F292451

General Info

Members Datasets Scaffolds Average Seq Length
190 106 187 156

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_11327158|Ga0105241_113271581
Length 168
Sequence MDDILMQLLQEEQELQFTKFNEDTAWQVGCHLVDRARKENLAVTIDITRGNHQLFHASLNGTSADNDEWIKRKVRLVYRFGHSSFYMRQLLKSKGKRIEEAYLISESEYAPHGGCFPVMIKDAGLIGTITVSGLPQEEDHKLVVEAIRDYLAQEKQYGIESSNIHAGT

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
4 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
5 2909042592 Labrys sp. LIt4 Isolate Nodule
6 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
86 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
91 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
92 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
93 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
94 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
95 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
96 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
97 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
105 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
106 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.58
Nodule 0.53
Rhizoplane 0
Rhizosphere 85.79
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1626295 2162886006 Unclassified 1252
2 SwRhRL3b_contig_1913618 2162886006 Bacteria 2682
3 SwRhRL3b_contig_998987 2162886006 Bacteria 1244
4 SwRhRL2b_contig_2238289 2162886007 Bacteria 4874
5 rootH2_10022226 3300003320 Bacteria 9479
6 rootH1_10009128 3300003316 Bacteria 5847
7 rootH1_10009128 3300003323 Bacteria 47126
8 Ga0065704_10129869 3300005289 Bacteria 1643
9 Ga0065715_10143564 3300005293 Bacteria 1765
10 Ga0065707_10001120 3300005295 Bacteria 26753
11 Ga0065707_10082652 3300005295 Bacteria 13032
12 Ga0065707_10085800 3300005295 Bacteria 5878
13 Ga0065707_10086606 3300005295 Bacteria 5385
14 Ga0070689_100206376 3300005340 Bacteria 1606
15 Ga0070689_100277527 3300005340 Bacteria 1389
16 Ga0070691_10506073 3300005341 Bacteria 699
17 Ga0070669_100103288 3300005353 Bacteria 2153
18 Ga0070705_100040064 3300005440 Bacteria 2662
19 Ga0070700_100131387 3300005441 Bacteria 1690
20 Ga0070694_100082196 3300005444 Bacteria 2243
21 Ga0070708_100527250 3300005445 Bacteria 1114
22 Ga0070706_100308708 3300005467 Unclassified 1476
23 Ga0070707_100099054 3300005468 Bacteria 2824
24 Ga0070707_100204717 3300005468 Bacteria 1924
25 Ga0070698_100047635 3300005471 Bacteria 4381
26 Ga0070698_100110198 3300005471 Bacteria 2718
27 Ga0070699_100056858 3300005518 Bacteria 3388
28 Ga0070699_100066727 3300005518 Bacteria 3124
29 Ga0070699_100821877 3300005518 Bacteria 850
30 Ga0070697_100089999 3300005536 Bacteria 2536
31 Ga0070697_100288913 3300005536 Bacteria 1408
32 Ga0070695_100139399 3300005545 Bacteria 1680
33 Ga0070696_100039787 3300005546 Bacteria 3247
34 Ga0070696_100535485 3300005546 Bacteria 936
35 Ga0070696_101080405 3300005546 Unclassified 674
36 Ga0070693_100632385 3300005547 Bacteria 776
37 Ga0070693_100652757 3300005547 Bacteria 765
38 Ga0070704_100101672 3300005549 Bacteria 2167
39 Ga0070704_100178903 3300005549 Bacteria 1695
40 Ga0068857_101154662 3300005577 Unclassified 749
41 Ga0070702_100247640 3300005615 Bacteria 1206
42 Ga0070702_100695562 3300005615 Bacteria 774
43 Ga0068859_100025820 3300005617 Bacteria 5894
44 Ga0068859_100349918 3300005617 Bacteria 1572
45 Ga0068864_100308220 3300005618 Bacteria 1484
46 Ga0068861_100254461 3300005719 Bacteria 1500
47 Ga0068861_100522794 3300005719 Unclassified 1076
48 Ga0068862_100025147 3300005844 Bacteria 4998
49 Ga0068862_100093254 3300005844 Bacteria 2625
50 Ga0068862_100345171 3300005844 Bacteria 1380
51 Ga0068862_100467284 3300005844 Bacteria 1192
52 Ga0075365_10477412 3300006038 Bacteria 881
53 Ga0075363_100017205 3300006048 Bacteria 3582
54 Ga0075364_10827092 3300006051 Bacteria 631
55 Ga0075362_10149829 3300006177 Bacteria 1119
56 Ga0075369_10100832 3300006186 Bacteria 1295
57 Ga0075427_10053164 3300006194 Unclassified 700
58 Ga0075428_100420894 3300006844 Bacteria 1431
59 Ga0075430_100326430 3300006846 Unclassified 1268
60 Ga0075429_100006419 3300006880 Bacteria 10181
61 Ga0075429_100676225 3300006880 Unclassified 904
62 Ga0075429_100967734 3300006880 Unclassified 744
63 Ga0097620_100025819 3300006931 Bacteria 5894
64 Ga0097620_100349915 3300006931 Bacteria 1572
65 Ga0105240_11359897 3300009093 Bacteria 747
66 Ga0111539_10018112 3300009094 Bacteria 8723
67 Ga0114129_10025998 3300009147 Bacteria 8289
68 Ga0114129_10035325 3300009147 Bacteria 7061
69 Ga0114129_10325835 3300009147 Bacteria 2041
70 Ga0105243_10070027 3300009148 Bacteria 2831
71 Ga0105241_11327158 3300009174 Unclassified 686
72 Ga0105241_11436992 3300009174 Unclassified 662
73 Ga0105249_10084934 3300009553 Bacteria 2948
74 Ga0105249_10248519 3300009553 Bacteria 1762
75 Ga0105249_10739090 3300009553 Bacteria 1046
76 Ga0105249_11418378 3300009553 Unclassified 766
77 Ga0105239_11106916 3300010375 Bacteria 912
78 Ga0105246_10162118 3300011119 Unclassified 1704
79 Ga0157380_10296525 3300014326 Bacteria 1487
80 Ga0207647_10383816 3300025904 Bacteria 793
81 Ga0207643_10235482 3300025908 Unclassified 1124
82 Ga0207684_10277641 3300025910 Bacteria 1445
83 Ga0207660_10345663 3300025917 Bacteria 1191
84 Ga0207646_10075859 3300025922 Unclassified 3004
85 Ga0207646_10256471 3300025922 Bacteria 1580
86 Ga0207681_10510911 3300025923 Bacteria 985
87 Ga0207709_10098979 3300025935 Bacteria 1924
88 Ga0207670_10656065 3300025936 Unclassified 865
89 Ga0207712_10045412 3300025961 Bacteria 3042
90 Ga0207712_10222833 3300025961 Unclassified 1509
91 Ga0207708_10146767 3300026075 Bacteria 1854
92 Ga0207708_10854921 3300026075 Unclassified 785
93 Ga0207674_10128256 3300026116 Bacteria 2501
94 Ga0207675_100153854 3300026118 Bacteria 2191
95 Ga0268265_10021545 3300028380 Bacteria 4518
96 Ga0268265_10209245 3300028380 Bacteria 1698
97 Ga0268265_10417139 3300028380 Bacteria 1245
98 Ga0268265_10946441 3300028380 Bacteria 848
99 Ga0265326_10083270 3300028558 Bacteria 905
100 Ga0265319_1011127 3300028563 Unclassified 3707
101 Ga0265318_10040954 3300028577 Bacteria 1763
102 Ga0265320_10007987 3300031240 Bacteria 6516
103 Ga0265340_10022152 3300031247 Bacteria 3251
104 Ga0265340_10101268 3300031247 Unclassified 1338
105 Ga0265331_10043601 3300031250 Bacteria 2172
106 Ga0265331_10532007 3300031250 Bacteria 529
107 Ga0307408_100002613 3300031548 Bacteria 12539
108 Ga0265314_10044044 3300031711 Unclassified 3167
109 Ga0316576_10435564 3300031727 Unclassified 969
110 Ga0307405_10541343 3300031731 Unclassified 940
111 Ga0307410_10035870 3300031852 Bacteria 3225
112 Ga0307406_10085547 3300031901 Unclassified 2109
113 Ga0307412_10256826 3300031911 Unclassified 1360
114 Ga0307409_100032814 3300031995 Bacteria 3771
115 Ga0307416_100071249 3300032002 Unclassified 2887
116 Ga0307416_101261129 3300032002 Unclassified 845
117 Ga0307415_100522303 3300032126 Unclassified 1042
118 Ga0373941_0410009 3300035115 Bacteria 562
119 Ga0316582_0267146 3300036647 Unclassified 1173
120 Ga0316584_0093370 3300036712 Bacteria 2253
121 Ga0316584_0841150 3300036712 Bacteria 621
122 Ga0450891_002502 3300042129 Bacteria 1848
123 Ga0451577_0002582 3300042876 Bacteria 21379
124 Ga0451577_0008642 3300042876 Bacteria 9892
125 Ga0451577_0041511 3300042876 Bacteria 4129
126 Ga0451577_0157371 3300042876 Bacteria 2045
127 Ga0451577_0257802 3300042876 Unclassified 1579
128 Ga0451577_1128708 3300042876 Unclassified 701
129 Ga0451577_1141520 3300042876 Unclassified 696
130 Ga0453683_0000414 3300044673 Bacteria 49869
131 Ga0453683_0010141 3300044673 Bacteria 6255
132 Ga0453683_0036743 3300044673 Bacteria 3082
133 Ga0453683_0393909 3300044673 Bacteria 892
134 Ga0453683_0578775 3300044673 Unclassified 731
135 Ga0453683_0912338 3300044673 Bacteria 581
136 Ga0453684_0000003 3300044712 Bacteria 1481694
137 Ga0453684_0000430 3300044712 Bacteria 171415
138 Ga0453684_0000535 3300044712 Bacteria 144635
139 Ga0453684_0009674 3300044712 Bacteria 16788
140 Ga0453684_0017644 3300044712 Bacteria 11034
141 Ga0453684_0019002 3300044712 Bacteria 10497
142 Ga0453684_0027253 3300044712 Bacteria 8202
143 Ga0453684_0043095 3300044712 Bacteria 6072
144 Ga0453684_0044135 3300044712 Bacteria 5973
145 Ga0453684_0098694 3300044712 Bacteria 3579
146 Ga0453684_0122488 3300044712 Bacteria 3137
147 Ga0453684_0163099 3300044712 Bacteria 2634
148 Ga0453684_0163852 3300044712 Bacteria 2627
149 Ga0453684_0202553 3300044712 Bacteria 2313
150 Ga0453684_0278914 3300044712 Bacteria 1907
151 Ga0453684_0311826 3300044712 Bacteria 1785
152 Ga0453684_0491408 3300044712 Bacteria 1360
153 Ga0453684_0762521 3300044712 Bacteria 1046
154 Ga0453684_1131557 3300044712 Bacteria 825
155 Ga0451576_0010009 3300045051 Bacteria 10928
156 Ga0451576_0036297 3300045051 Bacteria 5226
157 Ga0451576_0061121 3300045051 Bacteria 3929
158 Ga0451576_0460384 3300045051 Unclassified 1335
159 Ga0451576_0626904 3300045051 Bacteria 1130
160 Ga0501295_131444 3300049518 Unclassified 608
161 Ga0501299_082983 3300049522 Bacteria 715
162 Ga0501300_032352 3300049523 Bacteria 774
163 Ga0501233_075813 3300049668 Unclassified 859
164 Ga0501259_047078 3300049688 Bacteria 866
165 Ga0501234_025041 3300049707 Unclassified 957
166 nmdc:mga03683_98343_c1 3300050489 Bacteria 1284
167 nmdc:mga03n38_25832_c1 3300050490 Bacteria 2418
168 nmdc:mga00v17_11288_c1 3300050491 Bacteria 4908
169 nmdc:mga0yw44_115450_c1 3300050492 Bacteria 1724
170 nmdc:mga05p37_18069_c1 3300050507 Bacteria 8518
171 nmdc:mga05p37_26047_c1 3300050507 Bacteria 7111
172 nmdc:mga09592_305050_c1 3300050508 Bacteria 1380
173 nmdc:mga08y16_291559_c1 3300050511 Bacteria 1682
174 nmdc:mga0a205_115312_c1 3300050515 Bacteria 2585
175 Ga0500559_0000102 3300053136 Bacteria 66427
176 Ga0500559_0000637 3300053136 Bacteria 23685
177 Ga0500559_0199871 3300053136 Bacteria 942
178 Ga0500573_0000017 3300053140 Bacteria 181426
179 Ga0500573_0000213 3300053140 Bacteria 23742
180 Ga0500573_0004011 3300053140 Bacteria 7694
181 Ga0500573_0010588 3300053140 Bacteria 5148
182 Ga0500573_0063269 3300053140 Bacteria 2117
183 Ga0500573_0091766 3300053140 Bacteria 1715
184 Ga0500573_0192302 3300053140 Bacteria 1089
185 Ga0500573_0301076 3300053140 Bacteria 801
186 Ga0500577_0203221 3300053142 Bacteria 855
187 Ga0500577_0392257 3300053142 Bacteria 607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10477412 Ga0075365_104774122 148
2 3300050492 nmdc:mga0yw44_115450_c1 nmdc:mga0yw44_115450_c1_303_761 148
3 iso_pu_bacteria 2738541276 2738717052 152
4 3300036712 Ga0316584_0841150 Ga0316584_0841150_130_591 153
5 3300053136 Ga0500559_0000102 Ga0500559_0000102_8667_9140 153
6 3300053140 Ga0500573_0000017 Ga0500573_0000017_177787_178260 153
7 3300053140 Ga0500573_0000213 Ga0500573_0000213_5913_6386 153
8 3300053140 Ga0500573_0010588 Ga0500573_0010588_3424_3897 153
9 3300053140 Ga0500573_0063269 Ga0500573_0063269_1163_1624 153
10 3300053140 Ga0500573_0091766 Ga0500573_0091766_504_965 153
11 3300053140 Ga0500573_0192302 Ga0500573_0192302_269_730 153
12 3300053140 Ga0500573_0301076 Ga0500573_0301076_128_619 153
13 3300053142 Ga0500577_0392257 Ga0500577_0392257_54_515 153
14 iso_pu_bacteria 2909042592 2909047302 153
15 3300003320 rootH2_10022226 rootH2_100222262 154
16 3300003323 rootH1_10009128 rootH1_1000912822 154
17 3300005547 Ga0070693_100632385 Ga0070693_1006323851 154
18 3300028558 Ga0265326_10083270 Ga0265326_100832702 154
19 3300028563 Ga0265319_1011127 Ga0265319_10111273 154
20 3300028577 Ga0265318_10040954 Ga0265318_100409542 154
21 3300031240 Ga0265320_10007987 Ga0265320_100079874 154
22 3300031247 Ga0265340_10022152 Ga0265340_100221522 154
23 3300031247 Ga0265340_10101268 Ga0265340_101012682 154
24 3300031250 Ga0265331_10043601 Ga0265331_100436012 154
25 3300031250 Ga0265331_10532007 Ga0265331_105320071 154
26 3300031711 Ga0265314_10044044 Ga0265314_100440443 154
27 3300036647 Ga0316582_0267146 Ga0316582_0267146_211_675 154
28 3300036712 Ga0316584_0093370 Ga0316584_0093370_1401_1865 154
29 3300042129 Ga0450891_002502 Ga0450891_002502_195_668 154
30 3300042876 Ga0451577_0002582 Ga0451577_0002582_1839_2303 154
31 3300044712 Ga0453684_0000003 Ga0453684_0000003_686278_686742 154
32 3300049523 Ga0501300_032352 Ga0501300_032352_143_610 154
33 3300049688 Ga0501259_047078 Ga0501259_047078_276_743 154
34 3300053136 Ga0500559_0000637 Ga0500559_0000637_2906_3382 154
35 3300053136 Ga0500559_0199871 Ga0500559_0199871_233_721 154
36 2162886006 SwRhRL3b_contig_1626295 SwRhRL3b_0390.00001200 155
37 2162886006 SwRhRL3b_contig_1913618 SwRhRL3b_0828.00001810 155
38 2162886006 SwRhRL3b_contig_998987 SwRhRL3b_0345.00001410 155
39 2162886007 SwRhRL2b_contig_2238289 SwRhRL2b_0267.00007420 155
40 3300005289 Ga0065704_10129869 Ga0065704_101298692 155
41 3300005293 Ga0065715_10143564 Ga0065715_101435642 155
42 3300005295 Ga0065707_10001120 Ga0065707_1000112011 155
43 3300005295 Ga0065707_10082652 Ga0065707_100826526 155
44 3300005295 Ga0065707_10085800 Ga0065707_100858004 155
45 3300005295 Ga0065707_10086606 Ga0065707_100866062 155
46 3300005340 Ga0070689_100206376 Ga0070689_1002063762 155
47 3300005340 Ga0070689_100277527 Ga0070689_1002775272 155
48 3300005341 Ga0070691_10506073 Ga0070691_105060732 155
49 3300005353 Ga0070669_100103288 Ga0070669_1001032883 155
50 3300005440 Ga0070705_100040064 Ga0070705_1000400642 155
51 3300005441 Ga0070700_100131387 Ga0070700_1001313872 155
52 3300005444 Ga0070694_100082196 Ga0070694_1000821962 155
53 3300005445 Ga0070708_100527250 Ga0070708_1005272502 155
54 3300005467 Ga0070706_100308708 Ga0070706_1003087082 155
55 3300005468 Ga0070707_100099054 Ga0070707_1000990543 155
56 3300005468 Ga0070707_100204717 Ga0070707_1002047172 155
57 3300005471 Ga0070698_100047635 Ga0070698_1000476351 155
58 3300005471 Ga0070698_100110198 Ga0070698_1001101982 155
59 3300005518 Ga0070699_100056858 Ga0070699_1000568583 155
60 3300005518 Ga0070699_100066727 Ga0070699_1000667273 155
61 3300005518 Ga0070699_100821877 Ga0070699_1008218771 155
62 3300005536 Ga0070697_100089999 Ga0070697_1000899992 155
63 3300005536 Ga0070697_100288913 Ga0070697_1002889132 155
64 3300005545 Ga0070695_100139399 Ga0070695_1001393992 155
65 3300005546 Ga0070696_100039787 Ga0070696_1000397873 155
66 3300005546 Ga0070696_100535485 Ga0070696_1005354852 155
67 3300005546 Ga0070696_101080405 Ga0070696_1010804051 155
68 3300005547 Ga0070693_100652757 Ga0070693_1006527572 155
69 3300005549 Ga0070704_100101672 Ga0070704_1001016722 155
70 3300005549 Ga0070704_100178903 Ga0070704_1001789031 155
71 3300005577 Ga0068857_101154662 Ga0068857_1011546621 155
72 3300005615 Ga0070702_100247640 Ga0070702_1002476402 155
73 3300005615 Ga0070702_100695562 Ga0070702_1006955622 155
74 3300005617 Ga0068859_100025820 Ga0068859_1000258204 155
75 3300005617 Ga0068859_100349918 Ga0068859_1003499181 155
76 3300005618 Ga0068864_100308220 Ga0068864_1003082202 155
77 3300005719 Ga0068861_100254461 Ga0068861_1002544612 155
78 3300005719 Ga0068861_100522794 Ga0068861_1005227941 155
79 3300005844 Ga0068862_100025147 Ga0068862_1000251474 155
80 3300005844 Ga0068862_100093254 Ga0068862_1000932542 155
81 3300005844 Ga0068862_100345171 Ga0068862_1003451712 155
82 3300005844 Ga0068862_100467284 Ga0068862_1004672842 155
83 3300006048 Ga0075363_100017205 Ga0075363_1000172051 155
84 3300006051 Ga0075364_10827092 Ga0075364_108270921 155
85 3300006177 Ga0075362_10149829 Ga0075362_101498292 155
86 3300006186 Ga0075369_10100832 Ga0075369_101008322 155
87 3300006194 Ga0075427_10053164 Ga0075427_100531642 155
88 3300006844 Ga0075428_100420894 Ga0075428_1004208941 155
89 3300006846 Ga0075430_100326430 Ga0075430_1003264302 155
90 3300006880 Ga0075429_100006419 Ga0075429_1000064199 155
91 3300006880 Ga0075429_100676225 Ga0075429_1006762252 155
92 3300006880 Ga0075429_100967734 Ga0075429_1009677341 155
93 3300006931 Ga0097620_100025819 Ga0097620_1000258193 155
94 3300006931 Ga0097620_100349915 Ga0097620_1003499152 155
95 3300009093 Ga0105240_11359897 Ga0105240_113598971 155
96 3300009094 Ga0111539_10018112 Ga0111539_100181127 155
97 3300009147 Ga0114129_10025998 Ga0114129_100259983 155
98 3300009147 Ga0114129_10035325 Ga0114129_100353257 155
99 3300009147 Ga0114129_10325835 Ga0114129_103258353 155
100 3300009148 Ga0105243_10070027 Ga0105243_100700272 155
101 3300009174 Ga0105241_11327158 Ga0105241_113271581 155
102 3300009174 Ga0105241_11436992 Ga0105241_114369921 155
103 3300009553 Ga0105249_10084934 Ga0105249_100849344 155
104 3300009553 Ga0105249_10248519 Ga0105249_102485192 155
105 3300009553 Ga0105249_10739090 Ga0105249_107390901 155
106 3300009553 Ga0105249_11418378 Ga0105249_114183782 155
107 3300010375 Ga0105239_11106916 Ga0105239_111069162 155
108 3300011119 Ga0105246_10162118 Ga0105246_101621181 155
109 3300014326 Ga0157380_10296525 Ga0157380_102965252 155
110 3300025904 Ga0207647_10383816 Ga0207647_103838162 155
111 3300025908 Ga0207643_10235482 Ga0207643_102354821 155
112 3300025910 Ga0207684_10277641 Ga0207684_102776412 155
113 3300025917 Ga0207660_10345663 Ga0207660_103456632 155
114 3300025922 Ga0207646_10075859 Ga0207646_100758592 155
115 3300025922 Ga0207646_10256471 Ga0207646_102564712 155
116 3300025923 Ga0207681_10510911 Ga0207681_105109111 155
117 3300025935 Ga0207709_10098979 Ga0207709_100989792 155
118 3300025936 Ga0207670_10656065 Ga0207670_106560652 155
119 3300025961 Ga0207712_10045412 Ga0207712_100454124 155
120 3300025961 Ga0207712_10222833 Ga0207712_102228332 155
121 3300026075 Ga0207708_10146767 Ga0207708_101467673 155
122 3300026075 Ga0207708_10854921 Ga0207708_108549211 155
123 3300026116 Ga0207674_10128256 Ga0207674_101282563 155
124 3300026118 Ga0207675_100153854 Ga0207675_1001538541 155
125 3300028380 Ga0268265_10021545 Ga0268265_100215457 155
126 3300028380 Ga0268265_10209245 Ga0268265_102092452 155
127 3300028380 Ga0268265_10417139 Ga0268265_104171392 155
128 3300028380 Ga0268265_10946441 Ga0268265_109464412 155
129 3300031548 Ga0307408_100002613 Ga0307408_1000026133 155
130 3300031727 Ga0316576_10435564 Ga0316576_104355642 155
131 3300031731 Ga0307405_10541343 Ga0307405_105413432 155
132 3300031852 Ga0307410_10035870 Ga0307410_100358701 155
133 3300031901 Ga0307406_10085547 Ga0307406_100855472 155
134 3300031911 Ga0307412_10256826 Ga0307412_102568262 155
135 3300031995 Ga0307409_100032814 Ga0307409_1000328143 155
136 3300032002 Ga0307416_100071249 Ga0307416_1000712492 155
137 3300032002 Ga0307416_101261129 Ga0307416_1012611292 155
138 3300032126 Ga0307415_100522303 Ga0307415_1005223032 155
139 3300035115 Ga0373941_0410009 Ga0373941_0410009_45_551 155
140 3300042876 Ga0451577_0008642 Ga0451577_0008642_16_483 155
141 3300042876 Ga0451577_0041511 Ga0451577_0041511_43_549 155
142 3300042876 Ga0451577_0157371 Ga0451577_0157371_307_798 155
143 3300042876 Ga0451577_0257802 Ga0451577_0257802_579_1046 155
144 3300042876 Ga0451577_1128708 Ga0451577_1128708_24_506 155
145 3300042876 Ga0451577_1141520 Ga0451577_1141520_128_595 155
146 3300044673 Ga0453683_0000414 Ga0453683_0000414_43990_44472 155
147 3300044673 Ga0453683_0010141 Ga0453683_0010141_2451_2918 155
148 3300044673 Ga0453683_0036743 Ga0453683_0036743_2387_2857 155
149 3300044673 Ga0453683_0393909 Ga0453683_0393909_52_519 155
150 3300044673 Ga0453683_0578775 Ga0453683_0578775_52_558 155
151 3300044673 Ga0453683_0912338 Ga0453683_0912338_25_522 155
152 3300044712 Ga0453684_0000430 Ga0453684_0000430_33780_34247 155
153 3300044712 Ga0453684_0000535 Ga0453684_0000535_53933_54400 155
154 3300044712 Ga0453684_0009674 Ga0453684_0009674_9421_9888 155
155 3300044712 Ga0453684_0017644 Ga0453684_0017644_3477_3983 155
156 3300044712 Ga0453684_0019002 Ga0453684_0019002_6068_6535 155
157 3300044712 Ga0453684_0027253 Ga0453684_0027253_7365_7874 155
158 3300044712 Ga0453684_0043095 Ga0453684_0043095_4318_4785 155
159 3300044712 Ga0453684_0044135 Ga0453684_0044135_5136_5603 155
160 3300044712 Ga0453684_0098694 Ga0453684_0098694_1737_2204 155
161 3300044712 Ga0453684_0122488 Ga0453684_0122488_2118_2585 155
162 3300044712 Ga0453684_0163099 Ga0453684_0163099_944_1450 155
163 3300044712 Ga0453684_0163852 Ga0453684_0163852_1130_1600 155
164 3300044712 Ga0453684_0202553 Ga0453684_0202553_1506_1973 155
165 3300044712 Ga0453684_0278914 Ga0453684_0278914_582_1079 155
166 3300044712 Ga0453684_0311826 Ga0453684_0311826_1035_1502 155
167 3300044712 Ga0453684_0491408 Ga0453684_0491408_763_1230 155
168 3300044712 Ga0453684_0762521 Ga0453684_0762521_431_898 155
169 3300044712 Ga0453684_1131557 Ga0453684_1131557_340_807 155
170 3300045051 Ga0451576_0010009 Ga0451576_0010009_147_629 155
171 3300045051 Ga0451576_0036297 Ga0451576_0036297_2818_3285 155
172 3300045051 Ga0451576_0061121 Ga0451576_0061121_2569_3066 155
173 3300045051 Ga0451576_0460384 Ga0451576_0460384_323_829 155
174 3300045051 Ga0451576_0626904 Ga0451576_0626904_187_654 155
175 3300049518 Ga0501295_131444 Ga0501295_131444_14_481 155
176 3300049522 Ga0501299_082983 Ga0501299_082983_231_698 155
177 3300049668 Ga0501233_075813 Ga0501233_075813_208_675 155
178 3300049707 Ga0501234_025041 Ga0501234_025041_178_645 155
179 3300050489 nmdc:mga03683_98343_c1 nmdc:mga03683_98343_c1_602_1102 155
180 3300050490 nmdc:mga03n38_25832_c1 nmdc:mga03n38_25832_c1_1444_1944 155
181 3300050491 nmdc:mga00v17_11288_c1 nmdc:mga00v17_11288_c1_4376_4876 155
182 3300050507 nmdc:mga05p37_18069_c1 nmdc:mga05p37_18069_c1_6190_6657 155
183 3300050507 nmdc:mga05p37_26047_c1 nmdc:mga05p37_26047_c1_4442_4909 155
184 3300050508 nmdc:mga09592_305050_c1 nmdc:mga09592_305050_c1_69_536 155
185 3300050511 nmdc:mga08y16_291559_c1 nmdc:mga08y16_291559_c1_39_506 155
186 3300050515 nmdc:mga0a205_115312_c1 nmdc:mga0a205_115312_c1_140_607 155
187 3300053140 Ga0500573_0004011 Ga0500573_0004011_2368_2850 155
188 3300053142 Ga0500577_0203221 Ga0500577_0203221_334_813 155
189 iso_pu_bacteria 2870622029 2870623361 155
190 iso_pu_bacteria 2964326757 2964329538 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03928

HbpS-like

Haem degrading protein HbpS-like

20

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4clc-assembly1.cif.gz_C-2 crystal structure of ybr137w protein 0.9325 5 154
4clc-assembly1.cif.gz_A-2 crystal structure of ybr137w protein 0.9269 5 152
4clc-assembly1.cif.gz_D-2 crystal structure of ybr137w protein 0.9265 5 150
4clc-assembly1.cif.gz_E-2 crystal structure of ybr137w protein 0.922 5 155
4clc-assembly1.cif.gz_B-2 crystal structure of ybr137w protein 0.9201 5 150
ID Description Score Start End Superfamily
af_Q9P7D6_10_179_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9643 2 155 3.30.450.150
af_A0A1D8PRF3_3_167_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9619 5 153 3.30.450.150
af_Q9P7D6_10_179_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9523 2 155 3.30.450.150
4clcB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9201 5 150 3.30.450.150
af_A0A1D8PRF3_3_167_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9199 5 153 3.30.450.150
ID Description Score Start End GO Terms
AF-A0A7Y5BU56-F1-model_v4 UPF0303 protein HUU38_18210 1.001 4 153
AF-A0A7W4P7J1-F1-model_v4 UPF0303 protein HLH21_13820 0.9954 5 152
AF-A0A317PUG0-F1-model_v4 UPF0303 protein DFR52_1011266 0.9942 5 153
AF-A3TI08-F1-model_v4 Uncharacterized protein 0.9941 5 152
AF-A0A2N2BBH0-F1-model_v4 deleted 0.9939 2 154

Feature Viewer

pLDDT pTM Quality
96.56 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map