F291278

General Info

Members Datasets Scaffolds Average Seq Length
189 138 378 295

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_241780|Ga0400483_241780_204_1079
Length 291
Sequence MTGFDASPLPKRYAIVEGKQMAYHEVGDGRPVVFLHGNPTSSYLWRNIIPHLSDRARCIAPDLIGQGDSDKLDDTGPDSYRFVEHRRYLDGLLDQLDLGDDIVFVIHDWGSALGFDWARRHPERVGGVVFMEAIVRPIDSWNEWPEAARGIFQGFRSDAGEEMVITKNLFVEAVLPGSIMRTLSDDEHNQYRKPFLEPEHRRPTLSWPRQIPIEGEPADVVEIVADYAQWLPTTEFPKLFVNAEPGAILGDSQRAFVRTWPNLSEVTVAGIHFIQEDSPHDIGQAIADWLP

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
81 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
90 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
91 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
92 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
136 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
137 2558860280 Kutzneria sp. 744 Isolate Unclassified
138 2775507255 Sphingobium indicum B90A Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.29
Rhizosphere 87.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_241780 3300039062 Bacteria 1859
2 JGI25406J46586_10038539 3300003203 Bacteria 1712
3 Ga0070676_10098473 3300005328 Bacteria 1803
4 Ga0070690_100191923 3300005330 Bacteria 1417
5 Ga0070666_10348317 3300005335 Bacteria 1059
6 Ga0070689_100089207 3300005340 Bacteria 2428
7 Ga0070691_10101776 3300005341 Bacteria 1428
8 Ga0070668_100481385 3300005347 Bacteria 1072
9 Ga0070674_100048266 3300005356 Bacteria 2921
10 Ga0070667_100085644 3300005367 Bacteria 2703
11 Ga0070714_100226500 3300005435 Bacteria 1721
12 Ga0070710_10029919 3300005437 Bacteria 2926
13 Ga0070700_100008120 3300005441 Bacteria 5706
14 Ga0070708_100003361 3300005445 Bacteria 12533
15 Ga0070708_100017470 3300005445 Bacteria 5986
16 Ga0070678_100014119 3300005456 Bacteria 5029
17 Ga0070706_100020207 3300005467 Bacteria 6136
18 Ga0070707_100012445 3300005468 Bacteria 7947
19 Ga0070707_100039070 3300005468 Bacteria 4535
20 Ga0070698_100038604 3300005471 Bacteria 4920
21 Ga0070698_100063402 3300005471 Bacteria 3727
22 Ga0070698_100331478 3300005471 Bacteria 1453
23 Ga0070699_100051508 3300005518 Bacteria 3564
24 Ga0070684_100051930 3300005535 Bacteria 3563
25 Ga0070697_100091760 3300005536 Bacteria 2512
26 Ga0070697_100133553 3300005536 Bacteria 2083
27 Ga0070697_100196934 3300005536 Bacteria 1711
28 Ga0070672_100054058 3300005543 Bacteria 3142
29 Ga0068859_100039004 3300005617 Bacteria 4764
30 Ga0068864_100206341 3300005618 Bacteria 1807
31 Ga0068861_100008044 3300005719 Bacteria 7258
32 Ga0068862_100605726 3300005844 Bacteria 1052
33 Ga0081539_10001258 3300005985 Bacteria 44901
34 Ga0081539_10050214 3300005985 Bacteria 2361
35 Ga0070715_10007334 3300006163 Bacteria 3794
36 Ga0070716_100235444 3300006173 Bacteria 1239
37 Ga0070712_100010381 3300006175 Bacteria 5875
38 Ga0070712_100064160 3300006175 Bacteria 2604
39 Ga0070712_100070194 3300006175 Bacteria 2502
40 Ga0075428_100118666 3300006844 Bacteria 2881
41 Ga0075428_100193634 3300006844 Bacteria 2199
42 Ga0075428_100220557 3300006844 Bacteria 2048
43 Ga0075428_100629844 3300006844 Bacteria 1144
44 Ga0075430_100024089 3300006846 Bacteria 5182
45 Ga0075430_100065572 3300006846 Bacteria 3050
46 Ga0075430_100219922 3300006846 Bacteria 1576
47 Ga0075431_100071350 3300006847 Bacteria 3584
48 Ga0075434_100130316 3300006871 Bacteria 2533
49 Ga0075429_100088577 3300006880 Bacteria 2698
50 Ga0075429_100384382 3300006880 Bacteria 1229
51 Ga0097620_100039003 3300006931 Bacteria 4764
52 Ga0075435_100043320 3300007076 Bacteria 3603
53 Ga0099794_10057956 3300007265 Bacteria 1877
54 Ga0099795_10000687 3300007788 Bacteria 6527
55 Ga0099795_10065467 3300007788 Bacteria 1359
56 Ga0111539_10023087 3300009094 Bacteria 7640
57 Ga0111539_10045263 3300009094 Bacteria 5268
58 Ga0111539_10075040 3300009094 Bacteria 3984
59 Ga0111539_10145109 3300009094 Bacteria 2779
60 Ga0105247_10012670 3300009101 Bacteria 5059
61 Ga0114129_10101531 3300009147 Bacteria 3980
62 Ga0114129_10173769 3300009147 Bacteria 2935
63 Ga0114129_10420306 3300009147 Bacteria 1758
64 Ga0114129_10641525 3300009147 Bacteria 1372
65 Ga0105248_10087092 3300009177 Bacteria 3514
66 Ga0105237_10034522 3300009545 Bacteria 5121
67 Ga0105238_10003598 3300009551 Bacteria 15440
68 Ga0105249_10159433 3300009553 Bacteria 2179
69 Ga0099796_10001114 3300010159 Bacteria 5165
70 Ga0099796_10103119 3300010159 Bacteria 1076
71 Ga0157375_10557217 3300013308 Bacteria 1307
72 Ga0163163_10032710 3300014325 Bacteria 5025
73 Ga0163163_10087129 3300014325 Bacteria 3132
74 Ga0213876_10085506 3300021384 Bacteria 1669
75 Ga0213876_10163499 3300021384 Bacteria 1184
76 Ga0213875_10022746 3300021388 Bacteria 2998
77 Ga0207682_10003255 3300025893 Bacteria 7104
78 Ga0207692_10040238 3300025898 Bacteria 2306
79 Ga0207645_10013981 3300025907 Bacteria 5384
80 Ga0207684_10008144 3300025910 Bacteria 9347
81 Ga0207693_10017056 3300025915 Bacteria 5797
82 Ga0207693_10059114 3300025915 Bacteria 3003
83 Ga0207693_10067101 3300025915 Bacteria 2809
84 Ga0207662_10031205 3300025918 Bacteria 3096
85 Ga0207646_10011647 3300025922 Bacteria 8504
86 Ga0207646_10118767 3300025922 Bacteria 2375
87 Ga0207646_10145019 3300025922 Bacteria 2139
88 Ga0207694_10081558 3300025924 Bacteria 2541
89 Ga0207650_10101141 3300025925 Bacteria 2219
90 Ga0207650_10250833 3300025925 Bacteria 1433
91 Ga0207664_10143742 3300025929 Bacteria 2021
92 Ga0207709_10047729 3300025935 Bacteria 2605
93 Ga0207669_10255196 3300025937 Bacteria 1308
94 Ga0207665_10232442 3300025939 Bacteria 1355
95 Ga0207691_10001672 3300025940 Bacteria 21925
96 Ga0207691_10073086 3300025940 Bacteria 3093
97 Ga0207689_10020061 3300025942 Bacteria 5627
98 Ga0207651_10336202 3300025960 Bacteria 1267
99 Ga0207658_10147292 3300025986 Bacteria 1914
100 Ga0207708_10403877 3300026075 Bacteria 1130
101 Ga0207648_10009261 3300026089 Bacteria 9461
102 Ga0207676_10010536 3300026095 Bacteria 6586
103 Ga0207675_100014581 3300026118 Bacteria 7324
104 Ga0207683_10004315 3300026121 Bacteria 12280
105 Ga0209588_1021858 3300027671 Bacteria 2012
106 Ga0207428_10096333 3300027907 Bacteria 2291
107 Ga0207428_10153502 3300027907 Bacteria 1752
108 Ga0207428_10322852 3300027907 Bacteria 1140
109 Ga0265330_10041027 3300031235 Bacteria 2053
110 Ga0265325_10034154 3300031241 Bacteria 2708
111 Ga0265340_10017112 3300031247 Bacteria 3749
112 Ga0265327_10128561 3300031251 Bacteria 1194
113 Ga0373958_0022393 3300034819 Bacteria 1180
114 Ga0373949_0017021 3300035090 Bacteria 1635
115 Ga0373939_0003203 3300035114 Bacteria 3837
116 Ga0373962_0002477 3300035242 Bacteria 4386
117 Ga0373962_0007822 3300035242 Bacteria 2623
118 Ga0373931_0006769 3300035691 Bacteria 5380
119 Ga0373925_0230191 3300037068 Bacteria 1482
120 Ga0436364_0691299 3300037853 Bacteria 8254
121 Ga0436364_1549215 3300037853 Bacteria 2144
122 Ga0400483_088437 3300039062 Bacteria 3984
123 Ga0400483_099844 3300039062 Bacteria 15104
124 Ga0436365_0294076 3300039437 Bacteria 4411
125 Ga0436365_0773535 3300039437 Bacteria 4972
126 Ga0436365_1605642 3300039437 Bacteria 1218
127 Ga0436361_0780064 3300039447 Bacteria 2185
128 Ga0439453_0001627 3300041408 Bacteria 2927
129 Ga0439443_000773 3300042003 Bacteria 3154
130 Ga0439435_0019946 3300042436 Bacteria 1724
131 Ga0439440_0005999 3300042993 Bacteria 2431
132 Ga0466969_0016834 3300044656 Bacteria 3823
133 Ga0466972_0010373 3300044658 Bacteria 4678
134 Ga0466966_0000545 3300044684 Bacteria 24031
135 Ga0466963_0049874 3300044694 Bacteria 2769
136 Ga0466971_0007599 3300044719 Bacteria 4727
137 Ga0466957_0003037 3300044842 Bacteria 9121
138 Ga0466957_0026625 3300044842 Bacteria 3432
139 Ga0466959_0028462 3300045049 Bacteria 4144
140 Ga0466958_0008298 3300045836 Bacteria 5752
141 Ga0495630_0343645 3300046517 Bacteria 1142
142 Ga0495621_0013851 3300046539 Bacteria 2542
143 Ga0496102_0030319 3300048905 Bacteria 4841
144 Ga0496104_0013255 3300048907 Bacteria 7430
145 Ga0496105_0009199 3300048908 Bacteria 7715
146 Ga0496109_0041290 3300048912 Bacteria 4179
147 Ga0496109_0347151 3300048912 Bacteria 1402
148 Ga0496110_0053124 3300048913 Bacteria 3561
149 Ga0496112_0125715 3300048915 Bacteria 2535
150 Ga0496114_0099514 3300048917 Bacteria 2480
151 Ga0496115_0022206 3300048918 Bacteria 4913
152 Ga0496115_0080021 3300048918 Bacteria 2660
153 Ga0501032_0010245 3300049569 Bacteria 6764
154 Ga0501034_0038877 3300049571 Bacteria 4819
155 Ga0501036_0037004 3300049572 Bacteria 4128
156 Ga0501037_0000588 3300049573 Bacteria 28582
157 Ga0501038_0067568 3300049574 Bacteria 3040
158 Ga0501039_0021273 3300049575 Bacteria 4977
159 Ga0501043_0001623 3300049579 Bacteria 19576
160 Ga0501070_0159872 3300049586 Bacteria 1857
161 Ga0501072_0272957 3300049588 Bacteria 1345
162 Ga0501073_0027849 3300049589 Bacteria 4038
163 Ga0501074_0021728 3300049590 Bacteria 4659
164 Ga0501077_0028175 3300049593 Bacteria 3569
165 Ga0501079_0038134 3300049741 Bacteria 3706
166 Ga0501080_0023293 3300049742 Bacteria 5741
167 Ga0501083_0052568 3300049744 Bacteria 2737
168 nmdc:mga05p37_133508_c1 3300050507 Bacteria 3045
169 nmdc:mga09592_28491_c1 3300050508 Bacteria 4640
170 nmdc:mga0qj67_11536_c1 3300050509 Bacteria 6623
171 nmdc:mga0qj67_14747_c1 3300050509 Bacteria 5907
172 nmdc:mga0qj67_66381_c1 3300050509 Bacteria 2874
173 nmdc:mga06r32_31128_c1 3300050510 Bacteria 5009
174 nmdc:mga06r32_393653_c1 3300050510 Bacteria 1368
175 nmdc:mga06r32_49225_c1 3300050510 Bacteria 4030
176 nmdc:mga08y16_135669_c1 3300050511 Bacteria 2558
177 nmdc:mga08y16_150560_c1 3300050511 Bacteria 2419
178 nmdc:mga08y16_28432_c1 3300050511 Bacteria 5895
179 nmdc:mga08y16_4935_c1 3300050511 Bacteria 13938
180 nmdc:mga08y16_69774_c1 3300050511 Bacteria 3664
181 nmdc:mga0n895_17964_c1 3300050512 Bacteria 6536
182 nmdc:mga0n895_20277_c1 3300050512 Bacteria 6196
183 nmdc:mga0rr50_13534_c1 3300050513 Bacteria 5316
184 Ga0501084_0185756 3300054114 Bacteria 1754
185 Ga0501082_0009185 3300060353 Bacteria 8527
186 Ga0466962_0018300 3300061719 Bacteria 3370
187 2558905734 2558860112 Bacteria 9931328
188 2559431987 2558860280 Bacteria 11429938
189 2778125258 2775507255 Bacteria 3945731
190 Ga0400483_241780
191 JGI25406J46586_10038539
192 Ga0070676_10098473
193 Ga0070690_100191923
194 Ga0070666_10348317
195 Ga0070689_100089207
196 Ga0070691_10101776
197 Ga0070668_100481385
198 Ga0070674_100048266
199 Ga0070667_100085644
200 Ga0070714_100226500
201 Ga0070710_10029919
202 Ga0070700_100008120
203 Ga0070708_100003361
204 Ga0070708_100017470
205 Ga0070678_100014119
206 Ga0070706_100020207
207 Ga0070707_100012445
208 Ga0070707_100039070
209 Ga0070698_100038604
210 Ga0070698_100063402
211 Ga0070698_100331478
212 Ga0070699_100051508
213 Ga0070684_100051930
214 Ga0070697_100091760
215 Ga0070697_100133553
216 Ga0070697_100196934
217 Ga0070672_100054058
218 Ga0068859_100039004
219 Ga0068864_100206341
220 Ga0068861_100008044
221 Ga0068862_100605726
222 Ga0081539_10001258
223 Ga0081539_10050214
224 Ga0070715_10007334
225 Ga0070716_100235444
226 Ga0070712_100010381
227 Ga0070712_100064160
228 Ga0070712_100070194
229 Ga0075428_100118666
230 Ga0075428_100193634
231 Ga0075428_100220557
232 Ga0075428_100629844
233 Ga0075430_100024089
234 Ga0075430_100065572
235 Ga0075430_100219922
236 Ga0075431_100071350
237 Ga0075434_100130316
238 Ga0075429_100088577
239 Ga0075429_100384382
240 Ga0097620_100039003
241 Ga0075435_100043320
242 Ga0099794_10057956
243 Ga0099795_10000687
244 Ga0099795_10065467
245 Ga0111539_10023087
246 Ga0111539_10045263
247 Ga0111539_10075040
248 Ga0111539_10145109
249 Ga0105247_10012670
250 Ga0114129_10101531
251 Ga0114129_10173769
252 Ga0114129_10420306
253 Ga0114129_10641525
254 Ga0105248_10087092
255 Ga0105237_10034522
256 Ga0105238_10003598
257 Ga0105249_10159433
258 Ga0099796_10001114
259 Ga0099796_10103119
260 Ga0157375_10557217
261 Ga0163163_10032710
262 Ga0163163_10087129
263 Ga0213876_10085506
264 Ga0213876_10163499
265 Ga0213875_10022746
266 Ga0207682_10003255
267 Ga0207692_10040238
268 Ga0207645_10013981
269 Ga0207684_10008144
270 Ga0207693_10017056
271 Ga0207693_10059114
272 Ga0207693_10067101
273 Ga0207662_10031205
274 Ga0207646_10011647
275 Ga0207646_10118767
276 Ga0207646_10145019
277 Ga0207694_10081558
278 Ga0207650_10101141
279 Ga0207650_10250833
280 Ga0207664_10143742
281 Ga0207709_10047729
282 Ga0207669_10255196
283 Ga0207665_10232442
284 Ga0207691_10001672
285 Ga0207691_10073086
286 Ga0207689_10020061
287 Ga0207651_10336202
288 Ga0207658_10147292
289 Ga0207708_10403877
290 Ga0207648_10009261
291 Ga0207676_10010536
292 Ga0207675_100014581
293 Ga0207683_10004315
294 Ga0209588_1021858
295 Ga0207428_10096333
296 Ga0207428_10153502
297 Ga0207428_10322852
298 Ga0265330_10041027
299 Ga0265325_10034154
300 Ga0265340_10017112
301 Ga0265327_10128561
302 Ga0373958_0022393
303 Ga0373949_0017021
304 Ga0373939_0003203
305 Ga0373962_0002477
306 Ga0373962_0007822
307 Ga0373931_0006769
308 Ga0373925_0230191
309 Ga0436364_0691299
310 Ga0436364_1549215
311 Ga0400483_088437
312 Ga0400483_099844
313 Ga0436365_0294076
314 Ga0436365_0773535
315 Ga0436365_1605642
316 Ga0436361_0780064
317 Ga0439453_0001627
318 Ga0439443_000773
319 Ga0439435_0019946
320 Ga0439440_0005999
321 Ga0466969_0016834
322 Ga0466972_0010373
323 Ga0466966_0000545
324 Ga0466963_0049874
325 Ga0466971_0007599
326 Ga0466957_0003037
327 Ga0466957_0026625
328 Ga0466959_0028462
329 Ga0466958_0008298
330 Ga0495630_0343645
331 Ga0495621_0013851
332 Ga0496102_0030319
333 Ga0496104_0013255
334 Ga0496105_0009199
335 Ga0496109_0041290
336 Ga0496109_0347151
337 Ga0496110_0053124
338 Ga0496112_0125715
339 Ga0496114_0099514
340 Ga0496115_0022206
341 Ga0496115_0080021
342 Ga0501032_0010245
343 Ga0501034_0038877
344 Ga0501036_0037004
345 Ga0501037_0000588
346 Ga0501038_0067568
347 Ga0501039_0021273
348 Ga0501043_0001623
349 Ga0501070_0159872
350 Ga0501072_0272957
351 Ga0501073_0027849
352 Ga0501074_0021728
353 Ga0501077_0028175
354 Ga0501079_0038134
355 Ga0501080_0023293
356 Ga0501083_0052568
357 nmdc:mga05p37_133508_c1
358 nmdc:mga09592_28491_c1
359 nmdc:mga0qj67_11536_c1
360 nmdc:mga0qj67_14747_c1
361 nmdc:mga0qj67_66381_c1
362 nmdc:mga06r32_31128_c1
363 nmdc:mga06r32_393653_c1
364 nmdc:mga06r32_49225_c1
365 nmdc:mga08y16_135669_c1
366 nmdc:mga08y16_150560_c1
367 nmdc:mga08y16_28432_c1
368 nmdc:mga08y16_4935_c1
369 nmdc:mga08y16_69774_c1
370 nmdc:mga0n895_17964_c1
371 nmdc:mga0n895_20277_c1
372 nmdc:mga0rr50_13534_c1
373 Ga0501084_0185756
374 Ga0501082_0009185
375 Ga0466962_0018300
376 2558905734
377 2559431987
378 2778125258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

30

279

0.89

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

32

285

0.53

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h77-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb from sphingobium sp. mi1205 0.9931 3 293
4h7j-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb h247a mutant from sphingobium sp. mi1205 0.993 3 293
4h7f-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb v134i mutant from sphingobium sp. mi1205 0.993 3 293
4h7i-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb l138i mutant from sphingobium sp. mi1205 0.9929 3 293
4h7d-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb t81a mutant from sphingobium sp. mi1205 0.9928 3 293
ID Description Score Start End Superfamily
4brzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9862 11 290 3.40.50.1820
4brzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9493 11 290 3.40.50.1820
5mxpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9442 10 290 3.40.50.1820
2psfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9389 11 291 3.40.50.1820
3a2nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9358 12 293 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A537L374-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9934 1 292 GO:0018786
AF-A0A0M2ZFI6-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9933 3 292 GO:0018786
AF-W1KLX9-F1-model_v4 deleted 0.9933 1 144
AF-A0A6G9GSI9-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.993 3 292 GO:0018786
AF-A0A1A0LT33-F1-model_v4 deleted 0.9927 9 292

Map