F291676

General Info

Members Datasets Scaffolds Average Seq Length
189 146 188 277

Family's Representative Sequence

Representative Sequence 3300053150|Ga0500603_000074|Ga0500603_000074_2393_3301
Length 302
Sequence LAASQGAAASRRARDADEWRGFRMTALADLSRPNAVSLDERSKHLRRLAVRALDKGERGHIGSTMSLIEILRVLYDDVLRVRPSEPAWPRRDRLILSKGHGCIALYVMLAEKGFFPLETLDTFCHRDSILGGHPEFGKVPGVEASTGALGHGLSIGIGMALAARIQRRDSRVFVIMGDGEINEGSVWEAAMCAGKHKLSELTAIIDYNKIQSAGPTKEILDLEPLVDKWRAFGFATAEVDGHDVVELRKAFGGLPLDRSRPTAIICHTVKGKGIPFAENDPAWHHKAKLPRETIADMYRALE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
134 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
135 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
136 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
137 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
140 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
143 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
144 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
145 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
146 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 1.59
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 0
Rhizoplane 7.41
Rhizosphere 74.6
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002493 3300003203 Bacteria 8703
2 Ga0065707_10084575 3300005295 Bacteria 7045
3 Ga0070680_100016542 3300005336 Bacteria 5804
4 Ga0070682_100030466 3300005337 Bacteria 3257
5 Ga0070660_100414973 3300005339 Bacteria 1114
6 Ga0070691_10080921 3300005341 Bacteria 1590
7 Ga0070714_100401806 3300005435 Bacteria 1295
8 Ga0070710_10047584 3300005437 Bacteria 2393
9 Ga0070708_100061744 3300005445 Bacteria 3349
10 Ga0070708_100563456 3300005445 Bacteria 1074
11 Ga0070663_100054967 3300005455 Unclassified 2848
12 Ga0070662_100201456 3300005457 Bacteria 1580
13 Ga0070681_10343789 3300005458 Bacteria 1402
14 Ga0070699_100131182 3300005518 Bacteria 2209
15 Ga0070697_100160101 3300005536 Bacteria 1901
16 Ga0070697_100557272 3300005536 Bacteria 1005
17 Ga0070695_100010884 3300005545 Bacteria 5435
18 Ga0070696_100028633 3300005546 Bacteria 3802
19 Ga0070665_100001775 3300005548 Bacteria 24559
20 Ga0068855_100088589 3300005563 Bacteria 3575
21 Ga0070702_100575754 3300005615 Bacteria 840
22 Ga0068859_100091363 3300005617 Bacteria 3095
23 Ga0068863_100144434 3300005841 Bacteria 2275
24 Ga0068862_100159313 3300005844 Bacteria 2014
25 Ga0081455_10002803 3300005937 Bacteria 20522
26 Ga0081539_10001624 3300005985 Bacteria 36878
27 Ga0081539_10001942 3300005985 Bacteria 31702
28 Ga0075365_10107044 3300006038 Bacteria 1919
29 Ga0075364_10314548 3300006051 Bacteria 1066
30 Ga0070712_100441508 3300006175 Bacteria 1082
31 Ga0075366_10099567 3300006195 Bacteria 1744
32 Ga0097621_100089939 3300006237 Bacteria 2568
33 Ga0075428_100073760 3300006844 Bacteria 3728
34 Ga0075431_100164858 3300006847 Bacteria 2278
35 Ga0075433_10294920 3300006852 Bacteria 1436
36 Ga0075434_100000001 3300006871 Bacteria 160353
37 Ga0075434_100144033 3300006871 Bacteria 2403
38 Ga0075434_100160906 3300006871 Unclassified 2265
39 Ga0075436_100000127 3300006914 Bacteria 45376
40 Ga0075436_100221956 3300006914 Unclassified 1341
41 Ga0097620_100091366 3300006931 Bacteria 3095
42 Ga0075435_100000007 3300007076 Bacteria 118665
43 Ga0075435_100002903 3300007076 Bacteria 11512
44 Ga0075435_100155619 3300007076 Bacteria 1923
45 Ga0099795_10001943 3300007788 Bacteria 4694
46 Ga0099795_10036906 3300007788 Bacteria 1717
47 Ga0111539_10009669 3300009094 Bacteria 12169
48 Ga0111539_10023222 3300009094 Bacteria 7618
49 Ga0111539_10086775 3300009094 Bacteria 3677
50 Ga0111539_10218105 3300009094 Unclassified 2222
51 Ga0111539_10595638 3300009094 Bacteria 1287
52 Ga0105245_10031370 3300009098 Bacteria 4702
53 Ga0105245_10364271 3300009098 Bacteria 1435
54 Ga0105247_10070279 3300009101 Bacteria 2187
55 Ga0114129_10005982 3300009147 Bacteria 17233
56 Ga0114129_10172436 3300009147 Bacteria 2948
57 Ga0105243_10052800 3300009148 Bacteria 3221
58 Ga0105241_10014478 3300009174 Bacteria 5776
59 Ga0105238_10021682 3300009551 Bacteria 6545
60 Ga0099796_10002746 3300010159 Bacteria 3944
61 Ga0099796_10055346 3300010159 Bacteria 1389
62 Ga0105246_10173015 3300011119 Bacteria 1655
63 Ga0105246_10245206 3300011119 Bacteria 1418
64 Ga0157370_10039709 3300013104 Unclassified 4547
65 Ga0163162_10081539 3300013306 Unclassified 3306
66 Ga0163162_10082193 3300013306 Bacteria 3293
67 Ga0163163_10349616 3300014325 Unclassified 1534
68 Ga0157379_10487122 3300014968 Unclassified 1142
69 Ga0157376_10397783 3300014969 Bacteria 1331
70 Ga0213876_10033247 3300021384 Bacteria 2719
71 Ga0224572_1005997 3300024225 Bacteria 2186
72 Ga0209233_1003592 3300025261 Bacteria 5438
73 Ga0209758_1001796 3300025297 Bacteria 23691
74 Ga0207693_10195468 3300025915 Bacteria 1591
75 Ga0207660_10081917 3300025917 Bacteria 2373
76 Ga0207694_10024217 3300025924 Bacteria 4609
77 Ga0207700_10089265 3300025928 Bacteria 2429
78 Ga0207670_10119762 3300025936 Bacteria 1911
79 Ga0207689_10478385 3300025942 Bacteria 1043
80 Ga0207667_10113337 3300025949 Bacteria 2796
81 Ga0207703_10253222 3300026035 Bacteria 1588
82 Ga0207678_10009295 3300026067 Bacteria 8653
83 Ga0207641_10113931 3300026088 Bacteria 2402
84 Ga0207675_100103857 3300026118 Bacteria 2678
85 Ga0207683_10155791 3300026121 Unclassified 2063
86 Ga0207428_10059610 3300027907 Bacteria 3026
87 Ga0268266_10000275 3300028379 Bacteria 85106
88 Ga0268266_10384817 3300028379 Bacteria 1324
89 Ga0268266_10671657 3300028379 Bacteria 998
90 Ga0268264_10062715 3300028381 Bacteria 3122
91 Ga0265338_10005010 3300028800 Bacteria 17508
92 Ga0307509_10398584 3300031507 Bacteria 1084
93 Ga0265313_10004437 3300031595 Bacteria 10799
94 Ga0307516_10003144 3300031730 Bacteria 21485
95 Ga0307407_10119067 3300031903 Bacteria 1671
96 Ga0307409_100288746 3300031995 Bacteria 1520
97 Ga0316586_1007894 3300033527 Bacteria 1563
98 Ga0316587_1000691 3300033529 Bacteria 3635
99 Ga0316596_1004942 3300033541 Bacteria 3020
100 Ga0373953_0058119 3300035117 Bacteria 1576
101 Ga0373954_0070104 3300035118 Bacteria 1665
102 Ga0373943_0182812 3300035170 Unclassified 1153
103 Ga0373927_0010569 3300035695 Bacteria 6152
104 Ga0373947_0061995 3300035725 Unclassified 2274
105 Ga0373937_0330615 3300036401 Bacteria 1442
106 Ga0373925_0293555 3300037068 Unclassified 1311
107 Ga0395900_0121225 3300037418 Bacteria 2683
108 Ga0395898_0180961 3300037466 Bacteria 2015
109 Ga0436364_0324634 3300037853 Bacteria 983
110 Ga0436364_1325048 3300037853 Bacteria 1888
111 Ga0436364_1455479 3300037853 Bacteria 1835
112 Ga0436365_0502977 3300039437 Bacteria 2107
113 Ga0436365_0930981 3300039437 Bacteria 4811
114 Ga0436365_1430331 3300039437 Bacteria 923
115 Ga0436360_1244880 3300039438 Bacteria 2687
116 Ga0436362_0756540 3300039453 Bacteria 1678
117 Ga0439443_022930 3300042003 Bacteria 994
118 Ga0453684_0003416 3300044712 Bacteria 35864
119 Ga0495603_0265571 3300046455 Unclassified 987
120 Ga0495580_0000929 3300046472 Bacteria 25598
121 Ga0495580_0009344 3300046472 Bacteria 7715
122 Ga0495628_0283517 3300046516 Bacteria 1229
123 Ga0495628_0365439 3300046516 Bacteria 1059
124 Ga0495652_0094769 3300046529 Bacteria 2434
125 Ga0495665_0070916 3300046531 Unclassified 1836
126 Ga0495645_0177133 3300046543 Bacteria 1464
127 Ga0495667_0009665 3300046559 Bacteria 6538
128 Ga0495667_0276584 3300046559 Bacteria 1066
129 Ga0495634_0016355 3300046642 Bacteria 5306
130 Ga0495635_0193604 3300046663 Unclassified 1380
131 Ga0495600_0166294 3300046809 Bacteria 1425
132 Ga0495604_0121826 3300047317 Bacteria 1887
133 Ga0495674_0105459 3300047319 Bacteria 2395
134 Ga0495674_0195481 3300047319 Unclassified 1680
135 Ga0496100_0062644 3300048903 Bacteria 2455
136 Ga0496102_0041365 3300048905 Bacteria 4172
137 Ga0496102_0111896 3300048905 Bacteria 2546
138 Ga0496104_0117312 3300048907 Unclassified 2554
139 Ga0496104_0489185 3300048907 Bacteria 1142
140 Ga0496105_0036987 3300048908 Bacteria 4022
141 Ga0496108_0222972 3300048911 Bacteria 1638
142 Ga0496109_0148545 3300048912 Bacteria 2194
143 Ga0496109_0282336 3300048912 Bacteria 1565
144 Ga0496112_0275323 3300048915 Unclassified 1631
145 Ga0496113_0495529 3300048916 Unclassified 981
146 Ga0496114_0058189 3300048917 Bacteria 3227
147 Ga0496115_0071743 3300048918 Unclassified 2809
148 Ga0496115_0077833 3300048918 Bacteria 2697
149 Ga0501080_0296213 3300049742 Bacteria 1468
150 nmdc:mga00v17_440895_c1 3300050491 Bacteria 846
151 nmdc:mga0k408_98886_c1 3300050493 Bacteria 1719
152 nmdc:mga05p37_50534_c1 3300050507 Bacteria 5113
153 nmdc:mga05p37_73459_c1 3300050507 Bacteria 4209
154 nmdc:mga05p37_93679_c1 3300050507 Bacteria 3701
155 nmdc:mga06r32_543581_c1 3300050510 Bacteria 1136
156 nmdc:mga08y16_149642_c1 3300050511 Bacteria 2427
157 nmdc:mga08y16_83738_c1 3300050511 Bacteria 3324
158 nmdc:mga08y16_8600_c1 3300050511 Bacteria 10698
159 nmdc:mga0n895_108922_c1 3300050512 Bacteria 2785
160 nmdc:mga0n895_113614_c1 3300050512 Bacteria 2726
161 nmdc:mga0n895_27_c1 3300050512 Bacteria 89407
162 nmdc:mga0n895_660284_c1 3300050512 Bacteria 1044
163 nmdc:mga0rr50_30517_c1 3300050513 Bacteria 3818
164 nmdc:mga0rr50_6_c1 3300050513 Bacteria 310626
165 nmdc:mga08x19_173_c1 3300050514 Bacteria 53439
166 nmdc:mga0a205_146586_c1 3300050515 Bacteria 2261
167 Ga0495601_0100787 3300053077 Bacteria 1865
168 Ga0495601_0199119 3300053077 Unclassified 1309
169 Ga0495595_0067078 3300053084 Unclassified 1691
170 Ga0495595_0070178 3300053084 Bacteria 1655
171 Ga0495619_0040160 3300053085 Bacteria 3058
172 Ga0500644_0000482 3300053088 Bacteria 17537
173 Ga0500566_0000002 3300053094 Bacteria 221889
174 Ga0500555_019891 3300053103 Bacteria 1934
175 Ga0500572_000094 3300053111 Bacteria 29088
176 Ga0500595_016194 3300053119 Bacteria 2782
177 Ga0500595_029428 3300053119 Bacteria 1863
178 Ga0500608_009386 3300053122 Bacteria 4154
179 Ga0500614_026136 3300053123 Bacteria 1393
180 Ga0500642_0026006 3300053130 Bacteria 2385
181 Ga0500559_0000690 3300053136 Bacteria 22236
182 Ga0500590_087940 3300053148 Bacteria 1514
183 Ga0500603_000074 3300053150 Bacteria 23022
184 Ga0500616_0000001 3300053153 Bacteria 1986011
185 Ga0500630_007912 3300053159 Bacteria 5205
186 Ga0500638_018693 3300053162 Bacteria 3237
187 Ga0500639_000002 3300053163 Bacteria 233548
188 Ga0500596_001120 3300053735 Bacteria 5387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10084575 Ga0065707_100845753 250
2 3300013104 Ga0157370_10039709 Ga0157370_100397092 255
3 3300050491 nmdc:mga00v17_440895_c1 nmdc:mga00v17_440895_c1_47_814 255
4 3300005985 Ga0081539_10001942 Ga0081539_1000194217 256
5 3300037853 Ga0436364_1325048 Ga0436364_1325048_1054_1863 257
6 3300046516 Ga0495628_0283517 Ga0495628_0283517_143_922 258
7 3300046559 Ga0495667_0009665 Ga0495667_0009665_5150_5929 258
8 3300046809 Ga0495600_0166294 Ga0495600_0166294_332_1111 258
9 3300046516 Ga0495628_0365439 Ga0495628_0365439_184_984 259
10 iso_pu_bacteria 8054002106 8054002186 261
11 3300006195 Ga0075366_10099567 Ga0075366_100995672 265
12 3300035170 Ga0373943_0182812 Ga0373943_0182812_113_910 265
13 3300035725 Ga0373947_0061995 Ga0373947_0061995_824_1621 265
14 3300046455 Ga0495603_0265571 Ga0495603_0265571_16_813 265
15 3300046642 Ga0495634_0016355 Ga0495634_0016355_2337_3134 265
16 3300050493 nmdc:mga0k408_98886_c1 nmdc:mga0k408_98886_c1_84_887 265
17 3300053084 Ga0495595_0067078 Ga0495595_0067078_765_1562 265
18 3300005615 Ga0070702_100575754 Ga0070702_1005757541 266
19 3300005844 Ga0068862_100159313 Ga0068862_1001593132 266
20 3300050511 nmdc:mga08y16_83738_c1 nmdc:mga08y16_83738_c1_1191_1994 266
21 3300053119 Ga0500595_029428 Ga0500595_029428_202_1008 267
22 3300005457 Ga0070662_100201456 Ga0070662_1002014562 269
23 3300005546 Ga0070696_100028633 Ga0070696_1000286333 269
24 3300005937 Ga0081455_10002803 Ga0081455_1000280318 269
25 3300009094 Ga0111539_10218105 Ga0111539_102181053 269
26 3300009148 Ga0105243_10052800 Ga0105243_100528002 269
27 3300013306 Ga0163162_10082193 Ga0163162_100821933 269
28 3300014969 Ga0157376_10397783 Ga0157376_103977832 269
29 3300026121 Ga0207683_10155791 Ga0207683_101557913 269
30 3300048905 Ga0496102_0111896 Ga0496102_0111896_248_1096 269
31 3300005458 Ga0070681_10343789 Ga0070681_103437891 270
32 3300005563 Ga0068855_100088589 Ga0068855_1000885893 270
33 3300025949 Ga0207667_10113337 Ga0207667_101133372 270
34 3300005445 Ga0070708_100061744 Ga0070708_1000617442 271
35 3300005518 Ga0070699_100131182 Ga0070699_1001311822 271
36 3300005536 Ga0070697_100160101 Ga0070697_1001601012 271
37 3300005536 Ga0070697_100557272 Ga0070697_1005572721 271
38 3300005548 Ga0070665_100001775 Ga0070665_10000177515 271
39 3300006871 Ga0075434_100000001 Ga0075434_10000000159 271
40 3300006871 Ga0075434_100144033 Ga0075434_1001440333 271
41 3300006914 Ga0075436_100000127 Ga0075436_10000012733 271
42 3300007076 Ga0075435_100000007 Ga0075435_10000000759 271
43 3300007076 Ga0075435_100002903 Ga0075435_1000029032 271
44 3300007076 Ga0075435_100155619 Ga0075435_1001556192 271
45 3300009094 Ga0111539_10595638 Ga0111539_105956381 271
46 3300009098 Ga0105245_10364271 Ga0105245_103642712 271
47 3300009551 Ga0105238_10021682 Ga0105238_100216825 271
48 3300014325 Ga0163163_10349616 Ga0163163_103496162 271
49 3300025924 Ga0207694_10024217 Ga0207694_100242172 271
50 3300028379 Ga0268266_10000275 Ga0268266_1000027524 271
51 3300037418 Ga0395900_0121225 Ga0395900_0121225_595_1419 271
52 3300042003 Ga0439443_022930 Ga0439443_022930_86_919 271
53 3300046472 Ga0495580_0000929 Ga0495580_0000929_10910_11740 271
54 3300048907 Ga0496104_0117312 Ga0496104_0117312_1546_2361 271
55 3300050507 nmdc:mga05p37_50534_c1 nmdc:mga05p37_50534_c1_629_1453 271
56 3300050512 nmdc:mga0n895_108922_c1 nmdc:mga0n895_108922_c1_1658_2482 271
57 3300050512 nmdc:mga0n895_113614_c1 nmdc:mga0n895_113614_c1_180_1013 271
58 3300050512 nmdc:mga0n895_27_c1 nmdc:mga0n895_27_c1_84461_85285 271
59 3300050513 nmdc:mga0rr50_30517_c1 nmdc:mga0rr50_30517_c1_2278_3102 271
60 3300050513 nmdc:mga0rr50_6_c1 nmdc:mga0rr50_6_c1_143022_143846 271
61 3300050514 nmdc:mga08x19_173_c1 nmdc:mga08x19_173_c1_45989_46813 271
62 3300050515 nmdc:mga0a205_146586_c1 nmdc:mga0a205_146586_c1_825_1658 271
63 3300005336 Ga0070680_100016542 Ga0070680_1000165423 273
64 3300005337 Ga0070682_100030466 Ga0070682_1000304663 273
65 3300005339 Ga0070660_100414973 Ga0070660_1004149731 273
66 3300005341 Ga0070691_10080921 Ga0070691_100809211 273
67 3300005445 Ga0070708_100563456 Ga0070708_1005634561 273
68 3300005455 Ga0070663_100054967 Ga0070663_1000549672 273
69 3300005545 Ga0070695_100010884 Ga0070695_1000108842 273
70 3300006237 Ga0097621_100089939 Ga0097621_1000899393 273
71 3300009098 Ga0105245_10031370 Ga0105245_100313702 273
72 3300009101 Ga0105247_10070279 Ga0105247_100702792 273
73 3300009174 Ga0105241_10014478 Ga0105241_100144783 273
74 3300011119 Ga0105246_10245206 Ga0105246_102452062 273
75 3300025261 Ga0209233_1003592 Ga0209233_10035922 273
76 3300025917 Ga0207660_10081917 Ga0207660_100819172 273
77 3300025942 Ga0207689_10478385 Ga0207689_104783852 273
78 3300026067 Ga0207678_10009295 Ga0207678_100092955 273
79 3300028379 Ga0268266_10671657 Ga0268266_106716571 273
80 3300037853 Ga0436364_1455479 Ga0436364_1455479_566_1429 273
81 3300039453 Ga0436362_0756540 Ga0436362_0756540_750_1616 273
82 3300048903 Ga0496100_0062644 Ga0496100_0062644_1314_2162 273
83 3300048905 Ga0496102_0041365 Ga0496102_0041365_853_1701 273
84 3300048918 Ga0496115_0077833 Ga0496115_0077833_1291_2139 273
85 3300013306 Ga0163162_10081539 Ga0163162_100815392 274
86 3300044712 Ga0453684_0003416 Ga0453684_0003416_619_1458 274
87 3300053103 Ga0500555_019891 Ga0500555_019891_242_1087 274
88 3300053119 Ga0500595_016194 Ga0500595_016194_36_887 274
89 3300046529 Ga0495652_0094769 Ga0495652_0094769_812_1648 275
90 3300046543 Ga0495645_0177133 Ga0495645_0177133_139_975 275
91 3300047317 Ga0495604_0121826 Ga0495604_0121826_447_1283 275
92 3300053077 Ga0495601_0100787 Ga0495601_0100787_799_1635 275
93 3300006038 Ga0075365_10107044 Ga0075365_101070442 277
94 3300006051 Ga0075364_10314548 Ga0075364_103145482 277
95 3300006852 Ga0075433_10294920 Ga0075433_102949202 277
96 3300009094 Ga0111539_10086775 Ga0111539_100867753 277
97 3300039437 Ga0436365_1430331 Ga0436365_1430331_12_857 277
98 3300021384 Ga0213876_10033247 Ga0213876_100332473 278
99 3300025936 Ga0207670_10119762 Ga0207670_101197622 278
100 3300026118 Ga0207675_100103857 Ga0207675_1001038573 278
101 3300039437 Ga0436365_0930981 Ga0436365_0930981_2656_3495 278
102 3300048912 Ga0496109_0148545 Ga0496109_0148545_459_1304 278
103 3300003203 JGI25406J46586_10002493 JGI25406J46586_1000249312 279
104 3300005435 Ga0070714_100401806 Ga0070714_1004018062 279
105 3300005437 Ga0070710_10047584 Ga0070710_100475842 279
106 3300005617 Ga0068859_100091363 Ga0068859_1000913632 279
107 3300005841 Ga0068863_100144434 Ga0068863_1001444342 279
108 3300005985 Ga0081539_10001624 Ga0081539_1000162426 279
109 3300006175 Ga0070712_100441508 Ga0070712_1004415082 279
110 3300006844 Ga0075428_100073760 Ga0075428_1000737603 279
111 3300006847 Ga0075431_100164858 Ga0075431_1001648582 279
112 3300006871 Ga0075434_100160906 Ga0075434_1001609063 279
113 3300006914 Ga0075436_100221956 Ga0075436_1002219561 279
114 3300006931 Ga0097620_100091366 Ga0097620_1000913663 279
115 3300007788 Ga0099795_10001943 Ga0099795_100019434 279
116 3300007788 Ga0099795_10036906 Ga0099795_100369062 279
117 3300009094 Ga0111539_10009669 Ga0111539_100096692 279
118 3300009094 Ga0111539_10023222 Ga0111539_100232223 279
119 3300009147 Ga0114129_10005982 Ga0114129_100059828 279
120 3300009147 Ga0114129_10172436 Ga0114129_101724362 279
121 3300010159 Ga0099796_10002746 Ga0099796_100027463 279
122 3300010159 Ga0099796_10055346 Ga0099796_100553461 279
123 3300011119 Ga0105246_10173015 Ga0105246_101730152 279
124 3300014968 Ga0157379_10487122 Ga0157379_104871221 279
125 3300024225 Ga0224572_1005997 Ga0224572_10059972 279
126 3300025297 Ga0209758_1001796 Ga0209758_10017964 279
127 3300025915 Ga0207693_10195468 Ga0207693_101954682 279
128 3300025928 Ga0207700_10089265 Ga0207700_100892653 279
129 3300026035 Ga0207703_10253222 Ga0207703_102532222 279
130 3300026088 Ga0207641_10113931 Ga0207641_101139312 279
131 3300027907 Ga0207428_10059610 Ga0207428_100596103 279
132 3300028379 Ga0268266_10384817 Ga0268266_103848172 279
133 3300028381 Ga0268264_10062715 Ga0268264_100627153 279
134 3300028800 Ga0265338_10005010 Ga0265338_1000501012 279
135 3300031507 Ga0307509_10398584 Ga0307509_103985842 279
136 3300031595 Ga0265313_10004437 Ga0265313_100044375 279
137 3300031730 Ga0307516_10003144 Ga0307516_1000314415 279
138 3300031903 Ga0307407_10119067 Ga0307407_101190672 279
139 3300031995 Ga0307409_100288746 Ga0307409_1002887462 279
140 3300033527 Ga0316586_1007894 Ga0316586_10078942 279
141 3300033529 Ga0316587_1000691 Ga0316587_10006915 279
142 3300033541 Ga0316596_1004942 Ga0316596_10049424 279
143 3300035117 Ga0373953_0058119 Ga0373953_0058119_480_1331 279
144 3300035118 Ga0373954_0070104 Ga0373954_0070104_264_1115 279
145 3300035695 Ga0373927_0010569 Ga0373927_0010569_3664_4515 279
146 3300036401 Ga0373937_0330615 Ga0373937_0330615_229_1080 279
147 3300037068 Ga0373925_0293555 Ga0373925_0293555_170_1021 279
148 3300037466 Ga0395898_0180961 Ga0395898_0180961_1008_1859 279
149 3300037853 Ga0436364_0324634 Ga0436364_0324634_95_943 279
150 3300039437 Ga0436365_0502977 Ga0436365_0502977_208_1110 279
151 3300039438 Ga0436360_1244880 Ga0436360_1244880_508_1356 279
152 3300046472 Ga0495580_0009344 Ga0495580_0009344_6636_7487 279
153 3300046531 Ga0495665_0070916 Ga0495665_0070916_867_1718 279
154 3300046559 Ga0495667_0276584 Ga0495667_0276584_166_1017 279
155 3300046663 Ga0495635_0193604 Ga0495635_0193604_98_946 279
156 3300047319 Ga0495674_0105459 Ga0495674_0105459_967_1818 279
157 3300047319 Ga0495674_0195481 Ga0495674_0195481_622_1470 279
158 3300048907 Ga0496104_0489185 Ga0496104_0489185_40_888 279
159 3300048908 Ga0496105_0036987 Ga0496105_0036987_104_952 279
160 3300048911 Ga0496108_0222972 Ga0496108_0222972_535_1380 279
161 3300048912 Ga0496109_0282336 Ga0496109_0282336_334_1179 279
162 3300048915 Ga0496112_0275323 Ga0496112_0275323_268_1113 279
163 3300048916 Ga0496113_0495529 Ga0496113_0495529_70_915 279
164 3300048917 Ga0496114_0058189 Ga0496114_0058189_2115_2972 279
165 3300048918 Ga0496115_0071743 Ga0496115_0071743_108_947 279
166 3300049742 Ga0501080_0296213 Ga0501080_0296213_493_1344 279
167 3300050507 nmdc:mga05p37_73459_c1 nmdc:mga05p37_73459_c1_2054_2902 279
168 3300050507 nmdc:mga05p37_93679_c1 nmdc:mga05p37_93679_c1_2104_2952 279
169 3300050510 nmdc:mga06r32_543581_c1 nmdc:mga06r32_543581_c1_240_1088 279
170 3300050511 nmdc:mga08y16_149642_c1 nmdc:mga08y16_149642_c1_1084_1932 279
171 3300050511 nmdc:mga08y16_8600_c1 nmdc:mga08y16_8600_c1_1944_2792 279
172 3300050512 nmdc:mga0n895_660284_c1 nmdc:mga0n895_660284_c1_148_996 279
173 3300053077 Ga0495601_0199119 Ga0495601_0199119_209_1057 279
174 3300053084 Ga0495595_0070178 Ga0495595_0070178_454_1302 279
175 3300053085 Ga0495619_0040160 Ga0495619_0040160_798_1655 279
176 3300053088 Ga0500644_0000482 Ga0500644_0000482_11331_12179 279
177 3300053094 Ga0500566_0000002 Ga0500566_0000002_50547_51386 279
178 3300053111 Ga0500572_000094 Ga0500572_000094_2116_2955 279
179 3300053122 Ga0500608_009386 Ga0500608_009386_2589_3428 279
180 3300053123 Ga0500614_026136 Ga0500614_026136_168_1007 279
181 3300053130 Ga0500642_0026006 Ga0500642_0026006_632_1480 279
182 3300053136 Ga0500559_0000690 Ga0500559_0000690_2319_3158 279
183 3300053148 Ga0500590_087940 Ga0500590_087940_489_1328 279
184 3300053150 Ga0500603_000074 Ga0500603_000074_2393_3301 279
185 3300053153 Ga0500616_0000001 Ga0500616_0000001_1566294_1567142 279
186 3300053159 Ga0500630_007912 Ga0500630_007912_593_1432 279
187 3300053162 Ga0500638_018693 Ga0500638_018693_942_1781 279
188 3300053163 Ga0500639_000002 Ga0500639_000002_55539_56378 279
189 3300053735 Ga0500596_001120 Ga0500596_001120_166_1005 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

39

301

0.93

PF00676

E1_dh

Dehydrogenase E1 component

133

253

0.93

PF13292

DXP_synthase_N

1-deoxy-D-xylulose-5-phosphate synthase

23

221

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_CCC split gene transketolase, active alpha2beta2 heterotetramer 0.9662 19 278
4kxw-assembly1.cif.gz_A human transketolase in covalent complex with donor ketose d-xylulose-5-phosphate, crystal 2 0.9393 19 278
3uk1-assembly1.cif.gz_B crystal structure of a transketolase from burkholderia thailandensis with an oxidized cysteinesulfonic acid in the active site 0.9368 19 278
5vrb-assembly2.cif.gz_B crystal structure of a transketolase from neisseria gonorrhoeae 0.9342 16 278
3rim-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis transketolase (rv1449c) 0.9339 19 278
ID Description Score Start End Superfamily
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9548 19 278 3.40.50.970
3rimD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9339 19 278 3.40.50.970
af_Q556J0_5_332_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9254 19 278 3.40.50.970
5hjeA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9231 19 278 3.40.50.970
af_Q2FYT8_1_292_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9221 50 277 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A0B1TWL5-F1-model_v4 Transketolase, N-terminal section 0.9815 15 278
AF-A0A6G8UEK9-F1-model_v4 Transketolase 0.9778 15 278
AF-M7AF59-F1-model_v4 Dehydrogenase E1 component domain protein 0.9762 91 279
AF-A0A358LFH5-F1-model_v4 deleted 0.9721 36 253
AF-A0A2N9MT19-F1-model_v4 Putative transketolase N-terminal section (EC 2.2.1.1) 0.9714 19 278 GO:0004802

Feature Viewer

pLDDT pTM Quality
88.04 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map