F292489

General Info

Members Datasets Scaffolds Average Seq Length
190 134 185 235

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10320322|Ga0157373_103203222
Length 267
Sequence LKKGFVSVKVSGHSQLQGSFMKSLQGKKMIVTGGSRGIGASIVRLLAEEGAQVCFTYSSREEAAAEVAKSLPGEGHFYLKLDVANEESVNHAMEQITAKWSEVDGLVNNAGITKDQLLLRMKSEDFDAVINTNLRGSFLMTKALTKIMMKARKGSIVNITSVIGQTGNPGQANYAASKAGTEAFSKSVALEMASRNVRVNCVAPGFIATEMTHVLNEDTKKKILEQIPLNTIGEGTDVANAVRFLLSDESKYITGHTLSVNGGMFMS

Samples

Sample ID Description Type Environment
1 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
79 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
80 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
128 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
131 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
132 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
133 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
134 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.32
Metatranscriptomes 1.05
Isolates 2.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.95
Nodule 0
Rhizoplane 1.58
Rhizosphere 85.79
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10070611 3300005290 Bacteria 5852
2 Ga0070709_10385740 3300005434 Bacteria 1043
3 Ga0070694_100019751 3300005444 Bacteria 4288
4 Ga0070708_100055866 3300005445 Bacteria 3511
5 Ga0070708_101010239 3300005445 Bacteria 780
6 Ga0070706_100183906 3300005467 Bacteria 1952
7 Ga0070706_100379300 3300005467 Bacteria 1317
8 Ga0070698_100005369 3300005471 Bacteria 14016
9 Ga0070699_100217594 3300005518 Bacteria 1702
10 Ga0070697_100013110 3300005536 Bacteria 6498
11 Ga0070672_100056303 3300005543 Bacteria 3083
12 Ga0070665_100212628 3300005548 Bacteria 1935
13 Ga0068856_100080688 3300005614 Bacteria 3227
14 Ga0068861_100041749 3300005719 Bacteria 3436
15 Ga0075365_10077101 3300006038 Bacteria 2251
16 Ga0075368_10012729 3300006042 Bacteria 3082
17 Ga0075363_100113467 3300006048 Bacteria 1508
18 Ga0075364_10054021 3300006051 Bacteria 2626
19 Ga0075364_10059234 3300006051 Bacteria 2510
20 Ga0070716_100033889 3300006173 Bacteria 2797
21 Ga0075362_10005818 3300006177 Bacteria 4547
22 Ga0075367_10015862 3300006178 Bacteria 4105
23 Ga0075366_10000722 3300006195 Bacteria 15693
24 Ga0075366_10021664 3300006195 Bacteria 3737
25 Ga0075428_100053624 3300006844 Bacteria 4418
26 Ga0075433_10058386 3300006852 Bacteria 3375
27 Ga0075434_100146644 3300006871 Bacteria 2380
28 Ga0075429_100037195 3300006880 Bacteria 4237
29 Ga0099794_10030431 3300007265 Bacteria 2521
30 Ga0105240_10291504 3300009093 Bacteria 1870
31 Ga0111539_10000076 3300009094 Bacteria 98052
32 Ga0114129_10856047 3300009147 Bacteria 1155
33 Ga0105243_11286996 3300009148 Bacteria 748
34 Ga0105242_10011311 3300009176 Bacteria 6860
35 Ga0105242_10092784 3300009176 Bacteria 2544
36 Ga0105248_10043575 3300009177 Bacteria 5032
37 Ga0105249_10334449 3300009553 Bacteria 1529
38 Ga0105030_104841 3300009987 Bacteria 1141
39 Ga0105239_10003515 3300010375 Bacteria 19186
40 Ga0157373_10320322 3300013100 Bacteria 1103
41 Ga0157370_10016465 3300013104 Bacteria 7484
42 Ga0163162_10023700 3300013306 Bacteria 6058
43 Ga0157372_10146423 3300013307 Bacteria 2724
44 Ga0157375_10371372 3300013308 Bacteria 1597
45 Ga0157376_10284703 3300014969 Bacteria 1558
46 Ga0206353_10159505 3300020082 Bacteria 9546
47 Ga0213873_10024618 3300021358 Bacteria 1446
48 Ga0213875_10000019 3300021388 Bacteria 231333
49 Ga0213875_10124849 3300021388 Unclassified 1203
50 Ga0228598_1023655 3300024227 Bacteria 1208
51 Ga0209233_1012186 3300025261 Bacteria 2499
52 Ga0207699_10236922 3300025906 Bacteria 1252
53 Ga0207684_10215447 3300025910 Bacteria 1657
54 Ga0207684_10304197 3300025910 Bacteria 1375
55 Ga0207664_10857195 3300025929 Bacteria 816
56 Ga0207686_10014663 3300025934 Bacteria 4369
57 Ga0207665_10108358 3300025939 Bacteria 1949
58 Ga0207712_10280770 3300025961 Bacteria 1359
59 Ga0207708_10040788 3300026075 Bacteria 3540
60 Ga0207702_10034676 3300026078 Bacteria 4220
61 Ga0207698_10708677 3300026142 Bacteria 1002
62 Ga0209588_1032443 3300027671 Bacteria 1673
63 Ga0207428_10000085 3300027907 Bacteria 132411
64 Ga0268266_10391841 3300028379 Bacteria 1312
65 Ga0265770_1003103 3300030878 Bacteria 2255
66 Ga0316576_10006354 3300031727 Bacteria 7346
67 Ga0316576_10062760 3300031727 Bacteria 2726
68 Ga0316576_10113164 3300031727 Bacteria 2035
69 Ga0316574_0056243 3300035398 Bacteria 2461
70 Ga0316574_0179309 3300035398 Bacteria 1363
71 Ga0373927_0013291 3300035695 Bacteria 5473
72 Ga0373927_0022523 3300035695 Bacteria 4127
73 Ga0373927_0145416 3300035695 Bacteria 1552
74 Ga0373937_0306519 3300036401 Bacteria 1502
75 Ga0316582_0348016 3300036647 Bacteria 1019
76 Ga0316584_0092369 3300036712 Bacteria 2266
77 Ga0373925_0249308 3300037068 Bacteria 1424
78 Ga0395900_0003866 3300037418 Bacteria 16002
79 Ga0395905_0000099 3300037471 Bacteria 144776
80 Ga0395905_0001161 3300037471 Bacteria 32913
81 Ga0395905_0572290 3300037471 Bacteria 1031
82 Ga0436364_0366372 3300037853 Bacteria 231753
83 Ga0436364_0643358 3300037853 Unclassified 1647
84 Ga0436364_0851754 3300037853 Bacteria 1226
85 Ga0395901_0005360 3300038443 Bacteria 12965
86 Ga0436362_0722637 3300039453 Bacteria 1472
87 Ga0450910_022710 3300042147 Bacteria 956
88 Ga0451577_0018207 3300042876 Bacteria 6473
89 Ga0451577_0141193 3300042876 Bacteria 2164
90 Ga0453683_0000157 3300044673 Bacteria 99964
91 Ga0453683_0057605 3300044673 Bacteria 2430
92 Ga0466966_0312101 3300044684 Bacteria 945
93 Ga0453684_0066147 3300044712 Bacteria 4604
94 Ga0451576_0006969 3300045051 Bacteria 13680
95 Ga0451576_1164955 3300045051 Bacteria 805
96 Ga0495580_0063651 3300046472 Bacteria 2586
97 Ga0495656_0000001 3300046615 Bacteria 410042
98 Ga0495656_0000009 3300046615 Bacteria 175620
99 Ga0495659_0001287 3300046664 Bacteria 8624
100 Ga0495659_0007285 3300046664 Bacteria 3506
101 Ga0495658_0140777 3300046683 Bacteria 1475
102 Ga0495613_0015781 3300046689 Bacteria 5622
103 Ga0495674_0503707 3300047319 Bacteria 968
104 Ga0495615_0005780 3300048090 Bacteria 2249
105 Ga0496109_0000353 3300048912 Bacteria 42673
106 Ga0496109_0724523 3300048912 Bacteria 932
107 Ga0496112_0003345 3300048915 Bacteria 13232
108 Ga0501031_0001701 3300049568 Bacteria 13810
109 Ga0501031_0073393 3300049568 Bacteria 2228
110 Ga0501031_0230665 3300049568 Bacteria 1205
111 Ga0501032_0000723 3300049569 Bacteria 26918
112 Ga0501033_0029708 3300049570 Bacteria 4108
113 Ga0501033_0046906 3300049570 Bacteria 3213
114 Ga0501033_0431149 3300049570 Bacteria 917
115 Ga0501034_0036497 3300049571 Bacteria 4980
116 Ga0501034_0053859 3300049571 Bacteria 4051
117 Ga0501036_0027011 3300049572 Bacteria 4851
118 Ga0501036_0126639 3300049572 Bacteria 2157
119 Ga0501037_0001393 3300049573 Bacteria 17736
120 Ga0501037_0009812 3300049573 Bacteria 7027
121 Ga0501038_0032967 3300049574 Bacteria 4563
122 Ga0501038_0266713 3300049574 Bacteria 1351
123 Ga0501038_0459978 3300049574 Bacteria 977
124 Ga0501039_0025733 3300049575 Bacteria 4523
125 Ga0501039_0035855 3300049575 Bacteria 3829
126 Ga0501039_0226222 3300049575 Bacteria 1470
127 Ga0501040_0022477 3300049576 Bacteria 4220
128 Ga0501041_0002136 3300049577 Bacteria 11142
129 Ga0501042_0002996 3300049578 Bacteria 10504
130 Ga0501042_0082824 3300049578 Bacteria 2300
131 Ga0501043_0000264 3300049579 Bacteria 47682
132 Ga0501043_0015373 3300049579 Bacteria 5995
133 Ga0501046_0006908 3300049580 Bacteria 10001
134 Ga0501047_0426183 3300049581 Bacteria 1158
135 Ga0501048_0000819 3300049582 Bacteria 22912
136 Ga0501048_0027823 3300049582 Bacteria 4106
137 Ga0501068_0003904 3300049584 Bacteria 8103
138 Ga0501068_0295584 3300049584 Bacteria 1036
139 Ga0501069_0030117 3300049585 Bacteria 2980
140 Ga0501069_0135115 3300049585 Bacteria 1413
141 Ga0501070_0171268 3300049586 Bacteria 1788
142 Ga0501070_0460911 3300049586 Bacteria 1024
143 Ga0501071_0006114 3300049587 Bacteria 7803
144 Ga0501071_0012895 3300049587 Bacteria 5686
145 Ga0501071_0059228 3300049587 Bacteria 2771
146 Ga0501072_0007633 3300049588 Bacteria 8211
147 Ga0501072_0069815 3300049588 Bacteria 2774
148 Ga0501072_0130948 3300049588 Unclassified 1999
149 Ga0501073_0028697 3300049589 Bacteria 3976
150 Ga0501074_0011631 3300049590 Bacteria 6396
151 Ga0501074_0189503 3300049590 Bacteria 1467
152 Ga0501075_0008984 3300049591 Bacteria 6973
153 Ga0501075_0019859 3300049591 Bacteria 4879
154 Ga0501075_0042535 3300049591 Bacteria 3406
155 Ga0501076_0027984 3300049592 Bacteria 4373
156 Ga0501076_0030976 3300049592 Bacteria 4168
157 Ga0501076_0143579 3300049592 Bacteria 1940
158 Ga0501077_0001722 3300049593 Bacteria 13180
159 Ga0501079_0047144 3300049741 Bacteria 3324
160 Ga0501079_0098992 3300049741 Bacteria 2260
161 Ga0501079_0261775 3300049741 Bacteria 1352
162 Ga0501080_0002894 3300049742 Bacteria 15093
163 Ga0501081_0002583 3300049743 Bacteria 11442
164 Ga0501081_0156760 3300049743 Bacteria 1638
165 Ga0501083_0034744 3300049744 Bacteria 3446
166 Ga0501035_0030823 3300049822 Bacteria 4887
167 Ga0501044_0673904 3300049823 Bacteria 921
168 Ga0501044_0707852 3300049823 Bacteria 892
169 Ga0501045_0011815 3300049824 Bacteria 6135
170 nmdc:mga03683_48270_c1 3300050489 Bacteria 1769
171 nmdc:mga00v17_19168_c1 3300050491 Bacteria 3901
172 nmdc:mga00v17_61792_c1 3300050491 Bacteria 2303
173 nmdc:mga0k408_36426_c1 3300050493 Bacteria 2824
174 nmdc:mga0k408_653_c1 3300050493 Bacteria 19027
175 nmdc:mga06z11_7869_c1 3300050494 Bacteria 4412
176 nmdc:mga09592_452170_c1 3300050508 Bacteria 1108
177 nmdc:mga08y16_1401_c1 3300050511 Bacteria 24169
178 nmdc:mga0n895_51203_c1 3300050512 Bacteria 4051
179 nmdc:mga0a205_26421_c1 3300050515 Bacteria 5536
180 Ga0500568_0003184 3300053139 Bacteria 9343
181 Ga0501084_0015050 3300054114 Bacteria 6414
182 Ga0501082_0008647 3300060353 Bacteria 8777
183 Ga0501082_0028803 3300060353 Bacteria 4784
184 Ga0530510_0005651 3300061734 Bacteria 8666
185 Ga0530510_0008539 3300061734 Bacteria 7150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10856047 Ga0114129_108560472 189
2 3300049575 Ga0501039_0035855 Ga0501039_0035855_2657_3355 200
3 3300049578 Ga0501042_0082824 Ga0501042_0082824_264_962 200
4 3300049587 Ga0501071_0059228 Ga0501071_0059228_942_1640 200
5 3300049588 Ga0501072_0069815 Ga0501072_0069815_1746_2444 200
6 3300049591 Ga0501075_0008984 Ga0501075_0008984_2093_2791 200
7 3300049592 Ga0501076_0143579 Ga0501076_0143579_816_1514 200
8 3300049741 Ga0501079_0261775 Ga0501079_0261775_49_747 200
9 3300049574 Ga0501038_0032967 Ga0501038_0032967_3926_4540 203
10 3300009148 Ga0105243_11286996 Ga0105243_112869961 214
11 3300009176 Ga0105242_10011311 Ga0105242_100113117 214
12 3300046472 Ga0495580_0063651 Ga0495580_0063651_1176_1823 214
13 3300049574 Ga0501038_0266713 Ga0501038_0266713_195_851 215
14 3300036712 Ga0316584_0092369 Ga0316584_0092369_1491_2255 217
15 3300049571 Ga0501034_0053859 Ga0501034_0053859_411_1151 218
16 3300009176 Ga0105242_10092784 Ga0105242_100927842 223
17 3300013308 Ga0157375_10371372 Ga0157375_103713722 223
18 3300005444 Ga0070694_100019751 Ga0070694_1000197513 224
19 3300006871 Ga0075434_100146644 Ga0075434_1001466442 224
20 3300020082 Ga0206353_10159505 Ga0206353_101595052 224
21 3300021388 Ga0213875_10124849 Ga0213875_101248491 224
22 3300037853 Ga0436364_0643358 Ga0436364_0643358_430_1176 224
23 3300050512 nmdc:mga0n895_51203_c1 nmdc:mga0n895_51203_c1_286_999 224
24 3300050515 nmdc:mga0a205_26421_c1 nmdc:mga0a205_26421_c1_704_1417 224
25 3300005445 Ga0070708_100055866 Ga0070708_1000558662 225
26 3300053139 Ga0500568_0003184 Ga0500568_0003184_8413_9258 225
27 3300005543 Ga0070672_100056303 Ga0070672_1000563034 226
28 3300005719 Ga0068861_100041749 Ga0068861_1000417493 226
29 3300006038 Ga0075365_10077101 Ga0075365_100771012 226
30 3300006042 Ga0075368_10012729 Ga0075368_100127293 226
31 3300006048 Ga0075363_100113467 Ga0075363_1001134671 226
32 3300006051 Ga0075364_10054021 Ga0075364_100540213 226
33 3300006177 Ga0075362_10005818 Ga0075362_100058183 226
34 3300006178 Ga0075367_10015862 Ga0075367_100158625 226
35 3300006195 Ga0075366_10000722 Ga0075366_1000072213 226
36 3300006844 Ga0075428_100053624 Ga0075428_1000536245 226
37 3300006852 Ga0075433_10058386 Ga0075433_100583862 226
38 3300006880 Ga0075429_100037195 Ga0075429_1000371955 226
39 3300009094 Ga0111539_10000076 Ga0111539_100000766 226
40 3300009177 Ga0105248_10043575 Ga0105248_100435752 226
41 3300009553 Ga0105249_10334449 Ga0105249_103344492 226
42 3300025961 Ga0207712_10280770 Ga0207712_102807702 226
43 3300026075 Ga0207708_10040788 Ga0207708_100407882 226
44 3300027907 Ga0207428_10000085 Ga0207428_1000008540 226
45 3300050489 nmdc:mga03683_48270_c1 nmdc:mga03683_48270_c1_222_962 226
46 3300050491 nmdc:mga00v17_19168_c1 nmdc:mga00v17_19168_c1_1525_2265 226
47 3300050493 nmdc:mga0k408_653_c1 nmdc:mga0k408_653_c1_3320_4060 226
48 3300050494 nmdc:mga06z11_7869_c1 nmdc:mga06z11_7869_c1_3282_4022 226
49 3300050508 nmdc:mga09592_452170_c1 nmdc:mga09592_452170_c1_49_789 226
50 3300050511 nmdc:mga08y16_1401_c1 nmdc:mga08y16_1401_c1_5810_6550 226
51 3300005467 Ga0070706_100379300 Ga0070706_1003793002 227
52 3300005471 Ga0070698_100005369 Ga0070698_1000053697 227
53 3300005518 Ga0070699_100217594 Ga0070699_1002175943 227
54 3300025910 Ga0207684_10304197 Ga0207684_103041972 227
55 3300036647 Ga0316582_0348016 Ga0316582_0348016_257_994 227
56 3300035695 Ga0373927_0145416 Ga0373927_0145416_78_773 228
57 3300046683 Ga0495658_0140777 Ga0495658_0140777_713_1450 228
58 3300046689 Ga0495613_0015781 Ga0495613_0015781_4019_4756 228
59 3300005434 Ga0070709_10385740 Ga0070709_103857402 229
60 3300025906 Ga0207699_10236922 Ga0207699_102369222 229
61 3300044712 Ga0453684_0066147 Ga0453684_0066147_2035_2760 229
62 3300009987 Ga0105030_104841 Ga0105030_1048411 230
63 3300030878 Ga0265770_1003103 Ga0265770_10031032 230
64 3300038443 Ga0395901_0005360 Ga0395901_0005360_2702_3448 231
65 3300042147 Ga0450910_022710 Ga0450910_022710_208_906 231
66 3300049568 Ga0501031_0073393 Ga0501031_0073393_719_1462 231
67 3300049569 Ga0501032_0000723 Ga0501032_0000723_25763_26506 231
68 3300049570 Ga0501033_0029708 Ga0501033_0029708_3000_3743 231
69 3300049570 Ga0501033_0431149 Ga0501033_0431149_27_725 231
70 3300049571 Ga0501034_0036497 Ga0501034_0036497_94_837 231
71 3300049572 Ga0501036_0126639 Ga0501036_0126639_499_1242 231
72 3300049573 Ga0501037_0001393 Ga0501037_0001393_10575_11318 231
73 3300049574 Ga0501038_0459978 Ga0501038_0459978_186_929 231
74 3300049575 Ga0501039_0025733 Ga0501039_0025733_2306_3004 231
75 3300049579 Ga0501043_0000264 Ga0501043_0000264_34223_34966 231
76 3300049581 Ga0501047_0426183 Ga0501047_0426183_161_904 231
77 3300049582 Ga0501048_0027823 Ga0501048_0027823_2516_3214 231
78 3300049584 Ga0501068_0295584 Ga0501068_0295584_19_717 231
79 3300049587 Ga0501071_0012895 Ga0501071_0012895_842_1540 231
80 3300049588 Ga0501072_0130948 Ga0501072_0130948_470_1168 231
81 3300049590 Ga0501074_0189503 Ga0501074_0189503_385_1083 231
82 3300049591 Ga0501075_0019859 Ga0501075_0019859_3382_4080 231
83 3300049592 Ga0501076_0027984 Ga0501076_0027984_475_1173 231
84 3300049741 Ga0501079_0098992 Ga0501079_0098992_875_1573 231
85 3300049743 Ga0501081_0156760 Ga0501081_0156760_677_1375 231
86 3300049824 Ga0501045_0011815 Ga0501045_0011815_359_1057 231
87 3300060353 Ga0501082_0028803 Ga0501082_0028803_2993_3691 231
88 3300061734 Ga0530510_0005651 Ga0530510_0005651_7088_7786 231
89 3300049568 Ga0501031_0001701 Ga0501031_0001701_11757_12458 232
90 3300049570 Ga0501033_0046906 Ga0501033_0046906_280_981 232
91 3300049572 Ga0501036_0027011 Ga0501036_0027011_332_1033 232
92 3300049573 Ga0501037_0009812 Ga0501037_0009812_2485_3186 232
93 3300049575 Ga0501039_0226222 Ga0501039_0226222_284_985 232
94 3300049576 Ga0501040_0022477 Ga0501040_0022477_893_1594 232
95 3300049577 Ga0501041_0002136 Ga0501041_0002136_4972_5673 232
96 3300049578 Ga0501042_0002996 Ga0501042_0002996_3473_4174 232
97 3300049579 Ga0501043_0015373 Ga0501043_0015373_3491_4192 232
98 3300049580 Ga0501046_0006908 Ga0501046_0006908_7482_8183 232
99 3300049582 Ga0501048_0000819 Ga0501048_0000819_11470_12171 232
100 3300049584 Ga0501068_0003904 Ga0501068_0003904_4838_5539 232
101 3300049585 Ga0501069_0030117 Ga0501069_0030117_1652_2353 232
102 3300049586 Ga0501070_0171268 Ga0501070_0171268_992_1693 232
103 3300049587 Ga0501071_0006114 Ga0501071_0006114_4950_5651 232
104 3300049588 Ga0501072_0007633 Ga0501072_0007633_4645_5346 232
105 3300049589 Ga0501073_0028697 Ga0501073_0028697_1376_2077 232
106 3300049590 Ga0501074_0011631 Ga0501074_0011631_2055_2756 232
107 3300049591 Ga0501075_0042535 Ga0501075_0042535_2320_3021 232
108 3300049592 Ga0501076_0030976 Ga0501076_0030976_3082_3783 232
109 3300049593 Ga0501077_0001722 Ga0501077_0001722_9800_10501 232
110 3300049741 Ga0501079_0047144 Ga0501079_0047144_2238_2939 232
111 3300049742 Ga0501080_0002894 Ga0501080_0002894_12163_12864 232
112 3300049743 Ga0501081_0002583 Ga0501081_0002583_8270_8971 232
113 3300049744 Ga0501083_0034744 Ga0501083_0034744_2035_2736 232
114 3300049822 Ga0501035_0030823 Ga0501035_0030823_2324_3025 232
115 3300049823 Ga0501044_0707852 Ga0501044_0707852_95_796 232
116 3300054114 Ga0501084_0015050 Ga0501084_0015050_5228_5929 232
117 3300060353 Ga0501082_0008647 Ga0501082_0008647_3334_4035 232
118 3300061734 Ga0530510_0008539 Ga0530510_0008539_2346_3047 232
119 3300042876 Ga0451577_0141193 Ga0451577_0141193_357_1106 233
120 3300005536 Ga0070697_100013110 Ga0070697_1000131104 235
121 3300026142 Ga0207698_10708677 Ga0207698_107086772 235
122 3300007265 Ga0099794_10030431 Ga0099794_100304313 237
123 3300027671 Ga0209588_1032443 Ga0209588_10324433 237
124 3300049585 Ga0501069_0135115 Ga0501069_0135115_375_1091 237
125 3300031727 Ga0316576_10113164 Ga0316576_101131643 238
126 3300048912 Ga0496109_0000353 Ga0496109_0000353_38717_39469 239
127 iso_pu_bacteria 8055037949 8055040439 239
128 iso_pu_bacteria 8057101203 8057103712 239
129 3300009093 Ga0105240_10291504 Ga0105240_102915042 240
130 3300024227 Ga0228598_1023655 Ga0228598_10236552 240
131 3300035695 Ga0373927_0022523 Ga0373927_0022523_1506_2252 240
132 3300036401 Ga0373937_0306519 Ga0373937_0306519_151_897 240
133 3300037068 Ga0373925_0249308 Ga0373925_0249308_79_825 240
134 iso_pu_bacteria 8007375930 8007377674 240
135 3300044673 Ga0453683_0057605 Ga0453683_0057605_211_945 241
136 3300045051 Ga0451576_0006969 Ga0451576_0006969_9876_10610 241
137 3300031727 Ga0316576_10006354 Ga0316576_100063545 242
138 3300035398 Ga0316574_0179309 Ga0316574_0179309_81_842 242
139 3300044673 Ga0453683_0000157 Ga0453683_0000157_48648_49406 242
140 3300045051 Ga0451576_1164955 Ga0451576_1164955_29_787 242
141 iso_pu_bacteria 8048746797 8048749768 242
142 3300005467 Ga0070706_100183906 Ga0070706_1001839061 243
143 3300010375 Ga0105239_10003515 Ga0105239_1000351515 243
144 3300013104 Ga0157370_10016465 Ga0157370_100164655 243
145 3300021358 Ga0213873_10024618 Ga0213873_100246182 243
146 3300021388 Ga0213875_10000019 Ga0213875_1000001988 243
147 3300025910 Ga0207684_10215447 Ga0207684_102154472 243
148 3300025929 Ga0207664_10857195 Ga0207664_108571951 243
149 3300025934 Ga0207686_10014663 Ga0207686_100146632 243
150 3300031727 Ga0316576_10062760 Ga0316576_100627603 243
151 3300035398 Ga0316574_0056243 Ga0316574_0056243_852_1637 243
152 3300037853 Ga0436364_0366372 Ga0436364_0366372_137898_138632 243
153 3300039453 Ga0436362_0722637 Ga0436362_0722637_286_1020 243
154 3300046615 Ga0495656_0000001 Ga0495656_0000001_322217_322963 243
155 3300046664 Ga0495659_0001287 Ga0495659_0001287_7169_7915 243
156 3300047319 Ga0495674_0503707 Ga0495674_0503707_18_752 243
157 3300005614 Ga0068856_100080688 Ga0068856_1000806884 244
158 3300006051 Ga0075364_10059234 Ga0075364_100592342 244
159 3300013100 Ga0157373_10320322 Ga0157373_103203222 244
160 3300013307 Ga0157372_10146423 Ga0157372_101464232 244
161 3300026078 Ga0207702_10034676 Ga0207702_100346763 244
162 3300037418 Ga0395900_0003866 Ga0395900_0003866_4938_5681 244
163 3300037471 Ga0395905_0000099 Ga0395905_0000099_135523_136266 244
164 3300037471 Ga0395905_0001161 Ga0395905_0001161_23486_24235 244
165 3300037471 Ga0395905_0572290 Ga0395905_0572290_101_877 244
166 3300044684 Ga0466966_0312101 Ga0466966_0312101_35_772 244
167 3300048912 Ga0496109_0724523 Ga0496109_0724523_176_916 244
168 3300050491 nmdc:mga00v17_61792_c1 nmdc:mga00v17_61792_c1_1396_2154 244
169 iso_pu_bacteria 2939582691 2939587454 244
170 3300037853 Ga0436364_0851754 Ga0436364_0851754_397_1203 245
171 3300005290 Ga0065712_10070611 Ga0065712_100706115 246
172 3300005445 Ga0070708_101010239 Ga0070708_1010102391 246
173 3300005548 Ga0070665_100212628 Ga0070665_1002126282 246
174 3300006173 Ga0070716_100033889 Ga0070716_1000338892 246
175 3300006195 Ga0075366_10021664 Ga0075366_100216642 246
176 3300013306 Ga0163162_10023700 Ga0163162_100237006 246
177 3300014969 Ga0157376_10284703 Ga0157376_102847031 246
178 3300025261 Ga0209233_1012186 Ga0209233_10121863 246
179 3300025939 Ga0207665_10108358 Ga0207665_101083583 246
180 3300028379 Ga0268266_10391841 Ga0268266_103918412 246
181 3300035695 Ga0373927_0013291 Ga0373927_0013291_3528_4286 246
182 3300042876 Ga0451577_0018207 Ga0451577_0018207_4071_4823 246
183 3300046615 Ga0495656_0000009 Ga0495656_0000009_157974_158735 246
184 3300046664 Ga0495659_0007285 Ga0495659_0007285_362_1123 246
185 3300048090 Ga0495615_0005780 Ga0495615_0005780_978_1736 246
186 3300048915 Ga0496112_0003345 Ga0496112_0003345_901_1662 246
187 3300049568 Ga0501031_0230665 Ga0501031_0230665_110_865 246
188 3300049586 Ga0501070_0460911 Ga0501070_0460911_34_780 246
189 3300049823 Ga0501044_0673904 Ga0501044_0673904_155_910 246
190 3300050493 nmdc:mga0k408_36426_c1 nmdc:mga0k408_36426_c1_685_1437 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

220

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

265

0.96

PF08659

KR

KR domain

28

208

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ftp-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9849 4 246
3ftp-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9847 4 246
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9846 4 246
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9822 2 246
3sj7-assembly1.cif.gz_B-2 structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with nadph 0.9806 7 246
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9911 81 246 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9847 4 246 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9812 2 244 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9794 7 246 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9791 59 178 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2S5MFR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9991 84 246 GO:0016491
AF-K1T1S4-F1-model_v4 3-oxoacyl-(Acyl-carrier-protein) reductase 0.9906 95 246 GO:0006633
GO:0016616
GO:0048038
AF-A0A1J5IPR9-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9904 7 246 GO:0004316
GO:0006633
GO:0051287
AF-A0A2S5MFR3-F1-model_v4 Beta-ketoacyl-ACP reductase 0.987 84 246 GO:0016491
AF-A0A6I3B668-F1-model_v4 SDR family oxidoreductase 0.9849 98 246 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.85 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map