F293908

General Info

Members Datasets Scaffolds Average Seq Length
191 110 382 83

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10017888|Ga0099795_100178882
Length 85
Sequence MTSRDPKHAFTSRPGDADTWIRAGDLSPPKNGAKAHHFTARLTIDITPDLRGRIKVAAFRRGITVAEMLRDLLSREFPPSPRGTA

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
15 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
16 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
21 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
22 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
36 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
39 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
40 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
41 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
46 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
47 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
48 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
49 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
52 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
56 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
57 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
58 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
59 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
60 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
61 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
62 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
63 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
64 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
65 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
66 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
67 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
81 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
87 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
94 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
95 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
96 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
100 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
101 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
102 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
103 2802429634 Rhizobium anhuiense S10 Isolate Nodule
104 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
105 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
106 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
107 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
108 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
109 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
110 2936381700 Rhizobium chutanense C16 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.24
Metatranscriptomes 0
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 3.66
Rhizoplane 2.09
Rhizosphere 85.86
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10017888 3300007788 Bacteria 2267
2 Ga0055531_10011238 3300003794 Bacteria 4347
3 Ga0070680_101667597 3300005336 Bacteria 552
4 Ga0070714_101455364 3300005435 Bacteria 669
5 Ga0070663_100810880 3300005455 Bacteria 803
6 Ga0070681_10297159 3300005458 Bacteria 1525
7 Ga0070684_100547124 3300005535 Bacteria 1074
8 Ga0068853_100471354 3300005539 Bacteria 1183
9 Ga0068855_101511256 3300005563 Bacteria 689
10 Ga0068852_102137883 3300005616 Bacteria 581
11 Ga0081540_1210344 3300005983 Bacteria 700
12 Ga0099794_10030794 3300007265 Bacteria 2507
13 Ga0099795_10529703 3300007788 Unclassified 553
14 Ga0105240_10177691 3300009093 Bacteria 2515
15 Ga0105240_12494579 3300009093 Bacteria 535
16 Ga0105237_10232826 3300009545 Bacteria 1843
17 Ga0105238_10010776 3300009551 Bacteria 9183
18 Ga0099796_10055816 3300010159 Bacteria 1384
19 Ga0157370_10174559 3300013104 Bacteria 1997
20 Ga0157369_10330689 3300013105 Bacteria 1583
21 Ga0157372_11286541 3300013307 Bacteria 844
22 Ga0213875_10008358 3300021388 Bacteria 5306
23 Ga0207425_1067314 3300025245 Bacteria 620
24 Ga0209233_1006613 3300025261 Bacteria 3723
25 Ga0209758_1003275 3300025297 Bacteria 15014
26 Ga0209257_1000490 3300025304 Bacteria 71185
27 Ga0207695_10101966 3300025913 Bacteria 2864
28 Ga0207671_10526733 3300025914 Bacteria 942
29 Ga0207660_10461481 3300025917 Bacteria 1028
30 Ga0207694_10002848 3300025924 Bacteria 13951
31 Ga0207664_10993871 3300025929 Bacteria 752
32 Ga0207667_11840183 3300025949 Bacteria 569
33 Ga0207639_10406243 3300026041 Bacteria 1228
34 Ga0207698_11719322 3300026142 Bacteria 643
35 Ga0265337_1006220 3300028556 Bacteria 4636
36 Ga0265338_10030806 3300028800 Bacteria 5273
37 Ga0265338_10530570 3300028800 Bacteria 826
38 Ga0265332_10151794 3300031238 Bacteria 969
39 Ga0265328_10001419 3300031239 Bacteria 11027
40 Ga0265325_10161251 3300031241 Bacteria 1055
41 Ga0265325_10316430 3300031241 Bacteria 694
42 Ga0265329_10030580 3300031242 Bacteria 1754
43 Ga0265329_10077839 3300031242 Bacteria 1050
44 Ga0265340_10073836 3300031247 Bacteria 1614
45 Ga0265331_10001163 3300031250 Bacteria 20063
46 Ga0265331_10063831 3300031250 Bacteria 1734
47 Ga0265327_10176191 3300031251 Bacteria 980
48 Ga0265316_10707760 3300031344 Bacteria 710
49 Ga0265313_10006131 3300031595 Bacteria 8636
50 Ga0265313_10084980 3300031595 Bacteria 1430
51 Ga0265313_10173790 3300031595 Bacteria 908
52 Ga0265313_10307166 3300031595 Bacteria 636
53 Ga0265314_10077495 3300031711 Bacteria 2205
54 Ga0265342_10224069 3300031712 Bacteria 1012
55 Ga0265342_10614640 3300031712 Bacteria 547
56 Ga0373936_0221899 3300035113 Bacteria 839
57 Ga0373943_0328663 3300035170 Bacteria 873
58 Ga0373927_0035165 3300035695 Bacteria 3258
59 Ga0373927_1114851 3300035695 Bacteria 520
60 Ga0373925_0044742 3300037068 Bacteria 3288
61 Ga0436364_0226891 3300037853 Bacteria 40228
62 Ga0436364_0808449 3300037853 Bacteria 589
63 Ga0436360_0095859 3300039438 Bacteria 1136
64 Ga0436360_0821867 3300039438 Bacteria 1084
65 Ga0436361_0220159 3300039447 Bacteria 1211
66 Ga0436361_0919825 3300039447 Bacteria 1119
67 Ga0466957_1202258 3300044842 Bacteria 548
68 Ga0466959_1024421 3300045049 Bacteria 550
69 Ga0495633_0000647 3300046558 Bacteria 32401
70 Ga0495671_0509909 3300046692 Bacteria 574
71 Ga0495636_0234733 3300047318 Bacteria 845
72 Ga0495686_0267191 3300047472 Bacteria 955
73 Ga0496103_0298317 3300048906 Bacteria 1037
74 Ga0496104_0142869 3300048907 Bacteria 2299
75 Ga0496105_0000078 3300048908 Bacteria 74087
76 Ga0496108_0017597 3300048911 Bacteria 5847
77 Ga0496116_0079732 3300048919 Bacteria 2036
78 Ga0496117_0450953 3300048920 Bacteria 636
79 Ga0496119_0091138 3300048922 Bacteria 1732
80 Ga0496120_0036548 3300048923 Bacteria 2922
81 Ga0501031_0163507 3300049568 Bacteria 1455
82 Ga0501031_0279938 3300049568 Bacteria 1082
83 Ga0501031_0706202 3300049568 Bacteria 647
84 Ga0501032_0000928 3300049569 Bacteria 23702
85 Ga0501032_0030602 3300049569 Bacteria 3694
86 Ga0501032_0253331 3300049569 Bacteria 1142
87 Ga0501033_0004165 3300049570 Bacteria 11648
88 Ga0501033_0084280 3300049570 Bacteria 2329
89 Ga0501033_0309266 3300049570 Bacteria 1111
90 Ga0501033_0330672 3300049570 Bacteria 1069
91 Ga0501033_0359879 3300049570 Bacteria 1018
92 Ga0501034_0011913 3300049571 Bacteria 8995
93 Ga0501034_0118686 3300049571 Bacteria 2632
94 Ga0501034_0331823 3300049571 Bacteria 1452
95 Ga0501034_0646258 3300049571 Bacteria 960
96 Ga0501034_0860702 3300049571 Bacteria 796
97 Ga0501034_1064065 3300049571 Bacteria 691
98 Ga0501034_1147964 3300049571 Bacteria 657
99 Ga0501036_0246061 3300049572 Bacteria 1499
100 Ga0501036_0410847 3300049572 Bacteria 1129
101 Ga0501036_1592440 3300049572 Bacteria 527
102 Ga0501037_0039000 3300049573 Bacteria 3498
103 Ga0501037_0147771 3300049573 Bacteria 1681
104 Ga0501037_0807831 3300049573 Bacteria 619
105 Ga0501037_0928964 3300049573 Bacteria 569
106 Ga0501038_0011506 3300049574 Bacteria 8073
107 Ga0501038_0151858 3300049574 Bacteria 1888
108 Ga0501038_0156926 3300049574 Bacteria 1852
109 Ga0501038_0172529 3300049574 Bacteria 1749
110 Ga0501038_0284680 3300049574 Bacteria 1300
111 Ga0501038_0621717 3300049574 Bacteria 815
112 Ga0501039_0005649 3300049575 Bacteria 9471
113 Ga0501039_0011198 3300049575 Bacteria 6834
114 Ga0501039_0149245 3300049575 Bacteria 1837
115 Ga0501039_0176506 3300049575 Bacteria 1680
116 Ga0501039_0279135 3300049575 Bacteria 1313
117 Ga0501039_1324897 3300049575 Bacteria 555
118 Ga0501040_0683755 3300049576 Bacteria 742
119 Ga0501040_1395268 3300049576 Bacteria 509
120 Ga0501043_0009832 3300049579 Bacteria 7498
121 Ga0501043_0356022 3300049579 Bacteria 1111
122 Ga0501046_0021105 3300049580 Bacteria 5378
123 Ga0501046_0181122 3300049580 Bacteria 1575
124 Ga0501046_0334387 3300049580 Bacteria 1102
125 Ga0501046_0827904 3300049580 Bacteria 648
126 Ga0501047_0003772 3300049581 Bacteria 14262
127 Ga0501047_0086863 3300049581 Bacteria 3005
128 Ga0501047_0315338 3300049581 Bacteria 1404
129 Ga0501047_0517876 3300049581 Bacteria 1019
130 Ga0501047_0712736 3300049581 Bacteria 820
131 Ga0501047_1041850 3300049581 Bacteria 631
132 Ga0501047_1173566 3300049581 Bacteria 581
133 Ga0501047_1320859 3300049581 Bacteria 535
134 Ga0501048_0100822 3300049582 Bacteria 2037
135 Ga0501048_0233303 3300049582 Bacteria 1306
136 Ga0501067_0178516 3300049583 Bacteria 1183
137 Ga0501067_0289534 3300049583 Bacteria 912
138 Ga0501069_0157173 3300049585 Bacteria 1308
139 Ga0501069_0227266 3300049585 Bacteria 1086
140 Ga0501070_0008102 3300049586 Bacteria 8894
141 Ga0501070_0064959 3300049586 Bacteria 3022
142 Ga0501070_0137756 3300049586 Bacteria 2015
143 Ga0501070_0569799 3300049586 Bacteria 905
144 Ga0501070_0925947 3300049586 Bacteria 679
145 Ga0501071_0754581 3300049587 Bacteria 750
146 Ga0501073_0021007 3300049589 Bacteria 4710
147 Ga0501073_0160490 3300049589 Bacteria 1558
148 Ga0501074_0105303 3300049590 Bacteria 2019
149 Ga0501074_0335939 3300049590 Bacteria 1072
150 Ga0501074_0936131 3300049590 Bacteria 610
151 Ga0501249_000023 3300049679 Bacteria 92139
152 Ga0501079_0342569 3300049741 Bacteria 1171
153 Ga0501079_1252998 3300049741 Bacteria 584
154 Ga0501080_0078515 3300049742 Bacteria 3070
155 Ga0501080_0110059 3300049742 Bacteria 2553
156 Ga0501080_0300017 3300049742 Bacteria 1457
157 Ga0501080_0820769 3300049742 Bacteria 814
158 Ga0501080_0909875 3300049742 Bacteria 766
159 Ga0501080_1214139 3300049742 Bacteria 648
160 Ga0501083_0208716 3300049744 Bacteria 1274
161 Ga0501035_0002472 3300049822 Bacteria 18050
162 Ga0501035_0110953 3300049822 Bacteria 2404
163 Ga0501035_0134043 3300049822 Bacteria 2157
164 Ga0501035_0141887 3300049822 Bacteria 2088
165 Ga0501044_0013021 3300049823 Bacteria 9001
166 Ga0501044_0114519 3300049823 Bacteria 2702
167 Ga0501044_0661972 3300049823 Bacteria 932
168 Ga0501044_1082454 3300049823 Bacteria 671
169 Ga0501044_1563532 3300049823 Bacteria 524
170 Ga0501044_1599655 3300049823 Bacteria 517
171 Ga0501045_0179538 3300049824 Bacteria 1577
172 Ga0501204_040574 3300049850 Bacteria 680
173 Ga0500655_017369 3300053133 Bacteria 1330
174 Ga0500590_359667 3300053148 Bacteria 516
175 Ga0500639_000069 3300053163 Bacteria 47153
176 Ga0501084_0232018 3300054114 Bacteria 1558
177 Ga0501084_1524228 3300054114 Bacteria 559
178 Ga0501082_0150587 3300060353 Bacteria 2021
179 Ga0501082_0366812 3300060353 Bacteria 1256
180 Ga0530510_0648608 3300061734 Bacteria 804
181 2513592879 2513237087 Bacteria 5817514
182 2514037577 2513237164 Bacteria 7563725
183 2585281053 2582581308 Bacteria 7413247
184 2806053758 2802429634 Bacteria 7083200
185 2806060958 2802429635 Bacteria 7650140
186 2806066753 2802429636 Bacteria 7597525
187 2856343076 2856342000 Bacteria 7176905
188 2871457627 2871451962 Bacteria 7336357
189 2883358101 2883354860 Bacteria 5865246
190 2891091115 2891088606 Bacteria 4762464
191 2936386257 2936381700 Bacteria 7006523
192 Ga0099795_10017888
193 Ga0055531_10011238
194 Ga0070680_101667597
195 Ga0070714_101455364
196 Ga0070663_100810880
197 Ga0070681_10297159
198 Ga0070684_100547124
199 Ga0068853_100471354
200 Ga0068855_101511256
201 Ga0068852_102137883
202 Ga0081540_1210344
203 Ga0099794_10030794
204 Ga0099795_10529703
205 Ga0105240_10177691
206 Ga0105240_12494579
207 Ga0105237_10232826
208 Ga0105238_10010776
209 Ga0099796_10055816
210 Ga0157370_10174559
211 Ga0157369_10330689
212 Ga0157372_11286541
213 Ga0213875_10008358
214 Ga0207425_1067314
215 Ga0209233_1006613
216 Ga0209758_1003275
217 Ga0209257_1000490
218 Ga0207695_10101966
219 Ga0207671_10526733
220 Ga0207660_10461481
221 Ga0207694_10002848
222 Ga0207664_10993871
223 Ga0207667_11840183
224 Ga0207639_10406243
225 Ga0207698_11719322
226 Ga0265337_1006220
227 Ga0265338_10030806
228 Ga0265338_10530570
229 Ga0265332_10151794
230 Ga0265328_10001419
231 Ga0265325_10161251
232 Ga0265325_10316430
233 Ga0265329_10030580
234 Ga0265329_10077839
235 Ga0265340_10073836
236 Ga0265331_10001163
237 Ga0265331_10063831
238 Ga0265327_10176191
239 Ga0265316_10707760
240 Ga0265313_10006131
241 Ga0265313_10084980
242 Ga0265313_10173790
243 Ga0265313_10307166
244 Ga0265314_10077495
245 Ga0265342_10224069
246 Ga0265342_10614640
247 Ga0373936_0221899
248 Ga0373943_0328663
249 Ga0373927_0035165
250 Ga0373927_1114851
251 Ga0373925_0044742
252 Ga0436364_0226891
253 Ga0436364_0808449
254 Ga0436360_0095859
255 Ga0436360_0821867
256 Ga0436361_0220159
257 Ga0436361_0919825
258 Ga0466957_1202258
259 Ga0466959_1024421
260 Ga0495633_0000647
261 Ga0495671_0509909
262 Ga0495636_0234733
263 Ga0495686_0267191
264 Ga0496103_0298317
265 Ga0496104_0142869
266 Ga0496105_0000078
267 Ga0496108_0017597
268 Ga0496116_0079732
269 Ga0496117_0450953
270 Ga0496119_0091138
271 Ga0496120_0036548
272 Ga0501031_0163507
273 Ga0501031_0279938
274 Ga0501031_0706202
275 Ga0501032_0000928
276 Ga0501032_0030602
277 Ga0501032_0253331
278 Ga0501033_0004165
279 Ga0501033_0084280
280 Ga0501033_0309266
281 Ga0501033_0330672
282 Ga0501033_0359879
283 Ga0501034_0011913
284 Ga0501034_0118686
285 Ga0501034_0331823
286 Ga0501034_0646258
287 Ga0501034_0860702
288 Ga0501034_1064065
289 Ga0501034_1147964
290 Ga0501036_0246061
291 Ga0501036_0410847
292 Ga0501036_1592440
293 Ga0501037_0039000
294 Ga0501037_0147771
295 Ga0501037_0807831
296 Ga0501037_0928964
297 Ga0501038_0011506
298 Ga0501038_0151858
299 Ga0501038_0156926
300 Ga0501038_0172529
301 Ga0501038_0284680
302 Ga0501038_0621717
303 Ga0501039_0005649
304 Ga0501039_0011198
305 Ga0501039_0149245
306 Ga0501039_0176506
307 Ga0501039_0279135
308 Ga0501039_1324897
309 Ga0501040_0683755
310 Ga0501040_1395268
311 Ga0501043_0009832
312 Ga0501043_0356022
313 Ga0501046_0021105
314 Ga0501046_0181122
315 Ga0501046_0334387
316 Ga0501046_0827904
317 Ga0501047_0003772
318 Ga0501047_0086863
319 Ga0501047_0315338
320 Ga0501047_0517876
321 Ga0501047_0712736
322 Ga0501047_1041850
323 Ga0501047_1173566
324 Ga0501047_1320859
325 Ga0501048_0100822
326 Ga0501048_0233303
327 Ga0501067_0178516
328 Ga0501067_0289534
329 Ga0501069_0157173
330 Ga0501069_0227266
331 Ga0501070_0008102
332 Ga0501070_0064959
333 Ga0501070_0137756
334 Ga0501070_0569799
335 Ga0501070_0925947
336 Ga0501071_0754581
337 Ga0501073_0021007
338 Ga0501073_0160490
339 Ga0501074_0105303
340 Ga0501074_0335939
341 Ga0501074_0936131
342 Ga0501249_000023
343 Ga0501079_0342569
344 Ga0501079_1252998
345 Ga0501080_0078515
346 Ga0501080_0110059
347 Ga0501080_0300017
348 Ga0501080_0820769
349 Ga0501080_0909875
350 Ga0501080_1214139
351 Ga0501083_0208716
352 Ga0501035_0002472
353 Ga0501035_0110953
354 Ga0501035_0134043
355 Ga0501035_0141887
356 Ga0501044_0013021
357 Ga0501044_0114519
358 Ga0501044_0661972
359 Ga0501044_1082454
360 Ga0501044_1563532
361 Ga0501044_1599655
362 Ga0501045_0179538
363 Ga0501204_040574
364 Ga0500655_017369
365 Ga0500590_359667
366 Ga0500639_000069
367 Ga0501084_0232018
368 Ga0501084_1524228
369 Ga0501082_0150587
370 Ga0501082_0366812
371 Ga0530510_0648608
372 2513592879
373 2514037577
374 2585281053
375 2806053758
376 2806060958
377 2806066753
378 2856343076
379 2871457627
380 2883358101
381 2891091115
382 2936386257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map