F292312

General Info

Members Datasets Scaffolds Average Seq Length
190 151 380 182

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100660260|Ga0075428_1006602601
Length 203
Sequence MTGLVLAVHRSPTHTMAKSTQPSIRLLAGLGVEDDAHAGVTVKHRSRVARDPSQPNLRQVHLIQAELHDELTGRGMSVEYGQTAEQIRSTRPTFTREQPCHWAGRMGENITTRGIDLLALPTGARLRLGPAALIEVTGLRNPCVQLEGIHSGLMQAVLDRDVDGALVRRAGVMGIVLAGGEVSPGDPIEVTLPNLPHEPLRPV

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
29 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
30 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
45 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
50 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
51 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
55 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
60 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
61 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
62 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
63 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
64 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
65 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
66 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
71 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
74 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
75 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
110 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
111 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
112 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
113 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
114 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
115 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
116 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
117 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
118 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
121 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
124 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
125 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
126 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
127 2751185800 Brucella pituitosa AA2 Isolate Unclassified
128 2773857925 Microvirga vignae BR3299 Isolate Unclassified
129 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
130 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
131 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
132 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
133 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
134 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
135 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
136 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
137 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
138 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
139 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
140 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
141 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
142 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
143 2858950400 Achromobacter sp. K91 Isolate Unclassified
144 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
145 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
146 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
147 2941479691
148 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
149 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
150 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
151 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.74
Metatranscriptomes 0
Isolates 15.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20
Nodule 10
Rhizoplane 8.42
Rhizosphere 37.89
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100660260 3300006844 Bacteria 1115
2 JGI24735J21928_10077765 3300002067 Bacteria 950
3 JGI25151J46595_10065622 3300003187 Bacteria 1129
4 JGI25165J46597_1006725 3300003214 Bacteria 2006
5 JGI25153J46596_10000012 3300003215 Bacteria 308056
6 JGI25153J46596_10007803 3300003215 Bacteria 5199
7 rootH1_10143086 3300003316 Bacteria 3178
8 Ga0055524_1000927 3300003775 Bacteria 18883
9 Ga0055524_1024668 3300003775 Bacteria 1900
10 Ga0055528_1006965 3300003790 Bacteria 5060
11 Ga0065704_10330030 3300005289 Bacteria 839
12 Ga0070682_100091742 3300005337 Bacteria 1989
13 Ga0070663_101078956 3300005455 Bacteria 701
14 Ga0070684_100295026 3300005535 Bacteria 1487
15 Ga0068853_100111944 3300005539 Bacteria 2426
16 Ga0070672_100740756 3300005543 Bacteria 862
17 Ga0070702_100157244 3300005615 Bacteria 1465
18 Ga0068859_100032913 3300005617 Bacteria 5207
19 Ga0068870_10608099 3300005840 Bacteria 744
20 Ga0075365_10013997 3300006038 Bacteria 4816
21 Ga0075363_100144684 3300006048 Bacteria 1340
22 Ga0070716_100407414 3300006173 Bacteria 979
23 Ga0114129_10544239 3300009147 Bacteria 1511
24 Ga0105246_10371621 3300011119 Bacteria 1178
25 Ga0157369_11506077 3300013105 Bacteria 684
26 Ga0157372_10215733 3300013307 Bacteria 2224
27 Ga0157377_10265501 3300014745 Bacteria 1119
28 Ga0157379_10387812 3300014968 Bacteria 1282
29 Ga0207427_101547 3300025231 Bacteria 8017
30 Ga0209129_1027676 3300025258 Bacteria 968
31 Ga0209233_1000769 3300025261 Bacteria 14440
32 Ga0209673_1004108 3300025273 Bacteria 7999
33 Ga0209676_1020274 3300025292 Bacteria 2264
34 Ga0209025_1003016 3300025294 Bacteria 16641
35 Ga0209025_1051293 3300025294 Bacteria 1641
36 Ga0209564_1017865 3300025295 Bacteria 2736
37 Ga0209758_1012155 3300025297 Bacteria 4858
38 Ga0209256_1014988 3300025299 Bacteria 2743
39 Ga0209051_1011719 3300025303 Bacteria 4305
40 Ga0209051_1058979 3300025303 Bacteria 1219
41 Ga0207643_10486738 3300025908 Bacteria 788
42 Ga0207662_10090137 3300025918 Bacteria 1885
43 Ga0207679_10914865 3300025945 Bacteria 802
44 Ga0207678_10918484 3300026067 Bacteria 774
45 Ga0207708_10275677 3300026075 Bacteria 1361
46 Ga0207683_10199741 3300026121 Bacteria 1817
47 Ga0268266_10191462 3300028379 Bacteria 1868
48 Ga0307509_10263205 3300031507 Bacteria 1498
49 Ga0265314_10026272 3300031711 Bacteria 4376
50 Ga0307413_10379653 3300031824 Bacteria 1101
51 Ga0307412_10000195 3300031911 Bacteria 41902
52 Ga0307412_10002725 3300031911 Bacteria 9822
53 Ga0307416_100044938 3300032002 Bacteria 3473
54 Ga0373931_0199778 3300035691 Bacteria 1194
55 Ga0373927_0001005 3300035695 Bacteria 21497
56 Ga0373947_0051692 3300035725 Bacteria 2473
57 Ga0395905_0039028 3300037471 Bacteria 4455
58 Ga0395901_0027421 3300038443 Bacteria 5853
59 Ga0451843_0267890 3300041509 Bacteria 2159
60 Ga0439431_0030946 3300041997 Bacteria 1328
61 Ga0466970_0332535 3300044765 Bacteria 860
62 Ga0495592_0003598 3300046454 Bacteria 11140
63 Ga0495638_0377875 3300046460 Bacteria 741
64 Ga0495605_0012692 3300046474 Bacteria 4666
65 Ga0495607_0026415 3300046501 Bacteria 3603
66 Ga0495607_0136381 3300046501 Bacteria 1271
67 Ga0495606_0002479 3300046507 Bacteria 21357
68 Ga0495606_0006577 3300046507 Bacteria 10687
69 Ga0495606_0036364 3300046507 Bacteria 3354
70 Ga0495610_0039007 3300046512 Bacteria 2405
71 Ga0495610_0164081 3300046512 Bacteria 937
72 Ga0495620_0045225 3300046515 Bacteria 1908
73 Ga0495643_0177156 3300046522 Bacteria 1038
74 Ga0495609_0030723 3300046538 Bacteria 2445
75 Ga0495597_0012069 3300046542 Bacteria 4176
76 Ga0495625_0067978 3300046660 Bacteria 2505
77 Ga0495661_0064098 3300046665 Bacteria 2170
78 Ga0495613_0207475 3300046689 Bacteria 1379
79 Ga0495636_0041717 3300047318 Bacteria 1905
80 Ga0495672_0016397 3300047320 Bacteria 4994
81 Ga0495676_0639220 3300047321 Bacteria 691
82 Ga0495683_0238013 3300047323 Bacteria 804
83 Ga0495687_078123 3300047443 Bacteria 1305
84 Ga0495686_0013896 3300047472 Bacteria 5571
85 Ga0495686_0058698 3300047472 Bacteria 2397
86 Ga0495626_0154272 3300048091 Bacteria 966
87 Ga0496100_0019752 3300048903 Bacteria 4027
88 Ga0496101_0613074 3300048904 Bacteria 860
89 Ga0496102_0075425 3300048905 Bacteria 3100
90 Ga0496102_1051299 3300048905 Bacteria 734
91 Ga0496103_0012033 3300048906 Bacteria 5139
92 Ga0496105_0273353 3300048908 Bacteria 1364
93 Ga0496106_0024125 3300048909 Bacteria 4521
94 Ga0496107_0033814 3300048910 Bacteria 3659
95 Ga0496108_0068123 3300048911 Bacteria 3002
96 Ga0496109_0359511 3300048912 Bacteria 1375
97 Ga0496110_0037113 3300048913 Bacteria 4234
98 Ga0496111_0057775 3300048914 Bacteria 2808
99 Ga0496112_0000016 3300048915 Bacteria 194634
100 Ga0496112_0190979 3300048915 Bacteria 2010
101 Ga0496113_0035673 3300048916 Bacteria 3638
102 Ga0496114_0219389 3300048917 Bacteria 1669
103 Ga0496116_0004945 3300048919 Bacteria 12554
104 Ga0496116_0083724 3300048919 Bacteria 1967
105 Ga0496116_0125890 3300048919 Bacteria 1472
106 Ga0496116_0340166 3300048919 Bacteria 692
107 Ga0496117_0071426 3300048920 Bacteria 2326
108 Ga0496118_0061758 3300048921 Bacteria 2772
109 Ga0496119_0001621 3300048922 Bacteria 26603
110 Ga0496119_0024394 3300048922 Bacteria 4256
111 Ga0496119_0083414 3300048922 Bacteria 1835
112 Ga0496120_0009605 3300048923 Bacteria 6838
113 Ga0496120_0066807 3300048923 Bacteria 1988
114 Ga0496121_0013643 3300048924 Bacteria 8711
115 Ga0496121_0049275 3300048924 Bacteria 3573
116 Ga0496121_0051479 3300048924 Bacteria 3467
117 Ga0496121_0099084 3300048924 Bacteria 2253
118 Ga0496121_0200910 3300048924 Bacteria 1421
119 Ga0496122_0000227 3300048925 Bacteria 125743
120 Ga0496122_0073559 3300048925 Bacteria 2422
121 Ga0496122_0116403 3300048925 Bacteria 1738
122 Ga0496123_0000265 3300048926 Bacteria 104723
123 Ga0496123_0038110 3300048926 Bacteria 3384
124 Ga0496123_0375830 3300048926 Bacteria 653
125 Ga0496124_0094648 3300048927 Bacteria 2429
126 Ga0496124_0139527 3300048927 Bacteria 1914
127 Ga0496124_0555793 3300048927 Bacteria 756
128 Ga0496125_0000241 3300048928 Bacteria 112044
129 Ga0496125_0018115 3300048928 Bacteria 6693
130 Ga0496125_0301083 3300048928 Bacteria 982
131 Ga0496125_0417627 3300048928 Bacteria 778
132 Ga0496126_0000778 3300048929 Bacteria 57576
133 Ga0496126_0004765 3300048929 Bacteria 15974
134 Ga0496126_0030983 3300048929 Bacteria 5059
135 Ga0496126_0144535 3300048929 Bacteria 2044
136 Ga0496126_0164462 3300048929 Bacteria 1894
137 Ga0501047_0000261 3300049581 Bacteria 61793
138 Ga0501067_0000923 3300049583 Bacteria 15771
139 Ga0501067_0006559 3300049583 Bacteria 6450
140 Ga0501068_0153899 3300049584 Bacteria 1446
141 Ga0501068_0229784 3300049584 Bacteria 1180
142 Ga0501069_0114118 3300049585 Bacteria 1540
143 nmdc:mga0yw44_2520_c2 3300050492 Bacteria 4713
144 nmdc:mga07m45_224713_c1 3300050496 Bacteria 1092
145 nmdc:mga05p37_841947_c1 3300050507 Bacteria 997
146 Ga0500578_0043261 3300053086 Bacteria 2890
147 Ga0500643_001061 3300053087 Bacteria 16632
148 Ga0500643_001141 3300053087 Bacteria 15856
149 Ga0500566_0053335 3300053094 Unclassified 2308
150 Ga0500569_016434 3300053109 Bacteria 1874
151 Ga0500595_006264 3300053119 Bacteria 5070
152 Ga0500618_021328 3300053125 Bacteria 1581
153 Ga0500621_058750 3300053126 Bacteria 1555
154 Ga0500642_0013313 3300053130 Bacteria 3019
155 Ga0500658_0000110 3300053134 Bacteria 38421
156 Ga0500659_0058249 3300053135 Bacteria 2066
157 Ga0500577_0000092 3300053142 Bacteria 21385
158 Ga0500577_0032747 3300053142 Bacteria 1831
159 Ga0500586_000905 3300053145 Bacteria 6095
160 Ga0500633_0028349 3300053160 Bacteria 1781
161 Ga0501082_0563914 3300060353 Bacteria 996
162 2513581430 2513237085 Bacteria 7695351
163 2515737744 2515154134 Bacteria 7220242
164 2517079700 2516653085 Bacteria 7346596
165 2585530322 2585427526 Bacteria 7258840
166 2753357231 2751185800 Bacteria 5467370
167 2774869633 2773857925 Bacteria 6472445
168 2821446713 2821443989 Bacteria 7658172
169 2838693864 2838686498 Bacteria 7807632
170 2838736256 2838729681 Bacteria 7400765
171 2838749075 2838742623 Bacteria 7396178
172 2841858860 2841851746 Bacteria 7532261
173 2842163178 2842156927 Bacteria 6894975
174 2842164534 2842163707 Bacteria 6916235
175 2842186785 2842180545 Bacteria 6888678
176 2842236565 2842229732 Bacteria 7475766
177 2842250206 2842243621 Bacteria 7421798
178 2842263960 2842257432 Bacteria 7401195
179 2842278152 2842271015 Bacteria 7807131
180 2842309756 2842304105 Bacteria 7023636
181 2844459984 2844454524 Bacteria 7952546
182 2858956615 2858950400 Bacteria 6783797
183 2891404468 2891395885 Bacteria 9251614
184 2933576197 2933570622 Bacteria 7023390
185 2935906005 2935901341 Bacteria 7341747
186 2941480504
187 8002747412 8002745576 Bacteria 4840272
188 8005308405 8005307578 Bacteria 7395396
189 8023681433 8023680758 Bacteria 7729763
190 8055435202 8055431914 Bacteria 4551896
191 Ga0075428_100660260
192 JGI24735J21928_10077765
193 JGI25151J46595_10065622
194 JGI25165J46597_1006725
195 JGI25153J46596_10000012
196 JGI25153J46596_10007803
197 rootH1_10143086
198 Ga0055524_1000927
199 Ga0055524_1024668
200 Ga0055528_1006965
201 Ga0065704_10330030
202 Ga0070682_100091742
203 Ga0070663_101078956
204 Ga0070684_100295026
205 Ga0068853_100111944
206 Ga0070672_100740756
207 Ga0070702_100157244
208 Ga0068859_100032913
209 Ga0068870_10608099
210 Ga0075365_10013997
211 Ga0075363_100144684
212 Ga0070716_100407414
213 Ga0114129_10544239
214 Ga0105246_10371621
215 Ga0157369_11506077
216 Ga0157372_10215733
217 Ga0157377_10265501
218 Ga0157379_10387812
219 Ga0207427_101547
220 Ga0209129_1027676
221 Ga0209233_1000769
222 Ga0209673_1004108
223 Ga0209676_1020274
224 Ga0209025_1003016
225 Ga0209025_1051293
226 Ga0209564_1017865
227 Ga0209758_1012155
228 Ga0209256_1014988
229 Ga0209051_1011719
230 Ga0209051_1058979
231 Ga0207643_10486738
232 Ga0207662_10090137
233 Ga0207679_10914865
234 Ga0207678_10918484
235 Ga0207708_10275677
236 Ga0207683_10199741
237 Ga0268266_10191462
238 Ga0307509_10263205
239 Ga0265314_10026272
240 Ga0307413_10379653
241 Ga0307412_10000195
242 Ga0307412_10002725
243 Ga0307416_100044938
244 Ga0373931_0199778
245 Ga0373927_0001005
246 Ga0373947_0051692
247 Ga0395905_0039028
248 Ga0395901_0027421
249 Ga0451843_0267890
250 Ga0439431_0030946
251 Ga0466970_0332535
252 Ga0495592_0003598
253 Ga0495638_0377875
254 Ga0495605_0012692
255 Ga0495607_0026415
256 Ga0495607_0136381
257 Ga0495606_0002479
258 Ga0495606_0006577
259 Ga0495606_0036364
260 Ga0495610_0039007
261 Ga0495610_0164081
262 Ga0495620_0045225
263 Ga0495643_0177156
264 Ga0495609_0030723
265 Ga0495597_0012069
266 Ga0495625_0067978
267 Ga0495661_0064098
268 Ga0495613_0207475
269 Ga0495636_0041717
270 Ga0495672_0016397
271 Ga0495676_0639220
272 Ga0495683_0238013
273 Ga0495687_078123
274 Ga0495686_0013896
275 Ga0495686_0058698
276 Ga0495626_0154272
277 Ga0496100_0019752
278 Ga0496101_0613074
279 Ga0496102_0075425
280 Ga0496102_1051299
281 Ga0496103_0012033
282 Ga0496105_0273353
283 Ga0496106_0024125
284 Ga0496107_0033814
285 Ga0496108_0068123
286 Ga0496109_0359511
287 Ga0496110_0037113
288 Ga0496111_0057775
289 Ga0496112_0000016
290 Ga0496112_0190979
291 Ga0496113_0035673
292 Ga0496114_0219389
293 Ga0496116_0004945
294 Ga0496116_0083724
295 Ga0496116_0125890
296 Ga0496116_0340166
297 Ga0496117_0071426
298 Ga0496118_0061758
299 Ga0496119_0001621
300 Ga0496119_0024394
301 Ga0496119_0083414
302 Ga0496120_0009605
303 Ga0496120_0066807
304 Ga0496121_0013643
305 Ga0496121_0049275
306 Ga0496121_0051479
307 Ga0496121_0099084
308 Ga0496121_0200910
309 Ga0496122_0000227
310 Ga0496122_0073559
311 Ga0496122_0116403
312 Ga0496123_0000265
313 Ga0496123_0038110
314 Ga0496123_0375830
315 Ga0496124_0094648
316 Ga0496124_0139527
317 Ga0496124_0555793
318 Ga0496125_0000241
319 Ga0496125_0018115
320 Ga0496125_0301083
321 Ga0496125_0417627
322 Ga0496126_0000778
323 Ga0496126_0004765
324 Ga0496126_0030983
325 Ga0496126_0144535
326 Ga0496126_0164462
327 Ga0501047_0000261
328 Ga0501067_0000923
329 Ga0501067_0006559
330 Ga0501068_0153899
331 Ga0501068_0229784
332 Ga0501069_0114118
333 nmdc:mga0yw44_2520_c2
334 nmdc:mga07m45_224713_c1
335 nmdc:mga05p37_841947_c1
336 Ga0500578_0043261
337 Ga0500643_001061
338 Ga0500643_001141
339 Ga0500566_0053335
340 Ga0500569_016434
341 Ga0500595_006264
342 Ga0500618_021328
343 Ga0500621_058750
344 Ga0500642_0013313
345 Ga0500658_0000110
346 Ga0500659_0058249
347 Ga0500577_0000092
348 Ga0500577_0032747
349 Ga0500586_000905
350 Ga0500633_0028349
351 Ga0501082_0563914
352 2513581430
353 2515737744
354 2517079700
355 2585530322
356 2753357231
357 2774869633
358 2821446713
359 2838693864
360 2838736256
361 2838749075
362 2841858860
363 2842163178
364 2842164534
365 2842186785
366 2842236565
367 2842250206
368 2842263960
369 2842278152
370 2842309756
371 2844459984
372 2858956615
373 2891404468
374 2933576197
375 2935906005
376 2941480504
377 8002747412
378 8005308405
379 8023681433
380 8055435202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

53

189

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vgb-assembly1.cif.gz_B human erythrocyte pyruvate kinase 0.8161 87 167
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.808 1 171
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.7666 1 171
1o67-assembly3.cif.gz_C crystal structure of an hypothetical protein 0.7655 1 175
4ip7-assembly1.cif.gz_C structure of the s12d variant of human liver pyruvate kinase in complex with citrate and fbp. 0.7621 83 166
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8044 2 171 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7748 2 171 2.40.33.20
af_U4PC34_202_334_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7338 56 166 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7327 2 176 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7289 4 175 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A7T9YPC6-F1-model_v4 deleted 0.9961 2 180
AF-A0A2W1W8Y0-F1-model_v4 deleted 0.9959 1 180
AF-A0A387HRZ8-F1-model_v4 MOSC domain-containing protein 0.9953 3 180 GO:0003824
GO:0030151
GO:0030170
AF-A0A7X0L8Y2-F1-model_v4 MOSC domain-containing protein YiiM 0.9948 51 180 GO:0003824
GO:0030151
GO:0030170
AF-A0A1I5IZ29-F1-model_v4 MOSC domain-containing protein YiiM 0.9946 3 180 GO:0003824
GO:0030151
GO:0030170

Map