F292845

General Info

Members Datasets Scaffolds Average Seq Length
190 130 380 276

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0467006|Ga0395901_0467006_35_898
Length 287
Sequence MESGENAKTKAATTYNAASDYYDNPVNSFWERFGRRTIQRLNLSPGAQVLDVCCGSGASAIPCAETVGSDGFVLGVDLAENLLELAREKAQQRGLTNIEFRTGDMLNLGLPESRFDAVVCVFGIFFVPDMSAAVRELWKRVRVGGKLAITTWGPRLFEPANSAFWNSIRGVRPELYKGFNPWDRISDTEGVRSMFSAAGIQSAVSIQDVQIVPETGVHKLSSPEAWWTMVLGSGYRGTVAQLNEVDRERVRQENLDFIRRADVHSVEANVVYAVAVRGVHEVGTTSR

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
89 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
90 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
93 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
94 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
95 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
96 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
97 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
98 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
99 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
100 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
101 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
102 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
103 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
104 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
105 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
106 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
107 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
108 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
109 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
110 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
111 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
112 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
113 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
114 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
115 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
116 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
117 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
118 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
119 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
120 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
121 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
122 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
123 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 98.42
Stem 0
Stem Tuber 0
Unclassified 27.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0467006 3300038443 Bacteria 1289
2 SwRhRL2b_contig_956848 2162886007 Bacteria 2761
3 rootL2_10064411 3300003322 Bacteria 4126
4 Ga0065704_10081227 3300005289 Unclassified 3799
5 Ga0065704_10118442 3300005289 Bacteria 1816
6 Ga0065712_10005954 3300005290 Bacteria 2736
7 Ga0065707_10003080 3300005295 Unclassified 4866
8 Ga0065707_10005921 3300005295 Bacteria 3613
9 Ga0070670_100214105 3300005331 Bacteria 1675
10 Ga0068869_100090845 3300005334 Bacteria 2296
11 Ga0068869_100247731 3300005334 Bacteria 1422
12 Ga0070682_100012642 3300005337 Unclassified 4843
13 Ga0070687_100187466 3300005343 Bacteria 1244
14 Ga0070692_10060069 3300005345 Bacteria 2000
15 Ga0070667_100177203 3300005367 Bacteria 1884
16 Ga0070705_100075568 3300005440 Bacteria 2051
17 Ga0070705_100082473 3300005440 Unclassified 1979
18 Ga0070705_100105824 3300005440 Bacteria 1787
19 Ga0070705_100200464 3300005440 Bacteria 1368
20 Ga0070700_100022856 3300005441 Unclassified 3652
21 Ga0070694_100004102 3300005444 Bacteria 8744
22 Ga0070694_100201399 3300005444 Bacteria 1484
23 Ga0070678_100028697 3300005456 Bacteria 3799
24 Ga0068867_100050265 3300005459 Bacteria 3072
25 Ga0068867_100107924 3300005459 Bacteria 2134
26 Ga0070698_100006699 3300005471 Bacteria 12493
27 Ga0070699_100000894 3300005518 Bacteria 27843
28 Ga0070699_100097674 3300005518 Unclassified 2573
29 Ga0070699_100344414 3300005518 Bacteria 1342
30 Ga0070679_100068270 3300005530 Bacteria 3546
31 Ga0070697_100134753 3300005536 Bacteria 2073
32 Ga0068853_100520207 3300005539 Bacteria 1125
33 Ga0070695_100039880 3300005545 Unclassified 2970
34 Ga0070696_100177856 3300005546 Unclassified 1577
35 Ga0070693_100020411 3300005547 Bacteria 3493
36 Ga0070704_100227938 3300005549 Bacteria 1518
37 Ga0068857_100050087 3300005577 Bacteria 3705
38 Ga0068856_100123337 3300005614 Bacteria 2593
39 Ga0070702_100005534 3300005615 Bacteria 5899
40 Ga0068852_100098430 3300005616 Unclassified 2634
41 Ga0068859_100035476 3300005617 Bacteria 5004
42 Ga0068859_100037150 3300005617 Bacteria 4888
43 Ga0068859_100199417 3300005617 Bacteria 2086
44 Ga0068864_100014613 3300005618 Bacteria 6520
45 Ga0068864_100078877 3300005618 Bacteria 2883
46 Ga0068861_100033949 3300005719 Bacteria 3768
47 Ga0068861_100113106 3300005719 Bacteria 2178
48 Ga0068870_10012171 3300005840 Bacteria 4012
49 Ga0068858_100011827 3300005842 Bacteria 8228
50 Ga0068858_100142142 3300005842 Unclassified 2253
51 Ga0068860_100045266 3300005843 Unclassified 4196
52 Ga0068860_100233335 3300005843 Unclassified 1788
53 Ga0070716_100419830 3300006173 Unclassified 967
54 Ga0070712_100122973 3300006175 Bacteria 1955
55 Ga0097621_100015674 3300006237 Bacteria 5711
56 Ga0068871_100015001 3300006358 Bacteria 5794
57 Ga0075430_100174928 3300006846 Bacteria 1786
58 Ga0075433_10023046 3300006852 Bacteria 5236
59 Ga0075433_10040423 3300006852 Archaea 4036
60 Ga0075434_100086786 3300006871 Bacteria 3129
61 Ga0075434_100512753 3300006871 Bacteria 1220
62 Ga0075434_100569814 3300006871 Unclassified 1152
63 Ga0097620_100037150 3300006931 Bacteria 4888
64 Ga0097620_100199420 3300006931 Bacteria 2086
65 Ga0075435_100290426 3300007076 Unclassified 1397
66 Ga0105240_10746508 3300009093 Bacteria 1064
67 Ga0111539_10005446 3300009094 Bacteria 16465
68 Ga0111539_10029159 3300009094 Bacteria 6727
69 Ga0114129_10005907 3300009147 Bacteria 17317
70 Ga0114129_10018821 3300009147 Bacteria 9835
71 Ga0114129_10128156 3300009147 Unclassified 3488
72 Ga0114129_10497194 3300009147 Bacteria 1593
73 Ga0105243_10012356 3300009148 Bacteria 6456
74 Ga0105243_10122493 3300009148 Bacteria 2195
75 Ga0105243_10369279 3300009148 Bacteria 1323
76 Ga0105241_10017367 3300009174 Bacteria 5287
77 Ga0105241_10095331 3300009174 Bacteria 2355
78 Ga0105242_10115730 3300009176 Bacteria 2293
79 Ga0105242_10236597 3300009176 Bacteria 1639
80 Ga0105249_10022682 3300009553 Bacteria 5625
81 Ga0105249_10027619 3300009553 Bacteria 5121
82 Ga0105249_10106419 3300009553 Bacteria 2646
83 Ga0157378_10029427 3300013297 Bacteria 4848
84 Ga0163163_10013704 3300014325 Bacteria 7429
85 Ga0157376_10315977 3300014969 Bacteria 1483
86 Ga0207647_10008304 3300025904 Bacteria 7449
87 Ga0207695_10344383 3300025913 Unclassified 1378
88 Ga0207671_10092016 3300025914 Bacteria 2286
89 Ga0207652_10239711 3300025921 Bacteria 1635
90 Ga0207659_10274099 3300025926 Bacteria 1377
91 Ga0207686_10046190 3300025934 Bacteria 2685
92 Ga0207709_10006574 3300025935 Bacteria 6527
93 Ga0207711_10049694 3300025941 Bacteria 3590
94 Ga0207689_10067725 3300025942 Unclassified 2934
95 Ga0207689_10079710 3300025942 Bacteria 2691
96 Ga0207689_10326223 3300025942 Bacteria 1274
97 Ga0207667_10192820 3300025949 Bacteria 2091
98 Ga0207651_10064529 3300025960 Bacteria 2564
99 Ga0207712_10071152 3300025961 Bacteria 2501
100 Ga0207712_10119402 3300025961 Archaea 1992
101 Ga0207703_10024871 3300026035 Unclassified 4712
102 Ga0207703_10203072 3300026035 Unclassified 1762
103 Ga0207708_10005174 3300026075 Bacteria 9621
104 Ga0207708_10010926 3300026075 Bacteria 6751
105 Ga0207708_10047400 3300026075 Bacteria 3271
106 Ga0207702_10144595 3300026078 Bacteria 2156
107 Ga0207676_10086584 3300026095 Bacteria 2560
108 Ga0207676_10136906 3300026095 Bacteria 2091
109 Ga0207676_10193513 3300026095 Bacteria 1791
110 Ga0207674_10073432 3300026116 Bacteria 3434
111 Ga0207675_100012786 3300026118 Bacteria 7841
112 Ga0207675_100036590 3300026118 Unclassified 4578
113 Ga0207683_10004686 3300026121 Bacteria 11786
114 Ga0207698_10141775 3300026142 Bacteria 2072
115 Ga0207428_10068567 3300027907 Unclassified 2789
116 Ga0268264_10115751 3300028381 Bacteria 2356
117 Ga0265327_10030439 3300031251 Bacteria 3052
118 Ga0307408_100092951 3300031548 Unclassified 2281
119 Ga0307408_100477756 3300031548 Bacteria 1087
120 Ga0307405_10013965 3300031731 Bacteria 4303
121 Ga0307413_10081693 3300031824 Bacteria 2073
122 Ga0307410_10256375 3300031852 Unclassified 1362
123 Ga0307412_10010096 3300031911 Bacteria 5431
124 Ga0307409_100055132 3300031995 Bacteria 3067
125 Ga0307416_101136007 3300032002 Unclassified 886
126 Ga0307414_10008769 3300032004 Bacteria 5765
127 Ga0307415_100000206 3300032126 Bacteria 26036
128 Ga0307415_100026376 3300032126 Unclassified 3664
129 Ga0307415_100358884 3300032126 Unclassified 1230
130 Ga0373949_0035569 3300035090 Bacteria 1205
131 Ga0439448_0020941 3300042005 Bacteria 2027
132 Ga0495598_0092955 3300046537 Unclassified 987
133 Ga0496103_0162479 3300048906 Bacteria 1433
134 Ga0501291_001858 3300049514 Unclassified 2474
135 Ga0501296_000391 3300049519 Bacteria 4369
136 Ga0501296_003686 3300049519 Unclassified 1642
137 Ga0501296_004247 3300049519 Unclassified 1556
138 Ga0501298_000323 3300049521 Bacteria 6353
139 Ga0501299_006979 3300049522 Unclassified 1786
140 Ga0501300_015833 3300049523 Bacteria 1101
141 Ga0501303_001181 3300049526 Unclassified 1949
142 Ga0501075_0413056 3300049591 Bacteria 1029
143 Ga0501201_000709 3300049651 Bacteria 3118
144 Ga0501207_001597 3300049654 Unclassified 2848
145 Ga0501207_008698 3300049654 Unclassified 1472
146 Ga0501208_005947 3300049655 Unclassified 1528
147 Ga0501209_003653 3300049656 Bacteria 2573
148 Ga0501216_002208 3300049660 Unclassified 2734
149 Ga0501217_000146 3300049661 Bacteria 9677
150 Ga0501217_001002 3300049661 Bacteria 5109
151 Ga0501223_000178 3300049663 Bacteria 16578
152 Ga0501223_023787 3300049663 Bacteria 1194
153 Ga0501223_033708 3300049663 Unclassified 996
154 Ga0501224_001083 3300049664 Bacteria 3540
155 Ga0501224_015727 3300049664 Unclassified 1122
156 Ga0501227_002971 3300049665 Bacteria 3709
157 Ga0501227_006121 3300049665 Bacteria 2585
158 Ga0501230_002653 3300049667 Bacteria 2299
159 Ga0501233_004723 3300049668 Bacteria 2512
160 Ga0501233_053216 3300049668 Bacteria 986
161 Ga0501235_006515 3300049669 Bacteria 2542
162 Ga0501235_025651 3300049669 Unclassified 1318
163 Ga0501242_008425 3300049674 Unclassified 1206
164 Ga0501253_016442 3300049683 Unclassified 1232
165 Ga0501256_002574 3300049685 Bacteria 1450
166 Ga0501259_002334 3300049688 Bacteria 3104
167 Ga0501260_007330 3300049689 Unclassified 1075
168 Ga0501221_008636 3300049704 Unclassified 1775
169 Ga0501221_024070 3300049704 Unclassified 1219
170 Ga0501225_0001639 3300049705 Bacteria 6986
171 Ga0501225_0003750 3300049705 Bacteria 4571
172 Ga0501234_009385 3300049707 Unclassified 1526
173 Ga0501245_009534 3300049708 Unclassified 1395
174 Ga0501232_004015 3300049757 Unclassified 1380
175 Ga0501273_006658 3300049770 Unclassified 1342
176 Ga0501283_000797 3300049779 Bacteria 4133
177 Ga0501212_001114 3300049851 Bacteria 2938
178 nmdc:mga05p37_17172_c1 3300050507 Bacteria 8731
179 nmdc:mga05p37_54053_c1 3300050507 Bacteria 4940
180 nmdc:mga05p37_808561_c1 3300050507 Unclassified 1024
181 nmdc:mga0qj67_133455_c1 3300050509 Bacteria 2011
182 nmdc:mga08y16_3396_c1 3300050511 Bacteria 16517
183 nmdc:mga08y16_416832_c1 3300050511 Unclassified 1373
184 nmdc:mga08y16_87389_c1 3300050511 Bacteria 3248
185 nmdc:mga0n895_430800_c1 3300050512 Bacteria 1333
186 nmdc:mga0a205_24898_c1 3300050515 Bacteria 5696
187 nmdc:mga0a205_46682_c1 3300050515 Bacteria 4177
188 nmdc:mga0a205_87817_c1 3300050515 Bacteria 3004
189 Ga0501084_0500336 3300054114 Unclassified 1027
190 8001526177 8001522603 Bacteria 4726425
191 Ga0395901_0467006
192 SwRhRL2b_contig_956848
193 rootL2_10064411
194 Ga0065704_10081227
195 Ga0065704_10118442
196 Ga0065712_10005954
197 Ga0065707_10003080
198 Ga0065707_10005921
199 Ga0070670_100214105
200 Ga0068869_100090845
201 Ga0068869_100247731
202 Ga0070682_100012642
203 Ga0070687_100187466
204 Ga0070692_10060069
205 Ga0070667_100177203
206 Ga0070705_100075568
207 Ga0070705_100082473
208 Ga0070705_100105824
209 Ga0070705_100200464
210 Ga0070700_100022856
211 Ga0070694_100004102
212 Ga0070694_100201399
213 Ga0070678_100028697
214 Ga0068867_100050265
215 Ga0068867_100107924
216 Ga0070698_100006699
217 Ga0070699_100000894
218 Ga0070699_100097674
219 Ga0070699_100344414
220 Ga0070679_100068270
221 Ga0070697_100134753
222 Ga0068853_100520207
223 Ga0070695_100039880
224 Ga0070696_100177856
225 Ga0070693_100020411
226 Ga0070704_100227938
227 Ga0068857_100050087
228 Ga0068856_100123337
229 Ga0070702_100005534
230 Ga0068852_100098430
231 Ga0068859_100035476
232 Ga0068859_100037150
233 Ga0068859_100199417
234 Ga0068864_100014613
235 Ga0068864_100078877
236 Ga0068861_100033949
237 Ga0068861_100113106
238 Ga0068870_10012171
239 Ga0068858_100011827
240 Ga0068858_100142142
241 Ga0068860_100045266
242 Ga0068860_100233335
243 Ga0070716_100419830
244 Ga0070712_100122973
245 Ga0097621_100015674
246 Ga0068871_100015001
247 Ga0075430_100174928
248 Ga0075433_10023046
249 Ga0075433_10040423
250 Ga0075434_100086786
251 Ga0075434_100512753
252 Ga0075434_100569814
253 Ga0097620_100037150
254 Ga0097620_100199420
255 Ga0075435_100290426
256 Ga0105240_10746508
257 Ga0111539_10005446
258 Ga0111539_10029159
259 Ga0114129_10005907
260 Ga0114129_10018821
261 Ga0114129_10128156
262 Ga0114129_10497194
263 Ga0105243_10012356
264 Ga0105243_10122493
265 Ga0105243_10369279
266 Ga0105241_10017367
267 Ga0105241_10095331
268 Ga0105242_10115730
269 Ga0105242_10236597
270 Ga0105249_10022682
271 Ga0105249_10027619
272 Ga0105249_10106419
273 Ga0157378_10029427
274 Ga0163163_10013704
275 Ga0157376_10315977
276 Ga0207647_10008304
277 Ga0207695_10344383
278 Ga0207671_10092016
279 Ga0207652_10239711
280 Ga0207659_10274099
281 Ga0207686_10046190
282 Ga0207709_10006574
283 Ga0207711_10049694
284 Ga0207689_10067725
285 Ga0207689_10079710
286 Ga0207689_10326223
287 Ga0207667_10192820
288 Ga0207651_10064529
289 Ga0207712_10071152
290 Ga0207712_10119402
291 Ga0207703_10024871
292 Ga0207703_10203072
293 Ga0207708_10005174
294 Ga0207708_10010926
295 Ga0207708_10047400
296 Ga0207702_10144595
297 Ga0207676_10086584
298 Ga0207676_10136906
299 Ga0207676_10193513
300 Ga0207674_10073432
301 Ga0207675_100012786
302 Ga0207675_100036590
303 Ga0207683_10004686
304 Ga0207698_10141775
305 Ga0207428_10068567
306 Ga0268264_10115751
307 Ga0265327_10030439
308 Ga0307408_100092951
309 Ga0307408_100477756
310 Ga0307405_10013965
311 Ga0307413_10081693
312 Ga0307410_10256375
313 Ga0307412_10010096
314 Ga0307409_100055132
315 Ga0307416_101136007
316 Ga0307414_10008769
317 Ga0307415_100000206
318 Ga0307415_100026376
319 Ga0307415_100358884
320 Ga0373949_0035569
321 Ga0439448_0020941
322 Ga0495598_0092955
323 Ga0496103_0162479
324 Ga0501291_001858
325 Ga0501296_000391
326 Ga0501296_003686
327 Ga0501296_004247
328 Ga0501298_000323
329 Ga0501299_006979
330 Ga0501300_015833
331 Ga0501303_001181
332 Ga0501075_0413056
333 Ga0501201_000709
334 Ga0501207_001597
335 Ga0501207_008698
336 Ga0501208_005947
337 Ga0501209_003653
338 Ga0501216_002208
339 Ga0501217_000146
340 Ga0501217_001002
341 Ga0501223_000178
342 Ga0501223_023787
343 Ga0501223_033708
344 Ga0501224_001083
345 Ga0501224_015727
346 Ga0501227_002971
347 Ga0501227_006121
348 Ga0501230_002653
349 Ga0501233_004723
350 Ga0501233_053216
351 Ga0501235_006515
352 Ga0501235_025651
353 Ga0501242_008425
354 Ga0501253_016442
355 Ga0501256_002574
356 Ga0501259_002334
357 Ga0501260_007330
358 Ga0501221_008636
359 Ga0501221_024070
360 Ga0501225_0001639
361 Ga0501225_0003750
362 Ga0501234_009385
363 Ga0501245_009534
364 Ga0501232_004015
365 Ga0501273_006658
366 Ga0501283_000797
367 Ga0501212_001114
368 nmdc:mga05p37_17172_c1
369 nmdc:mga05p37_54053_c1
370 nmdc:mga05p37_808561_c1
371 nmdc:mga0qj67_133455_c1
372 nmdc:mga08y16_3396_c1
373 nmdc:mga08y16_416832_c1
374 nmdc:mga08y16_87389_c1
375 nmdc:mga0n895_430800_c1
376 nmdc:mga0a205_24898_c1
377 nmdc:mga0a205_46682_c1
378 nmdc:mga0a205_87817_c1
379 Ga0501084_0500336
380 8001526177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

50

149

0.98

PF13649

Methyltransf_25

Methyltransferase domain

49

145

0.95

PF13847

Methyltransf_31

Methyltransferase domain

43

187

0.94

PF05175

MTS

Methyltransferase small domain

35

121

0.9

PF08242

Methyltransf_12

Methyltransferase domain

50

147

0.9

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

33

150

0.84

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

5

179

0.83

PF13489

Methyltransf_23

Methyltransferase domain

26

212

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8623 40 151
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8602 17 201
3m4x-assembly1.cif.gz_A structure of a ribosomal methyltransferase 0.8536 38 152
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.841 38 150
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8381 32 272
ID Description Score Start End Superfamily
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9333 37 105 3.40.50.150
af_B7ZXR6_266_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.927 35 102 3.40.50.150
af_A0A0R0FLG0_1_109_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9239 41 93 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9156 46 105 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8938 33 107 3.40.50.150
ID Description Score Start End GO Terms
AF-G3J252-F1-model_v4 Methyltransferase type 11 0.9747 1 272 GO:0008168
GO:0032259
AF-A0A1Z4T6Q9-F1-model_v4 deleted 0.9727 40 150
AF-G3J252-F1-model_v4 Methyltransferase type 11 0.9712 1 272 GO:0008168
GO:0032259
AF-A0A832K672-F1-model_v4 Arsenite methyltransferase (EC 2.1.1.137) 0.9632 38 150 GO:0008168
GO:0032259
AF-J7T967-F1-model_v4 deleted 0.9505 38 150

Map