F294351

General Info

Members Datasets Scaffolds Average Seq Length
191 136 189 102

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0118785|Ga0395899_0118785_1028_1393
Length 121
Sequence MKDAPSCAMTAIPNSRGSTMVANITSALNAYKAAAQAATGGGGMDARPTGKSFADVLGDLASSAKDEGVKAEKLGAAALLGKADYAEVVTAVANADVALQTVVTVRDKIISAYQDILKMPI

Samples

Sample ID Description Type Environment
1 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
2 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
128 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
129 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
130 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
131 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 1.57
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.71
Nodule 0
Rhizoplane 0.52
Rhizosphere 93.19
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10281024 3300003320 Bacteria 1211
2 Ga0070658_10474670 3300005327 Bacteria 1079
3 Ga0070683_100752366 3300005329 Bacteria 934
4 Ga0070680_100631658 3300005336 Bacteria 920
5 Ga0070680_100681668 3300005336 Bacteria 884
6 Ga0070682_101547953 3300005337 Bacteria 572
7 Ga0070660_100290074 3300005339 Bacteria 1340
8 Ga0070689_100332843 3300005340 Bacteria 1270
9 Ga0070691_10153233 3300005341 Bacteria 1183
10 Ga0070692_10190599 3300005345 Bacteria 1194
11 Ga0070659_100037083 3300005366 Bacteria 3800
12 Ga0070659_101214248 3300005366 Bacteria 667
13 Ga0070714_100000273 3300005435 Bacteria 39446
14 Ga0070714_101342887 3300005435 Bacteria 698
15 Ga0070713_100688511 3300005436 Bacteria 975
16 Ga0070701_11320276 3300005438 Bacteria 516
17 Ga0070708_100220357 3300005445 Bacteria 1779
18 Ga0070681_10004316 3300005458 Bacteria 13510
19 Ga0070681_10150195 3300005458 Bacteria 2256
20 Ga0070681_10459845 3300005458 Bacteria 1185
21 Ga0070681_10533785 3300005458 Bacteria 1087
22 Ga0070681_10623906 3300005458 Bacteria 993
23 Ga0070706_101632627 3300005467 Unclassified 588
24 Ga0070707_100375184 3300005468 Bacteria 1382
25 Ga0070707_100835520 3300005468 Bacteria 885
26 Ga0070698_100040474 3300005471 Bacteria 4789
27 Ga0070679_100011163 3300005530 Bacteria 8557
28 Ga0070679_100051844 3300005530 Bacteria 4087
29 Ga0070679_100744139 3300005530 Bacteria 923
30 Ga0070684_101639135 3300005535 Bacteria 607
31 Ga0068853_101837269 3300005539 Bacteria 587
32 Ga0070696_100143486 3300005546 Bacteria 1747
33 Ga0070693_100592169 3300005547 Unclassified 799
34 Ga0068855_100036769 3300005563 Bacteria 5826
35 Ga0068857_100253130 3300005577 Bacteria 1615
36 Ga0068854_100935475 3300005578 Bacteria 764
37 Ga0068856_100386627 3300005614 Bacteria 1419
38 Ga0070702_101363991 3300005615 Bacteria 578
39 Ga0068859_100399713 3300005617 Bacteria 1470
40 Ga0068866_10476705 3300005718 Bacteria 821
41 Ga0068863_100673114 3300005841 Bacteria 1027
42 Ga0068863_101256439 3300005841 Bacteria 747
43 Ga0068858_100415267 3300005842 Unclassified 1294
44 Ga0068862_100078763 3300005844 Bacteria 2856
45 Ga0070717_11624856 3300006028 Unclassified 585
46 Ga0070712_100674879 3300006175 Bacteria 879
47 Ga0075436_100131452 3300006914 Bacteria 1755
48 Ga0097620_100399666 3300006931 Bacteria 1470
49 Ga0105240_10051429 3300009093 Bacteria 5184
50 Ga0105240_10192831 3300009093 Bacteria 2394
51 Ga0105241_11976541 3300009174 Unclassified 573
52 Ga0105248_11990252 3300009177 Bacteria 660
53 Ga0105238_10505269 3300009551 Bacteria 1210
54 Ga0105249_11304003 3300009553 Bacteria 798
55 Ga0105239_10900436 3300010375 Unclassified 1015
56 Ga0157373_11134661 3300013100 Bacteria 587
57 Ga0157370_10004053 3300013104 Bacteria 17003
58 Ga0157370_10232682 3300013104 Bacteria 1705
59 Ga0157369_10022182 3300013105 Bacteria 7092
60 Ga0157369_10598426 3300013105 Bacteria 1138
61 Ga0157372_10160027 3300013307 Bacteria 2602
62 Ga0157372_10907310 3300013307 Bacteria 1022
63 Ga0182008_10009437 3300014497 Bacteria 5264
64 Ga0157376_10299504 3300014969 Bacteria 1522
65 Ga0206356_11771648 3300020070 Bacteria 560
66 Ga0206353_11528661 3300020082 Unclassified 551
67 Ga0213872_10017481 3300021361 Bacteria 3313
68 Ga0213872_10068880 3300021361 Bacteria 1596
69 Ga0213872_10116166 3300021361 Bacteria 1185
70 Ga0213871_10065557 3300021441 Bacteria 1018
71 Ga0213871_10104767 3300021441 Unclassified 831
72 Ga0207705_10229244 3300025909 Bacteria 1412
73 Ga0207684_11276354 3300025910 Unclassified 605
74 Ga0207707_10019503 3300025912 Bacteria 5920
75 Ga0207707_10260029 3300025912 Bacteria 1506
76 Ga0207707_10476143 3300025912 Bacteria 1067
77 Ga0207707_10542788 3300025912 Bacteria 988
78 Ga0207707_10588750 3300025912 Bacteria 942
79 Ga0207695_10078607 3300025913 Bacteria 3346
80 Ga0207695_10135371 3300025913 Bacteria 2417
81 Ga0207695_11705499 3300025913 Bacteria 511
82 Ga0207660_10001043 3300025917 Bacteria 18334
83 Ga0207660_10107130 3300025917 Bacteria 2097
84 Ga0207660_10959052 3300025917 Bacteria 698
85 Ga0207657_10187900 3300025919 Bacteria 1668
86 Ga0207652_10198743 3300025921 Bacteria 1804
87 Ga0207694_11377214 3300025924 Bacteria 596
88 Ga0207700_10639178 3300025928 Bacteria 948
89 Ga0207664_10003711 3300025929 Bacteria 10243
90 Ga0207664_10161913 3300025929 Bacteria 1909
91 Ga0207690_10103306 3300025932 Bacteria 2040
92 Ga0207706_11661877 3300025933 Unclassified 515
93 Ga0207670_10624930 3300025936 Bacteria 886
94 Ga0207670_11840050 3300025936 Bacteria 515
95 Ga0207703_10322963 3300026035 Unclassified 1414
96 Ga0207703_12200223 3300026035 Unclassified 527
97 Ga0207702_10258357 3300026078 Bacteria 1639
98 Ga0207702_10921640 3300026078 Bacteria 866
99 Ga0207641_11146365 3300026088 Bacteria 776
100 Ga0207674_10185086 3300026116 Bacteria 2033
101 Ga0268265_10657506 3300028380 Bacteria 1008
102 Ga0265338_10040598 3300028800 Bacteria 4368
103 Ga0265338_10202767 3300028800 Unclassified 1495
104 Ga0265338_10207014 3300028800 Bacteria 1475
105 Ga0265338_10542891 3300028800 Bacteria 814
106 Ga0265332_10295036 3300031238 Bacteria 669
107 Ga0265320_10005669 3300031240 Bacteria 7972
108 Ga0307408_100149225 3300031548 Bacteria 1844
109 Ga0265314_10006032 3300031711 Bacteria 10794
110 Ga0265314_10268144 3300031711 Bacteria 971
111 Ga0307412_11427047 3300031911 Bacteria 627
112 Ga0316593_10125184 3300032168 Bacteria 925
113 Ga0373953_0262173 3300035117 Bacteria 752
114 Ga0373943_0558113 3300035170 Bacteria 672
115 Ga0373955_0207383 3300035172 Bacteria 1168
116 Ga0373961_0049261 3300035241 Bacteria 1244
117 Ga0373933_0030896 3300035724 Bacteria 3104
118 Ga0373937_0087515 3300036401 Bacteria 2883
119 Ga0373925_1554902 3300037068 Bacteria 541
120 Ga0395899_0118785 3300037312 Bacteria 1895
121 Ga0395900_0024808 3300037418 Bacteria 6137
122 Ga0395900_0087809 3300037418 Bacteria 3196
123 Ga0395898_0002300 3300037466 Bacteria 22916
124 Ga0395898_0308225 3300037466 Bacteria 1510
125 Ga0395898_0346906 3300037466 Bacteria 1416
126 Ga0395898_0682576 3300037466 Bacteria 969
127 Ga0395901_0018601 3300038443 Bacteria 7096
128 Ga0395901_0076252 3300038443 Bacteria 3497
129 Ga0436365_1798591 3300039437 Bacteria 1464
130 Ga0436360_0003696 3300039438 Bacteria 2287
131 Ga0436360_0650170 3300039438 Unclassified 814
132 Ga0436360_1374615 3300039438 Bacteria 1308
133 Ga0436361_0338342 3300039447 Bacteria 4844
134 Ga0436361_0483890 3300039447 Bacteria 3532
135 Ga0436361_0725581 3300039447 Bacteria 2012
136 Ga0436362_0977111 3300039453 Bacteria 1457
137 Ga0466972_0056884 3300044658 Bacteria 1880
138 Ga0466972_0168834 3300044658 Bacteria 1027
139 Ga0453683_0013851 3300044673 Bacteria 5246
140 Ga0453683_0416065 3300044673 Bacteria 867
141 Ga0466963_0465849 3300044694 Bacteria 892
142 Ga0466960_0021116 3300044901 Bacteria 2895
143 Ga0451576_0002057 3300045051 Bacteria 31640
144 Ga0451576_0019821 3300045051 Bacteria 7336
145 Ga0451576_0045816 3300045051 Bacteria 4604
146 Ga0451576_0141922 3300045051 Bacteria 2504
147 Ga0466958_0193494 3300045836 Bacteria 1293
148 Ga0466958_1169529 3300045836 Bacteria 502
149 Ga0466967_0092037 3300045976 Bacteria 2757
150 Ga0466967_1014527 3300045976 Bacteria 826
151 Ga0495580_0044782 3300046472 Bacteria 3146
152 Ga0496115_0357567 3300048918 Bacteria 1190
153 Ga0496120_0138506 3300048923 Bacteria 1238
154 Ga0501034_0699760 3300049571 Bacteria 912
155 Ga0501036_0218847 3300049572 Bacteria 1599
156 Ga0501037_0950988 3300049573 Bacteria 561
157 Ga0501039_1181384 3300049575 Bacteria 592
158 Ga0501040_1147341 3300049576 Bacteria 564
159 Ga0501041_0333468 3300049577 Bacteria 957
160 Ga0501046_0680759 3300049580 Bacteria 726
161 Ga0501068_1151240 3300049584 Bacteria 513
162 Ga0501069_0077095 3300049585 Bacteria 1875
163 Ga0501070_0302702 3300049586 Bacteria 1302
164 Ga0501071_0801085 3300049587 Bacteria 726
165 Ga0501072_0104324 3300049588 Bacteria 2254
166 Ga0501074_0089864 3300049590 Bacteria 2200
167 Ga0501074_1036204 3300049590 Bacteria 577
168 Ga0501076_0527917 3300049592 Bacteria 973
169 Ga0501076_0560997 3300049592 Bacteria 942
170 Ga0501079_0053697 3300049741 Bacteria 3108
171 Ga0501080_0018667 3300049742 Bacteria 6419
172 Ga0501080_0081986 3300049742 Bacteria 2996
173 Ga0501080_0181114 3300049742 Bacteria 1939
174 Ga0501081_0187938 3300049743 Bacteria 1495
175 Ga0501083_0018317 3300049744 Bacteria 4880
176 Ga0501035_0612808 3300049822 Bacteria 886
177 Ga0501044_0182268 3300049823 Bacteria 2066
178 nmdc:mga08x19_632774_c1 3300050514 Unclassified 759
179 Ga0500643_026519 3300053087 Bacteria 1813
180 Ga0500643_061426 3300053087 Bacteria 1054
181 Ga0500555_004692 3300053103 Bacteria 3882
182 Ga0500562_000065 3300053108 Bacteria 51296
183 Ga0500652_001013 3300053131 Bacteria 9176
184 Ga0500604_0113245 3300053151 Bacteria 902
185 Ga0500616_0075627 3300053153 Bacteria 1704
186 Ga0500637_0006513 3300053178 Bacteria 5760
187 Ga0500645_021826 3300053730 Bacteria 1973
188 Ga0501082_0069001 3300060353 Bacteria 3044
189 Ga0530510_0069564 3300061734 Bacteria 2554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053178 Ga0500637_0006513 Ga0500637_0006513_2818_3123 82
2 3300021361 Ga0213872_10017481 Ga0213872_100174813 86
3 3300039447 Ga0436361_0483890 Ga0436361_0483890_1468_1773 86
4 3300028800 Ga0265338_10040598 Ga0265338_100405985 92
5 3300044658 Ga0466972_0056884 Ga0466972_0056884_276_596 93
6 3300049572 Ga0501036_0218847 Ga0501036_0218847_720_1049 94
7 3300049573 Ga0501037_0950988 Ga0501037_0950988_112_441 94
8 3300049575 Ga0501039_1181384 Ga0501039_1181384_36_365 94
9 3300049577 Ga0501041_0333468 Ga0501041_0333468_286_615 94
10 3300049587 Ga0501071_0801085 Ga0501071_0801085_353_682 94
11 3300049588 Ga0501072_0104324 Ga0501072_0104324_1757_2086 94
12 3300049590 Ga0501074_0089864 Ga0501074_0089864_210_539 94
13 3300049592 Ga0501076_0527917 Ga0501076_0527917_380_709 94
14 3300049741 Ga0501079_0053697 Ga0501079_0053697_176_505 94
15 3300049742 Ga0501080_0018667 Ga0501080_0018667_5944_6273 94
16 3300049743 Ga0501081_0187938 Ga0501081_0187938_725_1054 94
17 3300060353 Ga0501082_0069001 Ga0501082_0069001_2440_2769 94
18 3300061734 Ga0530510_0069564 Ga0530510_0069564_1536_1865 94
19 iso_pu_bacteria 2883291878 2883295429 95
20 3300044658 Ga0466972_0168834 Ga0466972_0168834_686_991 96
21 3300044901 Ga0466960_0021116 Ga0466960_0021116_1519_1824 96
22 iso_pu_bacteria 2883354860 2883358298 96
23 3300005327 Ga0070658_10474670 Ga0070658_104746703 98
24 3300005329 Ga0070683_100752366 Ga0070683_1007523663 98
25 3300005336 Ga0070680_100631658 Ga0070680_1006316582 98
26 3300005337 Ga0070682_101547953 Ga0070682_1015479531 98
27 3300005339 Ga0070660_100290074 Ga0070660_1002900742 98
28 3300005341 Ga0070691_10153233 Ga0070691_101532332 98
29 3300005345 Ga0070692_10190599 Ga0070692_101905993 98
30 3300005366 Ga0070659_100037083 Ga0070659_1000370834 98
31 3300005436 Ga0070713_100688511 Ga0070713_1006885112 98
32 3300005445 Ga0070708_100220357 Ga0070708_1002203571 98
33 3300005458 Ga0070681_10004316 Ga0070681_100043165 98
34 3300005458 Ga0070681_10459845 Ga0070681_104598453 98
35 3300005458 Ga0070681_10623906 Ga0070681_106239062 98
36 3300005467 Ga0070706_101632627 Ga0070706_1016326271 98
37 3300005468 Ga0070707_100835520 Ga0070707_1008355201 98
38 3300005530 Ga0070679_100011163 Ga0070679_1000111635 98
39 3300005535 Ga0070684_101639135 Ga0070684_1016391351 98
40 3300005577 Ga0068857_100253130 Ga0068857_1002531302 98
41 3300005578 Ga0068854_100935475 Ga0068854_1009354752 98
42 3300005614 Ga0068856_100386627 Ga0068856_1003866273 98
43 3300006914 Ga0075436_100131452 Ga0075436_1001314524 98
44 3300009093 Ga0105240_10051429 Ga0105240_100514293 98
45 3300009093 Ga0105240_10192831 Ga0105240_101928313 98
46 3300009177 Ga0105248_11990252 Ga0105248_119902522 98
47 3300009551 Ga0105238_10505269 Ga0105238_105052692 98
48 3300013100 Ga0157373_11134661 Ga0157373_111346612 98
49 3300013104 Ga0157370_10004053 Ga0157370_100040535 98
50 3300013104 Ga0157370_10232682 Ga0157370_102326823 98
51 3300013105 Ga0157369_10022182 Ga0157369_100221825 98
52 3300013105 Ga0157369_10598426 Ga0157369_105984263 98
53 3300013307 Ga0157372_10160027 Ga0157372_101600272 98
54 3300013307 Ga0157372_10907310 Ga0157372_109073102 98
55 3300014497 Ga0182008_10009437 Ga0182008_100094375 98
56 3300014969 Ga0157376_10299504 Ga0157376_102995042 98
57 3300020070 Ga0206356_11771648 Ga0206356_117716481 98
58 3300020082 Ga0206353_11528661 Ga0206353_115286612 98
59 3300025909 Ga0207705_10229244 Ga0207705_102292442 98
60 3300025910 Ga0207684_11276354 Ga0207684_112763542 98
61 3300025912 Ga0207707_10019503 Ga0207707_100195035 98
62 3300025912 Ga0207707_10476143 Ga0207707_104761432 98
63 3300025912 Ga0207707_10542788 Ga0207707_105427882 98
64 3300025913 Ga0207695_10078607 Ga0207695_100786073 98
65 3300025913 Ga0207695_10135371 Ga0207695_101353714 98
66 3300025917 Ga0207660_10001043 Ga0207660_100010438 98
67 3300025917 Ga0207660_10107130 Ga0207660_101071301 98
68 3300025917 Ga0207660_10959052 Ga0207660_109590521 98
69 3300025919 Ga0207657_10187900 Ga0207657_101879004 98
70 3300025921 Ga0207652_10198743 Ga0207652_101987431 98
71 3300025924 Ga0207694_11377214 Ga0207694_113772142 98
72 3300025928 Ga0207700_10639178 Ga0207700_106391783 98
73 3300025932 Ga0207690_10103306 Ga0207690_101033064 98
74 3300025933 Ga0207706_11661877 Ga0207706_116618771 98
75 3300026035 Ga0207703_12200223 Ga0207703_122002232 98
76 3300026078 Ga0207702_10921640 Ga0207702_109216402 98
77 3300026116 Ga0207674_10185086 Ga0207674_101850862 98
78 3300035117 Ga0373953_0262173 Ga0373953_0262173_415_717 98
79 3300035170 Ga0373943_0558113 Ga0373943_0558113_194_496 98
80 3300035172 Ga0373955_0207383 Ga0373955_0207383_86_388 98
81 3300035724 Ga0373933_0030896 Ga0373933_0030896_2272_2574 98
82 3300036401 Ga0373937_0087515 Ga0373937_0087515_785_1087 98
83 3300037068 Ga0373925_1554902 Ga0373925_1554902_14_325 98
84 3300037466 Ga0395898_0346906 Ga0395898_0346906_246_548 98
85 3300039437 Ga0436365_1798591 Ga0436365_1798591_589_891 98
86 3300044694 Ga0466963_0465849 Ga0466963_0465849_244_546 98
87 3300045836 Ga0466958_0193494 Ga0466958_0193494_874_1176 98
88 3300045836 Ga0466958_1169529 Ga0466958_1169529_17_316 98
89 3300045976 Ga0466967_0092037 Ga0466967_0092037_2384_2686 98
90 3300048918 Ga0496115_0357567 Ga0496115_0357567_470_772 98
91 3300049585 Ga0501069_0077095 Ga0501069_0077095_558_860 98
92 3300049586 Ga0501070_0302702 Ga0501070_0302702_191_493 98
93 3300049742 Ga0501080_0181114 Ga0501080_0181114_458_760 98
94 3300050514 nmdc:mga08x19_632774_c1 nmdc:mga08x19_632774_c1_147_458 98
95 3300053087 Ga0500643_026519 Ga0500643_026519_733_1044 98
96 3300053730 Ga0500645_021826 Ga0500645_021826_1078_1389 98
97 3300005336 Ga0070680_100681668 Ga0070680_1006816682 99
98 3300005435 Ga0070714_101342887 Ga0070714_1013428871 99
99 3300005458 Ga0070681_10150195 Ga0070681_101501956 99
100 3300005458 Ga0070681_10533785 Ga0070681_105337852 99
101 3300005468 Ga0070707_100375184 Ga0070707_1003751842 99
102 3300005471 Ga0070698_100040474 Ga0070698_1000404745 99
103 3300005530 Ga0070679_100051844 Ga0070679_1000518446 99
104 3300005530 Ga0070679_100744139 Ga0070679_1007441392 99
105 3300005539 Ga0068853_101837269 Ga0068853_1018372691 99
106 3300005546 Ga0070696_100143486 Ga0070696_1001434863 99
107 3300006028 Ga0070717_11624856 Ga0070717_116248562 99
108 3300006175 Ga0070712_100674879 Ga0070712_1006748791 99
109 3300021441 Ga0213871_10065557 Ga0213871_100655572 99
110 3300025912 Ga0207707_10260029 Ga0207707_102600293 99
111 3300025912 Ga0207707_10588750 Ga0207707_105887502 99
112 3300025913 Ga0207695_11705499 Ga0207695_117054991 99
113 3300025929 Ga0207664_10161913 Ga0207664_101619133 99
114 3300035241 Ga0373961_0049261 Ga0373961_0049261_49_354 99
115 3300039438 Ga0436360_0003696 Ga0436360_0003696_1124_1432 99
116 3300039438 Ga0436360_1374615 Ga0436360_1374615_908_1213 99
117 3300039453 Ga0436362_0977111 Ga0436362_0977111_419_736 99
118 3300044673 Ga0453683_0013851 Ga0453683_0013851_3058_3378 99
119 3300044673 Ga0453683_0416065 Ga0453683_0416065_243_560 99
120 3300045051 Ga0451576_0002057 Ga0451576_0002057_18437_18757 99
121 3300045051 Ga0451576_0019821 Ga0451576_0019821_5750_6070 99
122 3300045051 Ga0451576_0045816 Ga0451576_0045816_1245_1562 99
123 3300045051 Ga0451576_0141922 Ga0451576_0141922_341_658 99
124 3300046472 Ga0495580_0044782 Ga0495580_0044782_167_481 99
125 3300053087 Ga0500643_061426 Ga0500643_061426_506_811 99
126 3300053103 Ga0500555_004692 Ga0500555_004692_2833_3138 99
127 3300053108 Ga0500562_000065 Ga0500562_000065_31844_32152 99
128 3300053151 Ga0500604_0113245 Ga0500604_0113245_127_435 99
129 3300053153 Ga0500616_0075627 Ga0500616_0075627_906_1211 99
130 3300003320 rootH2_10281024 rootH2_102810242 100
131 3300005340 Ga0070689_100332843 Ga0070689_1003328433 100
132 3300005366 Ga0070659_101214248 Ga0070659_1012142482 100
133 3300005435 Ga0070714_100000273 Ga0070714_10000027316 100
134 3300005438 Ga0070701_11320276 Ga0070701_113202761 100
135 3300005547 Ga0070693_100592169 Ga0070693_1005921692 100
136 3300005563 Ga0068855_100036769 Ga0068855_1000367698 100
137 3300005615 Ga0070702_101363991 Ga0070702_1013639912 100
138 3300005617 Ga0068859_100399713 Ga0068859_1003997132 100
139 3300005718 Ga0068866_10476705 Ga0068866_104767052 100
140 3300005841 Ga0068863_100673114 Ga0068863_1006731143 100
141 3300005841 Ga0068863_101256439 Ga0068863_1012564391 100
142 3300005842 Ga0068858_100415267 Ga0068858_1004152672 100
143 3300005844 Ga0068862_100078763 Ga0068862_1000787633 100
144 3300006931 Ga0097620_100399666 Ga0097620_1003996662 100
145 3300009174 Ga0105241_11976541 Ga0105241_119765412 100
146 3300009553 Ga0105249_11304003 Ga0105249_113040031 100
147 3300010375 Ga0105239_10900436 Ga0105239_109004361 100
148 3300021361 Ga0213872_10068880 Ga0213872_100688804 100
149 3300021361 Ga0213872_10116166 Ga0213872_101161662 100
150 3300021441 Ga0213871_10104767 Ga0213871_101047672 100
151 3300025929 Ga0207664_10003711 Ga0207664_100037117 100
152 3300025936 Ga0207670_10624930 Ga0207670_106249302 100
153 3300025936 Ga0207670_11840050 Ga0207670_118400501 100
154 3300026035 Ga0207703_10322963 Ga0207703_103229633 100
155 3300026078 Ga0207702_10258357 Ga0207702_102583572 100
156 3300026088 Ga0207641_11146365 Ga0207641_111463651 100
157 3300028380 Ga0268265_10657506 Ga0268265_106575063 100
158 3300028800 Ga0265338_10202767 Ga0265338_102027672 100
159 3300028800 Ga0265338_10207014 Ga0265338_102070143 100
160 3300028800 Ga0265338_10542891 Ga0265338_105428912 100
161 3300031238 Ga0265332_10295036 Ga0265332_102950362 100
162 3300031240 Ga0265320_10005669 Ga0265320_1000566910 100
163 3300031548 Ga0307408_100149225 Ga0307408_1001492253 100
164 3300031711 Ga0265314_10006032 Ga0265314_100060327 100
165 3300031711 Ga0265314_10268144 Ga0265314_102681442 100
166 3300031911 Ga0307412_11427047 Ga0307412_114270472 100
167 3300032168 Ga0316593_10125184 Ga0316593_101251842 100
168 3300037312 Ga0395899_0118785 Ga0395899_0118785_1028_1393 100
169 3300037418 Ga0395900_0024808 Ga0395900_0024808_3347_3712 100
170 3300037418 Ga0395900_0087809 Ga0395900_0087809_2308_2628 100
171 3300037466 Ga0395898_0002300 Ga0395898_0002300_18792_19157 100
172 3300037466 Ga0395898_0308225 Ga0395898_0308225_903_1244 100
173 3300037466 Ga0395898_0682576 Ga0395898_0682576_23_343 100
174 3300038443 Ga0395901_0018601 Ga0395901_0018601_5635_5955 100
175 3300038443 Ga0395901_0076252 Ga0395901_0076252_2816_3181 100
176 3300039438 Ga0436360_0650170 Ga0436360_0650170_77_385 100
177 3300039447 Ga0436361_0338342 Ga0436361_0338342_3394_3699 100
178 3300039447 Ga0436361_0725581 Ga0436361_0725581_621_941 100
179 3300045976 Ga0466967_1014527 Ga0466967_1014527_275_580 100
180 3300048923 Ga0496120_0138506 Ga0496120_0138506_39_344 100
181 3300049571 Ga0501034_0699760 Ga0501034_0699760_293_604 100
182 3300049576 Ga0501040_1147341 Ga0501040_1147341_241_552 100
183 3300049580 Ga0501046_0680759 Ga0501046_0680759_233_544 100
184 3300049584 Ga0501068_1151240 Ga0501068_1151240_162_491 100
185 3300049590 Ga0501074_1036204 Ga0501074_1036204_16_327 100
186 3300049592 Ga0501076_0560997 Ga0501076_0560997_446_754 100
187 3300049742 Ga0501080_0081986 Ga0501080_0081986_2229_2546 100
188 3300049744 Ga0501083_0018317 Ga0501083_0018317_3155_3472 100
189 3300049822 Ga0501035_0612808 Ga0501035_0612808_283_594 100
190 3300049823 Ga0501044_0182268 Ga0501044_0182268_1229_1540 100
191 3300053131 Ga0500652_001013 Ga0500652_001013_5208_5513 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02049

FliE

Flagellar hook-basal body complex protein FliE

32

121

0.9

Feature Viewer

pLDDT pTM Quality
63.56 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map