F293930

General Info

Members Datasets Scaffolds Average Seq Length
191 128 382 260

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10139314|Ga0105240_101393142
Length 314
Sequence MQSGIESPDAGNRYLDADQAVWLGFVLRRAGIEFSLLIKRRLRQAGAVQSSPLMYRNKKVVVVMPAYNAARTLPQTYAEVRDQGLVDKIILVDDQSRDDTVAVARSLEGVEVHEHQKNTGYGGNQKTCYRLALEAGADIVIMIHPDYQYTPKLIPAMASMIANGLHPCVLGSRILGGYSLEGGMPGWKYVANRFLTFAENVLLGAKLSEYHTGYRAFSREILETLALANNSDDFVFDNQMLAQILWHGFTIGEVSCPTKYFKEASSINLPRSIKYGFGCLGTGLKFRLAKWGIARFKLFPPVSHGAQTAVRSAN

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
64 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 99.48
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10139314 3300009093 Bacteria 2902
2 Ga0065704_10129612 3300005289 Bacteria 1646
3 Ga0065707_10090571 3300005295 Unclassified 4114
4 Ga0070689_100095036 3300005340 Bacteria 2354
5 Ga0070691_10004219 3300005341 Bacteria 6534
6 Ga0070688_100103035 3300005365 Bacteria 1885
7 Ga0070714_100000692 3300005435 Bacteria 23833
8 Ga0070714_100325072 3300005435 Bacteria 1439
9 Ga0070705_100394221 3300005440 Unclassified 1023
10 Ga0070681_10045405 3300005458 Bacteria 4395
11 Ga0070707_100360017 3300005468 Bacteria 1413
12 Ga0070679_100043534 3300005530 Bacteria 4471
13 Ga0070697_100045607 3300005536 Unclassified 3552
14 Ga0070672_100068812 3300005543 Bacteria 2809
15 Ga0070686_100100079 3300005544 Bacteria 1957
16 Ga0068855_100044101 3300005563 Bacteria 5279
17 Ga0068855_100204298 3300005563 Bacteria 2223
18 Ga0068855_100651374 3300005563 Bacteria 1131
19 Ga0068859_100125632 3300005617 Bacteria 2634
20 Ga0068863_100029054 3300005841 Bacteria 5281
21 Ga0068863_100085489 3300005841 Bacteria 2989
22 Ga0068858_100056014 3300005842 Bacteria 3645
23 Ga0070717_10260251 3300006028 Unclassified 1535
24 Ga0097621_100229532 3300006237 Bacteria 1620
25 Ga0097621_100294907 3300006237 Bacteria 1431
26 Ga0068871_100389534 3300006358 Bacteria 1239
27 Ga0075428_100003485 3300006844 Bacteria 17222
28 Ga0075431_100110521 3300006847 Unclassified 2836
29 Ga0075433_10746532 3300006852 Bacteria 856
30 Ga0075429_100104975 3300006880 Bacteria 2468
31 Ga0097620_100125629 3300006931 Bacteria 2634
32 Ga0097620_100665936 3300006931 Bacteria 1132
33 Ga0105240_10001281 3300009093 Bacteria 43515
34 Ga0105240_10002699 3300009093 Bacteria 28216
35 Ga0111539_10020910 3300009094 Bacteria 8058
36 Ga0105245_10058875 3300009098 Bacteria 3458
37 Ga0114129_10182482 3300009147 Bacteria 2855
38 Ga0105242_10209492 3300009176 Bacteria 1736
39 Ga0105248_10203567 3300009177 Bacteria 2230
40 Ga0105238_10001822 3300009551 Bacteria 21360
41 Ga0157369_10261241 3300013105 Unclassified 1806
42 Ga0157374_10093304 3300013296 Bacteria 2874
43 Ga0157374_10342726 3300013296 Bacteria 1484
44 Ga0157375_10000282 3300013308 Bacteria 46322
45 Ga0157375_10491387 3300013308 Unclassified 1392
46 Ga0163163_10000074 3300014325 Bacteria 111318
47 Ga0163163_10098610 3300014325 Bacteria 2943
48 Ga0157380_10120935 3300014326 Bacteria 2218
49 Ga0206351_10517110 3300020077 Bacteria 1474
50 Ga0207680_10094422 3300025903 Bacteria 1910
51 Ga0207707_10075274 3300025912 Bacteria 2945
52 Ga0207695_10001316 3300025913 Bacteria 42089
53 Ga0207695_10003387 3300025913 Bacteria 22522
54 Ga0207695_10133523 3300025913 Bacteria 2437
55 Ga0207671_10000186 3300025914 Bacteria 95503
56 Ga0207663_10056293 3300025916 Bacteria 2472
57 Ga0207652_10025581 3300025921 Bacteria 4908
58 Ga0207694_10010649 3300025924 Bacteria 6938
59 Ga0207650_10060434 3300025925 Bacteria 2828
60 Ga0207659_10014028 3300025926 Bacteria 5157
61 Ga0207664_10000871 3300025929 Bacteria 20405
62 Ga0207690_10599093 3300025932 Bacteria 899
63 Ga0207686_10259234 3300025934 Bacteria 1274
64 Ga0207704_10347082 3300025938 Bacteria 1154
65 Ga0207711_10457848 3300025941 Bacteria 1188
66 Ga0207689_10112387 3300025942 Bacteria 2239
67 Ga0207667_10057956 3300025949 Bacteria 4064
68 Ga0207667_10814925 3300025949 Bacteria 929
69 Ga0207651_10422993 3300025960 Bacteria 1138
70 Ga0207641_10037943 3300026088 Bacteria 4026
71 Ga0207641_10090449 3300026088 Bacteria 2677
72 Ga0207674_10219236 3300026116 Bacteria 1850
73 Ga0207698_10291919 3300026142 Unclassified 1514
74 Ga0265337_1015865 3300028556 Unclassified 2452
75 Ga0265319_1000013 3300028563 Bacteria 180699
76 Ga0265319_1011156 3300028563 Bacteria 3700
77 Ga0265319_1012398 3300028563 Bacteria 3448
78 Ga0265334_10026960 3300028573 Unclassified 2316
79 Ga0265318_10025362 3300028577 Unclassified 2342
80 Ga0265323_10006660 3300028653 Bacteria 4843
81 Ga0265323_10015401 3300028653 Bacteria 3009
82 Ga0265323_10067466 3300028653 Bacteria 1230
83 Ga0265323_10069739 3300028653 Bacteria 1204
84 Ga0265322_10025486 3300028654 Unclassified 1691
85 Ga0265336_10002429 3300028666 Bacteria 7688
86 Ga0265338_10000487 3300028800 Bacteria 70806
87 Ga0265338_10000605 3300028800 Bacteria 62898
88 Ga0265338_10001032 3300028800 Bacteria 46571
89 Ga0265338_10003037 3300028800 Bacteria 24157
90 Ga0265338_10006433 3300028800 Bacteria 14972
91 Ga0265338_10031099 3300028800 Bacteria 5239
92 Ga0265338_10123530 3300028800 Bacteria 2058
93 Ga0265338_10316242 3300028800 Bacteria 1131
94 Ga0265324_10009563 3300029957 Bacteria 3778
95 Ga0265324_10023340 3300029957 Unclassified 2203
96 Ga0265320_10001081 3300031240 Bacteria 20109
97 Ga0265320_10005506 3300031240 Bacteria 8121
98 Ga0265320_10011491 3300031240 Bacteria 5206
99 Ga0265320_10032088 3300031240 Bacteria 2693
100 Ga0265325_10006169 3300031241 Bacteria 7313
101 Ga0265339_10006183 3300031249 Bacteria 7884
102 Ga0265316_10000019 3300031344 Bacteria 194648
103 Ga0265316_10001616 3300031344 Bacteria 24035
104 Ga0265316_10256794 3300031344 Bacteria 1282
105 Ga0265316_10259496 3300031344 Unclassified 1274
106 Ga0265313_10001441 3300031595 Bacteria 22204
107 Ga0265313_10007656 3300031595 Bacteria 7321
108 Ga0265313_10012234 3300031595 Bacteria 5255
109 Ga0265314_10006232 3300031711 Bacteria 10590
110 Ga0265342_10064360 3300031712 Bacteria 2152
111 Ga0265342_10133190 3300031712 Bacteria 1391
112 Ga0316576_10034058 3300031727 Bacteria 3629
113 Ga0316576_10158246 3300031727 Bacteria 1708
114 Ga0316578_10276413 3300031728 Bacteria 1006
115 Ga0373956_0188109 3300035119 Bacteria 977
116 Ga0316574_0178697 3300035398 Bacteria 1366
117 Ga0373927_0095869 3300035695 Bacteria 1928
118 Ga0373933_0082155 3300035724 Bacteria 1977
119 Ga0373947_0003149 3300035725 Bacteria 9822
120 Ga0373937_0011391 3300036401 Bacteria 7803
121 Ga0373937_0453826 3300036401 Bacteria 1217
122 Ga0373937_0757295 3300036401 Bacteria 919
123 Ga0316582_0439555 3300036647 Bacteria 899
124 Ga0316584_0211633 3300036712 Bacteria 1427
125 Ga0316584_0332298 3300036712 Bacteria 1094
126 Ga0373925_0002682 3300037068 Bacteria 14120
127 Ga0373925_0038334 3300037068 Bacteria 3543
128 Ga0451577_0004087 3300042876 Bacteria 15683
129 Ga0453684_0176948 3300044712 Bacteria 2508
130 Ga0453684_0654355 3300044712 Bacteria 1146
131 Ga0451576_0077980 3300045051 Bacteria 3448
132 Ga0451576_0138977 3300045051 Unclassified 2534
133 Ga0451576_0709468 3300045051 Unclassified 1057
134 Ga0495592_0000245 3300046454 Bacteria 46405
135 Ga0495592_0143590 3300046454 Bacteria 1658
136 Ga0495629_0064579 3300046459 Bacteria 2556
137 Ga0495629_0126819 3300046459 Bacteria 1778
138 Ga0495580_0266511 3300046472 Bacteria 1171
139 Ga0495639_0224868 3300046475 Bacteria 923
140 Ga0495662_0029047 3300046476 Bacteria 2670
141 Ga0495664_0005755 3300046477 Bacteria 6823
142 Ga0495618_0001517 3300046514 Bacteria 15587
143 Ga0495618_0002417 3300046514 Bacteria 12003
144 Ga0495628_0000030 3300046516 Bacteria 120546
145 Ga0495630_0000318 3300046517 Bacteria 38584
146 Ga0495630_0004646 3300046517 Bacteria 9638
147 Ga0495630_0013262 3300046517 Bacteria 5995
148 Ga0495630_0060536 3300046517 Bacteria 2842
149 Ga0495666_0024770 3300046526 Bacteria 2964
150 Ga0495652_0005003 3300046529 Bacteria 12556
151 Ga0495640_0035410 3300046533 Bacteria 3533
152 Ga0495586_0000205 3300046535 Bacteria 39531
153 Ga0495586_0001116 3300046535 Bacteria 15125
154 Ga0495586_0001554 3300046535 Bacteria 12676
155 Ga0495586_0001803 3300046535 Bacteria 11704
156 Ga0495645_0010243 3300046543 Bacteria 6569
157 Ga0495634_0003168 3300046642 Bacteria 13317
158 Ga0495635_0013204 3300046663 Bacteria 5783
159 Ga0495635_0125190 3300046663 Bacteria 1752
160 Ga0495659_0000143 3300046664 Bacteria 31297
161 Ga0495657_0040901 3300046675 Bacteria 3176
162 Ga0495599_0022370 3300046678 Bacteria 3946
163 Ga0495646_0068593 3300046680 Bacteria 2093
164 Ga0495646_0274285 3300046680 Bacteria 898
165 Ga0495647_0030242 3300046681 Bacteria 2008
166 Ga0495658_0002672 3300046683 Bacteria 8973
167 Ga0495613_0002183 3300046689 Bacteria 14816
168 Ga0495613_0168883 3300046689 Bacteria 1553
169 Ga0495613_0323636 3300046689 Bacteria 1064
170 Ga0495624_0354949 3300046690 Bacteria 882
171 Ga0495600_0264609 3300046809 Bacteria 1092
172 Ga0495674_0001955 3300047319 Bacteria 20326
173 Ga0495674_0005140 3300047319 Bacteria 12567
174 Ga0495674_0383625 3300047319 Bacteria 1137
175 Ga0495676_0056419 3300047321 Bacteria 3106
176 Ga0495680_0071354 3300047322 Bacteria 2644
177 Ga0495680_0327070 3300047322 Unclassified 1072
178 Ga0495675_0134155 3300047444 Bacteria 1538
179 Ga0495675_0178695 3300047444 Bacteria 1300
180 Ga0496106_0110906 3300048909 Bacteria 2136
181 Ga0501031_0078104 3300049568 Bacteria 2157
182 Ga0501032_0033554 3300049569 Bacteria 3516
183 Ga0501033_0078669 3300049570 Bacteria 2420
184 Ga0501033_0230693 3300049570 Bacteria 1315
185 Ga0501034_0450222 3300049571 Bacteria 1205
186 Ga0501037_0064331 3300049573 Bacteria 2673
187 Ga0501035_0008625 3300049822 Bacteria 9485
188 Ga0501044_0031577 3300049823 Bacteria 5574
189 nmdc:mga09592_72211_c1 3300050508 Unclassified 2930
190 nmdc:mga06r32_312472_c1 3300050510 Bacteria 1557
191 Ga0530510_0000439 3300061734 Bacteria 26850
192 Ga0105240_10139314
193 Ga0065704_10129612
194 Ga0065707_10090571
195 Ga0070689_100095036
196 Ga0070691_10004219
197 Ga0070688_100103035
198 Ga0070714_100000692
199 Ga0070714_100325072
200 Ga0070705_100394221
201 Ga0070681_10045405
202 Ga0070707_100360017
203 Ga0070679_100043534
204 Ga0070697_100045607
205 Ga0070672_100068812
206 Ga0070686_100100079
207 Ga0068855_100044101
208 Ga0068855_100204298
209 Ga0068855_100651374
210 Ga0068859_100125632
211 Ga0068863_100029054
212 Ga0068863_100085489
213 Ga0068858_100056014
214 Ga0070717_10260251
215 Ga0097621_100229532
216 Ga0097621_100294907
217 Ga0068871_100389534
218 Ga0075428_100003485
219 Ga0075431_100110521
220 Ga0075433_10746532
221 Ga0075429_100104975
222 Ga0097620_100125629
223 Ga0097620_100665936
224 Ga0105240_10001281
225 Ga0105240_10002699
226 Ga0111539_10020910
227 Ga0105245_10058875
228 Ga0114129_10182482
229 Ga0105242_10209492
230 Ga0105248_10203567
231 Ga0105238_10001822
232 Ga0157369_10261241
233 Ga0157374_10093304
234 Ga0157374_10342726
235 Ga0157375_10000282
236 Ga0157375_10491387
237 Ga0163163_10000074
238 Ga0163163_10098610
239 Ga0157380_10120935
240 Ga0206351_10517110
241 Ga0207680_10094422
242 Ga0207707_10075274
243 Ga0207695_10001316
244 Ga0207695_10003387
245 Ga0207695_10133523
246 Ga0207671_10000186
247 Ga0207663_10056293
248 Ga0207652_10025581
249 Ga0207694_10010649
250 Ga0207650_10060434
251 Ga0207659_10014028
252 Ga0207664_10000871
253 Ga0207690_10599093
254 Ga0207686_10259234
255 Ga0207704_10347082
256 Ga0207711_10457848
257 Ga0207689_10112387
258 Ga0207667_10057956
259 Ga0207667_10814925
260 Ga0207651_10422993
261 Ga0207641_10037943
262 Ga0207641_10090449
263 Ga0207674_10219236
264 Ga0207698_10291919
265 Ga0265337_1015865
266 Ga0265319_1000013
267 Ga0265319_1011156
268 Ga0265319_1012398
269 Ga0265334_10026960
270 Ga0265318_10025362
271 Ga0265323_10006660
272 Ga0265323_10015401
273 Ga0265323_10067466
274 Ga0265323_10069739
275 Ga0265322_10025486
276 Ga0265336_10002429
277 Ga0265338_10000487
278 Ga0265338_10000605
279 Ga0265338_10001032
280 Ga0265338_10003037
281 Ga0265338_10006433
282 Ga0265338_10031099
283 Ga0265338_10123530
284 Ga0265338_10316242
285 Ga0265324_10009563
286 Ga0265324_10023340
287 Ga0265320_10001081
288 Ga0265320_10005506
289 Ga0265320_10011491
290 Ga0265320_10032088
291 Ga0265325_10006169
292 Ga0265339_10006183
293 Ga0265316_10000019
294 Ga0265316_10001616
295 Ga0265316_10256794
296 Ga0265316_10259496
297 Ga0265313_10001441
298 Ga0265313_10007656
299 Ga0265313_10012234
300 Ga0265314_10006232
301 Ga0265342_10064360
302 Ga0265342_10133190
303 Ga0316576_10034058
304 Ga0316576_10158246
305 Ga0316578_10276413
306 Ga0373956_0188109
307 Ga0316574_0178697
308 Ga0373927_0095869
309 Ga0373933_0082155
310 Ga0373947_0003149
311 Ga0373937_0011391
312 Ga0373937_0453826
313 Ga0373937_0757295
314 Ga0316582_0439555
315 Ga0316584_0211633
316 Ga0316584_0332298
317 Ga0373925_0002682
318 Ga0373925_0038334
319 Ga0451577_0004087
320 Ga0453684_0176948
321 Ga0453684_0654355
322 Ga0451576_0077980
323 Ga0451576_0138977
324 Ga0451576_0709468
325 Ga0495592_0000245
326 Ga0495592_0143590
327 Ga0495629_0064579
328 Ga0495629_0126819
329 Ga0495580_0266511
330 Ga0495639_0224868
331 Ga0495662_0029047
332 Ga0495664_0005755
333 Ga0495618_0001517
334 Ga0495618_0002417
335 Ga0495628_0000030
336 Ga0495630_0000318
337 Ga0495630_0004646
338 Ga0495630_0013262
339 Ga0495630_0060536
340 Ga0495666_0024770
341 Ga0495652_0005003
342 Ga0495640_0035410
343 Ga0495586_0000205
344 Ga0495586_0001116
345 Ga0495586_0001554
346 Ga0495586_0001803
347 Ga0495645_0010243
348 Ga0495634_0003168
349 Ga0495635_0013204
350 Ga0495635_0125190
351 Ga0495659_0000143
352 Ga0495657_0040901
353 Ga0495599_0022370
354 Ga0495646_0068593
355 Ga0495646_0274285
356 Ga0495647_0030242
357 Ga0495658_0002672
358 Ga0495613_0002183
359 Ga0495613_0168883
360 Ga0495613_0323636
361 Ga0495624_0354949
362 Ga0495600_0264609
363 Ga0495674_0001955
364 Ga0495674_0005140
365 Ga0495674_0383625
366 Ga0495676_0056419
367 Ga0495680_0071354
368 Ga0495680_0327070
369 Ga0495675_0134155
370 Ga0495675_0178695
371 Ga0496106_0110906
372 Ga0501031_0078104
373 Ga0501032_0033554
374 Ga0501033_0078669
375 Ga0501033_0230693
376 Ga0501034_0450222
377 Ga0501037_0064331
378 Ga0501035_0008625
379 Ga0501044_0031577
380 nmdc:mga09592_72211_c1
381 nmdc:mga06r32_312472_c1
382 Ga0530510_0000439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

61

226

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7msk-assembly1.cif.gz_B thus glycosin s-glycosyltransferase 0.8557 5 93
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7972 6 240
7scj-assembly1.cif.gz_B cryo-em structure of the human exostosin-1 and exostosin-2 heterodimer in complex with a 4-sugar oligosaccharide acceptor analog 0.7902 4 120
7msn-assembly1.cif.gz_B suns glycosin s-glycosyltransferase 0.7663 5 116
7msp-assembly2.cif.gz_B suns glycosin s-glycosyltransferase 0.7646 5 116
ID Description Score Start End Superfamily
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8966 7 230 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8754 1 240 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8629 6 227 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8572 9 232 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8417 6 227 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V6LIP6-F1-model_v4 Glycosyl transferase family 2 0.9812 56 239 GO:0016740
AF-A0A3B9F0K6-F1-model_v4 Glycosyl transferase family 2 0.9811 41 246 GO:0016740
AF-A0A2V5PW17-F1-model_v4 Glycosyl transferase family 2 0.9799 65 245 GO:0016740
AF-A0A1V5YLC6-F1-model_v4 Undecaprenyl-phosphate mannosyltransferase (EC 2.4.1.54) 0.9764 5 246 GO:0047267
AF-A0A6A0IMX2-F1-model_v4 Glycosyltransferase family 2 protein 0.9755 1 247 GO:0016740

Map