F292846

General Info

Members Datasets Scaffolds Average Seq Length
190 146 380 139

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_1540678|Ga0395901_1540678_57_512
Length 151
Sequence VTIRIDSSLEGIDWAQAKADLAADRFDNGRSAGALRRSFEQSAHVAFARDGDRVVGMARLLSDGVCNAYLVDVWTASPYRRRGIAGSMVRLLLDAVPGQHVGLQTDDAQAFYASLGFEPQPEFWSRVVGRWLDNDANRSPDRSPASAPPKP

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
62 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
73 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
86 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
87 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
88 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 4.74
Rhizosphere 90.53
Stem 0
Stem Tuber 0
Unclassified 18.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_1540678 3300038443 Bacteria 620
2 Ga0070658_11013876 3300005327 Bacteria 722
3 Ga0070658_11546094 3300005327 Unclassified 575
4 Ga0068869_100609856 3300005334 Unclassified 923
5 Ga0070682_100307405 3300005337 Bacteria 1166
6 Ga0070687_100681220 3300005343 Unclassified 716
7 Ga0070675_100721875 3300005354 Bacteria 908
8 Ga0070674_100004645 3300005356 Bacteria 7846
9 Ga0070674_100268624 3300005356 Bacteria 1347
10 Ga0070714_100000010 3300005435 Bacteria 262871
11 Ga0070714_100075726 3300005435 Bacteria 2920
12 Ga0070701_10049801 3300005438 Bacteria 2167
13 Ga0070711_100177838 3300005439 Bacteria 1627
14 Ga0070700_100000072 3300005441 Bacteria 71205
15 Ga0070694_101156395 3300005444 Unclassified 647
16 Ga0070678_100996996 3300005456 Bacteria 770
17 Ga0068867_100171927 3300005459 Bacteria 1717
18 Ga0070707_101839208 3300005468 Unclassified 573
19 Ga0070672_100698657 3300005543 Bacteria 888
20 Ga0070704_100146135 3300005549 Bacteria 1853
21 Ga0081455_10077060 3300005937 Bacteria 2744
22 Ga0070717_10074379 3300006028 Bacteria 2839
23 Ga0075365_10059331 3300006038 Bacteria 2550
24 Ga0070716_100324137 3300006173 Bacteria 1080
25 Ga0068871_100114810 3300006358 Bacteria 2269
26 Ga0068871_101013168 3300006358 Bacteria 774
27 Ga0075431_102074362 3300006847 Unclassified 523
28 Ga0075434_100348836 3300006871 Bacteria 1501
29 Ga0075429_100532307 3300006880 Bacteria 1030
30 Ga0068865_100089223 3300006881 Bacteria 2233
31 Ga0075435_100566749 3300007076 Unclassified 984
32 Ga0105240_10104552 3300009093 Bacteria 3439
33 Ga0111539_10125611 3300009094 Bacteria 3006
34 Ga0111539_10597198 3300009094 Unclassified 1285
35 Ga0105245_10085869 3300009098 Bacteria 2885
36 Ga0105245_10130081 3300009098 Bacteria 2360
37 Ga0105245_10166434 3300009098 Bacteria 2096
38 Ga0114129_10851048 3300009147 Bacteria 1159
39 Ga0114129_10864338 3300009147 Bacteria 1149
40 Ga0114129_11194490 3300009147 Bacteria 948
41 Ga0105243_10801088 3300009148 Bacteria 929
42 Ga0105242_10125572 3300009176 Bacteria 2208
43 Ga0105242_10710577 3300009176 Unclassified 984
44 Ga0105248_10206857 3300009177 Unclassified 2211
45 Ga0157370_10014169 3300013104 Bacteria 8174
46 Ga0157378_11282984 3300013297 Bacteria 773
47 Ga0157372_11234079 3300013307 Unclassified 863
48 Ga0157372_11977778 3300013307 Unclassified 670
49 Ga0157375_10181061 3300013308 Bacteria 2259
50 Ga0157375_11363343 3300013308 Bacteria 835
51 Ga0157375_13208060 3300013308 Unclassified 545
52 Ga0163163_10228732 3300014325 Bacteria 1909
53 Ga0157379_11816716 3300014968 Bacteria 599
54 Ga0157376_10404051 3300014969 Bacteria 1322
55 Ga0157376_11197260 3300014969 Bacteria 788
56 Ga0206353_11189505 3300020082 Bacteria 7023
57 Ga0213874_10066938 3300021377 Bacteria 1138
58 Ga0213875_10054095 3300021388 Bacteria 1880
59 Ga0207643_10260122 3300025908 Bacteria 1071
60 Ga0207705_10790980 3300025909 Bacteria 736
61 Ga0207684_10125344 3300025910 Bacteria 2203
62 Ga0207695_10150995 3300025913 Bacteria 2262
63 Ga0207693_10086656 3300025915 Bacteria 2454
64 Ga0207663_10317675 3300025916 Bacteria 1169
65 Ga0207646_10268786 3300025922 Bacteria 1541
66 Ga0207687_10095213 3300025927 Bacteria 2180
67 Ga0207664_10000009 3300025929 Bacteria 299246
68 Ga0207669_10481174 3300025937 Bacteria 990
69 Ga0207691_10133962 3300025940 Bacteria 2187
70 Ga0207689_10250264 3300025942 Bacteria 1465
71 Ga0207708_10000023 3300026075 Bacteria 176615
72 Ga0207683_10010015 3300026121 Bacteria 8089
73 Ga0265336_10038261 3300028666 Unclassified 1473
74 Ga0265338_10006251 3300028800 Bacteria 15241
75 Ga0265332_10051404 3300031238 Bacteria 1770
76 Ga0265325_10176209 3300031241 Bacteria 998
77 Ga0265339_10059334 3300031249 Bacteria 2063
78 Ga0265331_10081136 3300031250 Bacteria 1507
79 Ga0265327_10208028 3300031251 Bacteria 884
80 Ga0265316_10020903 3300031344 Bacteria 5559
81 Ga0265314_10005028 3300031711 Bacteria 12047
82 Ga0307407_10433283 3300031903 Bacteria 950
83 Ga0307409_100320996 3300031995 Unclassified 1449
84 Ga0307414_10457653 3300032004 Bacteria 1121
85 Ga0307415_100043028 3300032126 Bacteria 3010
86 Ga0373952_0057342 3300035092 Unclassified 944
87 Ga0373942_0205270 3300035207 Unclassified 655
88 Ga0373933_0859548 3300035724 Unclassified 597
89 Ga0373925_1064456 3300037068 Unclassified 666
90 Ga0373925_1338068 3300037068 Bacteria 587
91 Ga0373925_1573430 3300037068 Bacteria 537
92 Ga0395899_0569936 3300037312 Bacteria 725
93 Ga0395900_0280950 3300037418 Bacteria 1657
94 Ga0395898_0559212 3300037466 Bacteria 1086
95 Ga0395905_0158387 3300037471 Bacteria 2129
96 Ga0436364_0371351 3300037853 Unclassified 698
97 Ga0436364_1113081 3300037853 Bacteria 4450
98 Ga0395901_0188502 3300038443 Bacteria 2163
99 Ga0395901_1104000 3300038443 Bacteria 764
100 Ga0436365_1513747 3300039437 Bacteria 3861
101 Ga0436363_0023184 3300039450 Bacteria 2243
102 Ga0436362_0918678 3300039453 Bacteria 583
103 Ga0451853_0910909 3300041512 Bacteria 523
104 Ga0439450_042850 3300042008 Unclassified 1056
105 Ga0450920_066906 3300042122 Bacteria 729
106 Ga0450906_022010 3300042145 Bacteria 1137
107 Ga0450910_044080 3300042147 Unclassified 726
108 Ga0466965_0253710 3300044683 Bacteria 944
109 Ga0466961_0129086 3300044693 Bacteria 1585
110 Ga0466961_0237422 3300044693 Unclassified 1121
111 Ga0466963_0011333 3300044694 Bacteria 5426
112 Ga0466963_0025425 3300044694 Bacteria 3776
113 Ga0466963_0283164 3300044694 Unclassified 1165
114 Ga0466963_0509836 3300044694 Bacteria 849
115 Ga0466964_0229534 3300044706 Bacteria 905
116 Ga0466964_0469372 3300044706 Unclassified 671
117 Ga0466957_0109387 3300044842 Bacteria 1751
118 Ga0466957_0383454 3300044842 Bacteria 959
119 Ga0466959_0190856 3300045049 Bacteria 1430
120 Ga0466959_0988925 3300045049 Unclassified 560
121 Ga0466958_0110241 3300045836 Bacteria 1718
122 Ga0466967_0524322 3300045976 Bacteria 1164
123 Ga0466967_2238454 3300045976 Bacteria 542
124 Ga0466967_2266056 3300045976 Bacteria 539
125 Ga0495592_0136632 3300046454 Bacteria 1709
126 Ga0495603_0186144 3300046455 Bacteria 1201
127 Ga0495603_0251658 3300046455 Unclassified 1017
128 Ga0495629_0170791 3300046459 Bacteria 1509
129 Ga0495651_0005037 3300046462 Bacteria 10091
130 Ga0495653_0086266 3300046463 Bacteria 2307
131 Ga0495653_0204138 3300046463 Bacteria 1339
132 Ga0495608_0542508 3300046511 Bacteria 701
133 Ga0495618_0154710 3300046514 Bacteria 1464
134 Ga0495618_0354999 3300046514 Bacteria 903
135 Ga0495628_0573736 3300046516 Bacteria 808
136 Ga0495630_0029997 3300046517 Bacteria 4044
137 Ga0495630_1220007 3300046517 Unclassified 568
138 Ga0495666_0089536 3300046526 Bacteria 1453
139 Ga0495652_0176329 3300046529 Bacteria 1645
140 Ga0495640_0004912 3300046533 Bacteria 10623
141 Ga0495640_0069361 3300046533 Bacteria 2371
142 Ga0495587_0422939 3300046536 Unclassified 739
143 Ga0495667_0033796 3300046559 Bacteria 3422
144 Ga0495667_0209962 3300046559 Bacteria 1244
145 Ga0495656_0330594 3300046615 Bacteria 787
146 Ga0495634_0102985 3300046642 Bacteria 1843
147 Ga0495634_0325601 3300046642 Bacteria 924
148 Ga0495635_0063731 3300046663 Bacteria 2531
149 Ga0495635_0120514 3300046663 Bacteria 1789
150 Ga0495657_0029380 3300046675 Bacteria 3856
151 Ga0495624_0416176 3300046690 Unclassified 806
152 Ga0495600_0180252 3300046809 Bacteria 1361
153 Ga0495604_0044973 3300047317 Bacteria 3447
154 Ga0495674_0006873 3300047319 Bacteria 10887
155 Ga0495674_0171418 3300047319 Bacteria 1811
156 Ga0495674_0250557 3300047319 Bacteria 1457
157 Ga0495680_0008306 3300047322 Bacteria 9451
158 Ga0495680_0077828 3300047322 Bacteria 2511
159 Ga0495684_0032718 3300047471 Bacteria 3994
160 Ga0495684_0037207 3300047471 Bacteria 3732
161 Ga0495602_0273102 3300048088 Bacteria 1249
162 Ga0496101_0166604 3300048904 Bacteria 1692
163 Ga0496104_0189682 3300048907 Unclassified 1967
164 Ga0496105_0070423 3300048908 Bacteria 2891
165 Ga0496106_0702352 3300048909 Bacteria 806
166 Ga0496108_0860069 3300048911 Bacteria 780
167 Ga0496109_0671039 3300048912 Bacteria 974
168 Ga0496111_0828572 3300048914 Bacteria 669
169 Ga0496114_0552407 3300048917 Bacteria 1017
170 Ga0496115_0021416 3300048918 Bacteria 4995
171 Ga0501036_1235464 3300049572 Bacteria 608
172 Ga0501071_0125353 3300049587 Bacteria 1906
173 Ga0501075_1161079 3300049591 Bacteria 586
174 nmdc:mga0yw44_180703_c1 3300050492 Unclassified 1388
175 nmdc:mga05p37_614695_c1 3300050507 Bacteria 1224
176 nmdc:mga09592_211956_c1 3300050508 Bacteria 1678
177 nmdc:mga06r32_1182_c1 3300050510 Bacteria 23541
178 nmdc:mga06r32_334898_c1 3300050510 Bacteria 1498
179 nmdc:mga06r32_689650_c1 3300050510 Bacteria 988
180 nmdc:mga08y16_1078073_c1 3300050511 Unclassified 779
181 nmdc:mga0n895_133111_c1 3300050512 Bacteria 2512
182 nmdc:mga0n895_363192_c1 3300050512 Bacteria 1466
183 nmdc:mga0rr50_1530671_c1 3300050513 Unclassified 564
184 nmdc:mga0a205_842628_c1 3300050515 Unclassified 764
185 Ga0495601_0109814 3300053077 Bacteria 1786
186 Ga0495619_0072140 3300053085 Bacteria 2312
187 Ga0501084_0803641 3300054114 Bacteria 792
188 Ga0501082_0805630 3300060353 Bacteria 822
189 Ga0530510_0218910 3300061734 Bacteria 1415
190 Ga0530510_0915495 3300061734 Unclassified 670
191 Ga0395901_1540678
192 Ga0070658_11013876
193 Ga0070658_11546094
194 Ga0068869_100609856
195 Ga0070682_100307405
196 Ga0070687_100681220
197 Ga0070675_100721875
198 Ga0070674_100004645
199 Ga0070674_100268624
200 Ga0070714_100000010
201 Ga0070714_100075726
202 Ga0070701_10049801
203 Ga0070711_100177838
204 Ga0070700_100000072
205 Ga0070694_101156395
206 Ga0070678_100996996
207 Ga0068867_100171927
208 Ga0070707_101839208
209 Ga0070672_100698657
210 Ga0070704_100146135
211 Ga0081455_10077060
212 Ga0070717_10074379
213 Ga0075365_10059331
214 Ga0070716_100324137
215 Ga0068871_100114810
216 Ga0068871_101013168
217 Ga0075431_102074362
218 Ga0075434_100348836
219 Ga0075429_100532307
220 Ga0068865_100089223
221 Ga0075435_100566749
222 Ga0105240_10104552
223 Ga0111539_10125611
224 Ga0111539_10597198
225 Ga0105245_10085869
226 Ga0105245_10130081
227 Ga0105245_10166434
228 Ga0114129_10851048
229 Ga0114129_10864338
230 Ga0114129_11194490
231 Ga0105243_10801088
232 Ga0105242_10125572
233 Ga0105242_10710577
234 Ga0105248_10206857
235 Ga0157370_10014169
236 Ga0157378_11282984
237 Ga0157372_11234079
238 Ga0157372_11977778
239 Ga0157375_10181061
240 Ga0157375_11363343
241 Ga0157375_13208060
242 Ga0163163_10228732
243 Ga0157379_11816716
244 Ga0157376_10404051
245 Ga0157376_11197260
246 Ga0206353_11189505
247 Ga0213874_10066938
248 Ga0213875_10054095
249 Ga0207643_10260122
250 Ga0207705_10790980
251 Ga0207684_10125344
252 Ga0207695_10150995
253 Ga0207693_10086656
254 Ga0207663_10317675
255 Ga0207646_10268786
256 Ga0207687_10095213
257 Ga0207664_10000009
258 Ga0207669_10481174
259 Ga0207691_10133962
260 Ga0207689_10250264
261 Ga0207708_10000023
262 Ga0207683_10010015
263 Ga0265336_10038261
264 Ga0265338_10006251
265 Ga0265332_10051404
266 Ga0265325_10176209
267 Ga0265339_10059334
268 Ga0265331_10081136
269 Ga0265327_10208028
270 Ga0265316_10020903
271 Ga0265314_10005028
272 Ga0307407_10433283
273 Ga0307409_100320996
274 Ga0307414_10457653
275 Ga0307415_100043028
276 Ga0373952_0057342
277 Ga0373942_0205270
278 Ga0373933_0859548
279 Ga0373925_1064456
280 Ga0373925_1338068
281 Ga0373925_1573430
282 Ga0395899_0569936
283 Ga0395900_0280950
284 Ga0395898_0559212
285 Ga0395905_0158387
286 Ga0436364_0371351
287 Ga0436364_1113081
288 Ga0395901_0188502
289 Ga0395901_1104000
290 Ga0436365_1513747
291 Ga0436363_0023184
292 Ga0436362_0918678
293 Ga0451853_0910909
294 Ga0439450_042850
295 Ga0450920_066906
296 Ga0450906_022010
297 Ga0450910_044080
298 Ga0466965_0253710
299 Ga0466961_0129086
300 Ga0466961_0237422
301 Ga0466963_0011333
302 Ga0466963_0025425
303 Ga0466963_0283164
304 Ga0466963_0509836
305 Ga0466964_0229534
306 Ga0466964_0469372
307 Ga0466957_0109387
308 Ga0466957_0383454
309 Ga0466959_0190856
310 Ga0466959_0988925
311 Ga0466958_0110241
312 Ga0466967_0524322
313 Ga0466967_2238454
314 Ga0466967_2266056
315 Ga0495592_0136632
316 Ga0495603_0186144
317 Ga0495603_0251658
318 Ga0495629_0170791
319 Ga0495651_0005037
320 Ga0495653_0086266
321 Ga0495653_0204138
322 Ga0495608_0542508
323 Ga0495618_0154710
324 Ga0495618_0354999
325 Ga0495628_0573736
326 Ga0495630_0029997
327 Ga0495630_1220007
328 Ga0495666_0089536
329 Ga0495652_0176329
330 Ga0495640_0004912
331 Ga0495640_0069361
332 Ga0495587_0422939
333 Ga0495667_0033796
334 Ga0495667_0209962
335 Ga0495656_0330594
336 Ga0495634_0102985
337 Ga0495634_0325601
338 Ga0495635_0063731
339 Ga0495635_0120514
340 Ga0495657_0029380
341 Ga0495624_0416176
342 Ga0495600_0180252
343 Ga0495604_0044973
344 Ga0495674_0006873
345 Ga0495674_0171418
346 Ga0495674_0250557
347 Ga0495680_0008306
348 Ga0495680_0077828
349 Ga0495684_0032718
350 Ga0495684_0037207
351 Ga0495602_0273102
352 Ga0496101_0166604
353 Ga0496104_0189682
354 Ga0496105_0070423
355 Ga0496106_0702352
356 Ga0496108_0860069
357 Ga0496109_0671039
358 Ga0496111_0828572
359 Ga0496114_0552407
360 Ga0496115_0021416
361 Ga0501036_1235464
362 Ga0501071_0125353
363 Ga0501075_1161079
364 nmdc:mga0yw44_180703_c1
365 nmdc:mga05p37_614695_c1
366 nmdc:mga09592_211956_c1
367 nmdc:mga06r32_1182_c1
368 nmdc:mga06r32_334898_c1
369 nmdc:mga06r32_689650_c1
370 nmdc:mga08y16_1078073_c1
371 nmdc:mga0n895_133111_c1
372 nmdc:mga0n895_363192_c1
373 nmdc:mga0rr50_1530671_c1
374 nmdc:mga0a205_842628_c1
375 Ga0495601_0109814
376 Ga0495619_0072140
377 Ga0501084_0803641
378 Ga0501082_0805630
379 Ga0530510_0218910
380 Ga0530510_0915495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

5

123

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

10

117

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

41

119

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6f-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase (dr_1678) from deinococcus radiodurans r1 at 1.19 a resolution 0.8886 5 122
7dai-assembly2.cif.gz_C the crystal structure of a serotonin n-acetyltransferase from oryza sativa 0.8866 5 123
7dal-assembly1.cif.gz_B the crystal structure of a serotonin n-acetyltransferase in complex with serotonin and acetyl-coa from oryza sativa 0.877 5 123
7daj-assembly1.cif.gz_B the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa 0.87 5 123
1y7r-assembly1.cif.gz_B 1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase 0.8648 4 123
ID Description Score Start End Superfamily
af_Q59V67_76_339_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8985 69 121 3.40.630.30
af_Q2FVP9_1_111_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8919 30 123 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.884 55 98 3.40.630.30
af_Q6Z1Y6_51_185_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8822 5 123 3.40.630.30
3s6fA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.882 5 125 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1Z4SGS2-F1-model_v4 deleted 0.9839 3 84
AF-A0A0E3PKF5-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9556 5 99 GO:0005737
GO:0008080
AF-A0A5S9IVI6-F1-model_v4 N-acetyltransferase 0.9454 4 123 GO:0005737
GO:0008080
AF-A0A0F6AGD1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9448 4 124 GO:0016747
AF-A0A3D1RBS1-F1-model_v4 GNAT family N-acetyltransferase 0.9446 5 123 GO:0005737
GO:0008080

Map