F291202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 189 | 138 | 174 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10035514|Ga0307414_100355142 |
| Length | 302 |
| Sequence | MASMAPDNAAASSKDPGRESWIFVGERRVSAIPPDDRALAYGDGLFETMRACRGELPWWDAHWSRLERGAVRLRLAMPSPAKVRSEAAQLLDGRDGVLKLQLGRGSGGRGYAPPLAPEPSWILSRHPLPSSHPAAGLTLRWCDTQLALQPALAGIKHCNRLEQVLARAEWQIPGAIDGDADEGLMRSTDGDVVCATAANLFVLHGERWRTPPVDRCGVAGVCRQWLLDRFEVEQARLSVADVETADAIVLTNAVRGILPVARLGSRRWAAHRRVAGWRRSLAQANPAFAVPGADPSNPPEMP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 4 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 5 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 6 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 7 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 8 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 9 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 10 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 11 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 12 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 13 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 14 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 49 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 50 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 53 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 82 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 83 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 84 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 85 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 86 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 87 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 88 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 89 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 90 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 91 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 92 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 95 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 96 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 97 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 98 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 99 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 100 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 101 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 102 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 103 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 104 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 105 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 111 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 112 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 113 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 114 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 115 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 116 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 117 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 118 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 125 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 132 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 133 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 135 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 136 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.06 |
| Metatranscriptomes | 0 |
| Isolates | 7.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.75 |
| Nodule | 0 |
| Rhizoplane | 3.17 |
| Rhizosphere | 66.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10004262 | 3300003187 | Bacteria | 7603 |
| 2 | rootH2_10097869 | 3300003320 | Bacteria | 2698 |
| 3 | rootH1_10221059 | 3300003323 | Bacteria | 1935 |
| 4 | Ga0055526_1000139 | 3300003771 | Bacteria | 63930 |
| 5 | Ga0055526_1017721 | 3300003771 | Bacteria | 2703 |
| 6 | Ga0055537_1000323 | 3300003773 | Bacteria | 32553 |
| 7 | Ga0055524_1000206 | 3300003775 | Bacteria | 63929 |
| 8 | Ga0055524_1038124 | 3300003775 | Bacteria | 1262 |
| 9 | Ga0055536_1013326 | 3300003781 | Bacteria | 2980 |
| 10 | Ga0055534_1000164 | 3300003784 | Bacteria | 49529 |
| 11 | Ga0055528_1000027 | 3300003790 | Bacteria | 126420 |
| 12 | Ga0055531_10005719 | 3300003794 | Bacteria | 7207 |
| 13 | Ga0055531_10016143 | 3300003794 | Bacteria | 3240 |
| 14 | Ga0065715_10040322 | 3300005293 | Bacteria | 1091 |
| 15 | Ga0065715_10106015 | 3300005293 | Bacteria | 2854 |
| 16 | Ga0065715_10171189 | 3300005293 | Bacteria | 1536 |
| 17 | Ga0068868_100074388 | 3300005338 | Bacteria | 2713 |
| 18 | Ga0070660_100050695 | 3300005339 | Bacteria | 3194 |
| 19 | Ga0070661_100074982 | 3300005344 | Bacteria | 2492 |
| 20 | Ga0070671_100079144 | 3300005355 | Bacteria | 2747 |
| 21 | Ga0070659_100165585 | 3300005366 | Bacteria | 1809 |
| 22 | Ga0070709_10008526 | 3300005434 | Bacteria | 5633 |
| 23 | Ga0070678_100416600 | 3300005456 | Bacteria | 1170 |
| 24 | Ga0070681_10131010 | 3300005458 | Bacteria | 2440 |
| 25 | Ga0068867_100032858 | 3300005459 | Bacteria | 3754 |
| 26 | Ga0070679_100066368 | 3300005530 | Bacteria | 3597 |
| 27 | Ga0070679_100276983 | 3300005530 | Bacteria | 1631 |
| 28 | Ga0068853_100615271 | 3300005539 | Bacteria | 1032 |
| 29 | Ga0070672_100000541 | 3300005543 | Bacteria | 22176 |
| 30 | Ga0070696_100120021 | 3300005546 | Bacteria | 1902 |
| 31 | Ga0070664_100212579 | 3300005564 | Bacteria | 1729 |
| 32 | Ga0068852_100168154 | 3300005616 | Bacteria | 2053 |
| 33 | Ga0070716_100046311 | 3300006173 | Unclassified | 2447 |
| 34 | Ga0070716_100349246 | 3300006173 | Bacteria | 1046 |
| 35 | Ga0070712_100075739 | 3300006175 | Bacteria | 2421 |
| 36 | Ga0157373_10305861 | 3300013100 | Bacteria | 1129 |
| 37 | Ga0157371_10133369 | 3300013102 | Bacteria | 1767 |
| 38 | Ga0157369_10025483 | 3300013105 | Bacteria | 6567 |
| 39 | Ga0157372_10283400 | 3300013307 | Bacteria | 1927 |
| 40 | Ga0163163_10664914 | 3300014325 | Bacteria | 1105 |
| 41 | Ga0182008_10088084 | 3300014497 | Bacteria | 1529 |
| 42 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 43 | Ga0207425_1006891 | 3300025245 | Bacteria | 3064 |
| 44 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 45 | Ga0209565_1017237 | 3300025263 | Bacteria | 1587 |
| 46 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 47 | Ga0209673_1009173 | 3300025273 | Bacteria | 4318 |
| 48 | Ga0209130_1004539 | 3300025284 | Bacteria | 5222 |
| 49 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 50 | Ga0209675_1030548 | 3300025291 | Bacteria | 1283 |
| 51 | Ga0209675_1033308 | 3300025291 | Bacteria | 1197 |
| 52 | Ga0209676_1000857 | 3300025292 | Bacteria | 39244 |
| 53 | Ga0209676_1006052 | 3300025292 | Bacteria | 6094 |
| 54 | Ga0209676_1006913 | 3300025292 | Bacteria | 5477 |
| 55 | Ga0209676_1009277 | 3300025292 | Bacteria | 4262 |
| 56 | Ga0209676_1009988 | 3300025292 | Bacteria | 4018 |
| 57 | Ga0209676_1016423 | 3300025292 | Bacteria | 2672 |
| 58 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 59 | Ga0209025_1002782 | 3300025294 | Bacteria | 17649 |
| 60 | Ga0209025_1009657 | 3300025294 | Bacteria | 6678 |
| 61 | Ga0209025_1058267 | 3300025294 | Bacteria | 1468 |
| 62 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 63 | Ga0209564_1023138 | 3300025295 | Bacteria | 2168 |
| 64 | Ga0209758_1044666 | 3300025297 | Bacteria | 1616 |
| 65 | Ga0209050_1001432 | 3300025298 | Bacteria | 25688 |
| 66 | Ga0209050_1043369 | 3300025298 | Bacteria | 1216 |
| 67 | Ga0209256_1000031 | 3300025299 | Bacteria | 410189 |
| 68 | Ga0209256_1001506 | 3300025299 | Bacteria | 23600 |
| 69 | Ga0209256_1004573 | 3300025299 | Bacteria | 8574 |
| 70 | Ga0209256_1004581 | 3300025299 | Bacteria | 8565 |
| 71 | Ga0209051_1003199 | 3300025303 | Bacteria | 10929 |
| 72 | Ga0209257_1005633 | 3300025304 | Bacteria | 8668 |
| 73 | Ga0209257_1005693 | 3300025304 | Bacteria | 8572 |
| 74 | Ga0209257_1005702 | 3300025304 | Bacteria | 8551 |
| 75 | Ga0207699_10005487 | 3300025906 | Bacteria | 6073 |
| 76 | Ga0207705_10223641 | 3300025909 | Bacteria | 1430 |
| 77 | Ga0207707_10151528 | 3300025912 | Bacteria | 2027 |
| 78 | Ga0207693_10045032 | 3300025915 | Bacteria | 3467 |
| 79 | Ga0207663_10225634 | 3300025916 | Bacteria | 1365 |
| 80 | Ga0207657_10013572 | 3300025919 | Bacteria | 7991 |
| 81 | Ga0207652_10165559 | 3300025921 | Bacteria | 1982 |
| 82 | Ga0207644_10007872 | 3300025931 | Bacteria | 6964 |
| 83 | Ga0207690_10123016 | 3300025932 | Bacteria | 1887 |
| 84 | Ga0207665_10017580 | 3300025939 | Bacteria | 4699 |
| 85 | Ga0207665_10292462 | 3300025939 | Bacteria | 1215 |
| 86 | Ga0207691_10005113 | 3300025940 | Bacteria | 12659 |
| 87 | Ga0207668_10012110 | 3300025972 | Bacteria | 5270 |
| 88 | Ga0207677_10185308 | 3300026023 | Bacteria | 1641 |
| 89 | Ga0209995_1004583 | 3300027471 | Bacteria | 2213 |
| 90 | Ga0209999_1001382 | 3300027543 | Bacteria | 4159 |
| 91 | Ga0209982_1000688 | 3300027552 | Bacteria | 4313 |
| 92 | Ga0209970_1002597 | 3300027614 | Bacteria | 3059 |
| 93 | Ga0209983_1001226 | 3300027665 | Bacteria | 5694 |
| 94 | Ga0316177_1104201 | 3300030731 | Bacteria | 5162 |
| 95 | Ga0314311_1226009 | 3300030733 | Bacteria | 6816 |
| 96 | Ga0307408_100330827 | 3300031548 | Bacteria | 1286 |
| 97 | Ga0307405_10442525 | 3300031731 | Bacteria | 1028 |
| 98 | Ga0307412_10038451 | 3300031911 | Bacteria | 3082 |
| 99 | Ga0307412_10052719 | 3300031911 | Bacteria | 2695 |
| 100 | Ga0307412_10466957 | 3300031911 | Bacteria | 1043 |
| 101 | Ga0307409_100362196 | 3300031995 | Bacteria | 1372 |
| 102 | Ga0307416_100379906 | 3300032002 | Bacteria | 1442 |
| 103 | Ga0307414_10035514 | 3300032004 | Bacteria | 3318 |
| 104 | Ga0307414_10081949 | 3300032004 | Bacteria | 2364 |
| 105 | Ga0307414_10279585 | 3300032004 | Bacteria | 1402 |
| 106 | Ga0307414_10472189 | 3300032004 | Bacteria | 1104 |
| 107 | Ga0307411_10057893 | 3300032005 | Bacteria | 2562 |
| 108 | Ga0307411_10076219 | 3300032005 | Bacteria | 2292 |
| 109 | Ga0307411_10275620 | 3300032005 | Bacteria | 1336 |
| 110 | Ga0395900_0244819 | 3300037418 | Bacteria | 1797 |
| 111 | Ga0395900_0331717 | 3300037418 | Bacteria | 1499 |
| 112 | Ga0395898_0085937 | 3300037466 | Bacteria | 3032 |
| 113 | Ga0395898_0683317 | 3300037466 | Bacteria | 969 |
| 114 | Ga0395905_0002519 | 3300037471 | Bacteria | 20234 |
| 115 | Ga0395905_0022985 | 3300037471 | Bacteria | 5893 |
| 116 | Ga0395901_0046440 | 3300038443 | Bacteria | 4511 |
| 117 | Ga0395901_0109089 | 3300038443 | Bacteria | 2906 |
| 118 | Ga0400483_231819 | 3300039062 | Bacteria | 3760 |
| 119 | Ga0436362_0358162 | 3300039453 | Bacteria | 5283 |
| 120 | Ga0439436_0002958 | 3300041404 | Bacteria | 5149 |
| 121 | Ga0439465_0056326 | 3300041413 | Bacteria | 1295 |
| 122 | Ga0439432_004051 | 3300042006 | Bacteria | 5375 |
| 123 | Ga0439432_009679 | 3300042006 | Bacteria | 3354 |
| 124 | Ga0439432_093981 | 3300042006 | Bacteria | 901 |
| 125 | Ga0439449_0014700 | 3300042007 | Bacteria | 2942 |
| 126 | Ga0439449_0039598 | 3300042007 | Bacteria | 1752 |
| 127 | Ga0439452_025194 | 3300042010 | Bacteria | 1513 |
| 128 | Ga0439457_027852 | 3300042014 | Bacteria | 1251 |
| 129 | Ga0451577_0002646 | 3300042876 | Bacteria | 20977 |
| 130 | Ga0453684_0000672 | 3300044712 | Bacteria | 122591 |
| 131 | Ga0451576_0000268 | 3300045051 | Bacteria | 127422 |
| 132 | Ga0495598_0054887 | 3300046537 | Bacteria | 1211 |
| 133 | Ga0495621_0002707 | 3300046539 | Bacteria | 4804 |
| 134 | Ga0495621_0050090 | 3300046539 | Bacteria | 1492 |
| 135 | Ga0495668_0014086 | 3300046616 | Bacteria | 4699 |
| 136 | Ga0495659_0012642 | 3300046664 | Bacteria | 2739 |
| 137 | Ga0495659_0066314 | 3300046664 | Bacteria | 1344 |
| 138 | Ga0495636_0003954 | 3300047318 | Bacteria | 5788 |
| 139 | Ga0495636_0013687 | 3300047318 | Bacteria | 3220 |
| 140 | Ga0495636_0042597 | 3300047318 | Bacteria | 1887 |
| 141 | Ga0495636_0047562 | 3300047318 | Bacteria | 1791 |
| 142 | Ga0495636_0059654 | 3300047318 | Bacteria | 1610 |
| 143 | Ga0496100_0258249 | 3300048903 | Bacteria | 1291 |
| 144 | Ga0496101_0103379 | 3300048904 | Bacteria | 2135 |
| 145 | Ga0496104_0278493 | 3300048907 | Bacteria | 1586 |
| 146 | Ga0496108_0143925 | 3300048911 | Bacteria | 2054 |
| 147 | Ga0496110_0206912 | 3300048913 | Bacteria | 1783 |
| 148 | Ga0496111_0124209 | 3300048914 | Bacteria | 1907 |
| 149 | Ga0496121_0013987 | 3300048924 | Bacteria | 8570 |
| 150 | Ga0501290_000566 | 3300049513 | Bacteria | 5604 |
| 151 | Ga0501031_0168281 | 3300049568 | Bacteria | 1432 |
| 152 | Ga0501032_0010334 | 3300049569 | Bacteria | 6731 |
| 153 | Ga0501033_0003528 | 3300049570 | Bacteria | 12797 |
| 154 | Ga0501033_0170077 | 3300049570 | Bacteria | 1565 |
| 155 | Ga0501033_0310021 | 3300049570 | Bacteria | 1110 |
| 156 | Ga0501034_0008927 | 3300049571 | Bacteria | 10538 |
| 157 | Ga0501036_0027265 | 3300049572 | Bacteria | 4826 |
| 158 | Ga0501037_0002138 | 3300049573 | Bacteria | 14302 |
| 159 | Ga0501038_0023837 | 3300049574 | Bacteria | 5464 |
| 160 | Ga0501039_0011088 | 3300049575 | Bacteria | 6868 |
| 161 | Ga0501043_0003623 | 3300049579 | Bacteria | 12688 |
| 162 | Ga0501043_0093771 | 3300049579 | Bacteria | 2360 |
| 163 | Ga0501047_0016220 | 3300049581 | Bacteria | 7107 |
| 164 | Ga0501047_0162054 | 3300049581 | Bacteria | 2108 |
| 165 | Ga0501068_0149597 | 3300049584 | Bacteria | 1467 |
| 166 | Ga0501071_0245557 | 3300049587 | Bacteria | 1350 |
| 167 | Ga0501073_0005037 | 3300049589 | Bacteria | 9902 |
| 168 | Ga0501223_018990 | 3300049663 | Bacteria | 1351 |
| 169 | Ga0501225_0024754 | 3300049705 | Bacteria | 1652 |
| 170 | Ga0501080_0002950 | 3300049742 | Bacteria | 14958 |
| 171 | Ga0501266_012518 | 3300049763 | Bacteria | 1095 |
| 172 | Ga0501275_000454 | 3300049772 | Bacteria | 4611 |
| 173 | Ga0501035_0059988 | 3300049822 | Bacteria | 3387 |
| 174 | Ga0501044_0006108 | 3300049823 | Bacteria | 13290 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046539 | Ga0495621_0050090 | Ga0495621_0050090_684_1436 | 226 |
| 2 | 3300042006 | Ga0439432_093981 | Ga0439432_093981_37_759 | 240 |
| 3 | 3300006173 | Ga0070716_100349246 | Ga0070716_1003492461 | 243 |
| 4 | 3300025939 | Ga0207665_10292462 | Ga0207665_102924622 | 243 |
| 5 | 3300032004 | Ga0307414_10472189 | Ga0307414_104721892 | 246 |
| 6 | 3300003320 | rootH2_10097869 | rootH2_100978692 | 251 |
| 7 | 3300032004 | Ga0307414_10279585 | Ga0307414_102795852 | 254 |
| 8 | 3300046537 | Ga0495598_0054887 | Ga0495598_0054887_192_1028 | 254 |
| 9 | 3300047318 | Ga0495636_0042597 | Ga0495636_0042597_186_1025 | 255 |
| 10 | 3300005459 | Ga0068867_100032858 | Ga0068867_1000328583 | 257 |
| 11 | 3300005543 | Ga0070672_100000541 | Ga0070672_10000054118 | 257 |
| 12 | 3300005564 | Ga0070664_100212579 | Ga0070664_1002125792 | 257 |
| 13 | 3300005616 | Ga0068852_100168154 | Ga0068852_1001681542 | 257 |
| 14 | 3300014325 | Ga0163163_10664914 | Ga0163163_106649142 | 257 |
| 15 | 3300025294 | Ga0209025_1002782 | Ga0209025_100278214 | 257 |
| 16 | 3300025940 | Ga0207691_10005113 | Ga0207691_1000511310 | 257 |
| 17 | 3300003794 | Ga0055531_10016143 | Ga0055531_100161433 | 264 |
| 18 | 3300025292 | Ga0209676_1009277 | Ga0209676_10092774 | 264 |
| 19 | 3300025298 | Ga0209050_1043369 | Ga0209050_10433692 | 264 |
| 20 | 3300025304 | Ga0209257_1005702 | Ga0209257_10057023 | 264 |
| 21 | iso_pu_bacteria | 2643221695 | 2644529942 | 264 |
| 22 | 3300039062 | Ga0400483_231819 | Ga0400483_231819_2812_3657 | 265 |
| 23 | iso_pu_bacteria | 2524614729 | 2525555890 | 265 |
| 24 | iso_pu_bacteria | 2627854209 | 2630650904 | 265 |
| 25 | iso_pu_bacteria | 2571042365 | 2572255275 | 267 |
| 26 | iso_pu_bacteria | 2643221559 | 2643818724 | 267 |
| 27 | iso_pu_bacteria | 2643221573 | 2643878379 | 267 |
| 28 | iso_pu_bacteria | 2643221586 | 2643940975 | 267 |
| 29 | iso_pu_bacteria | 2643221612 | 2644079983 | 267 |
| 30 | iso_pu_bacteria | 2643221720 | 2644659683 | 267 |
| 31 | iso_pu_bacteria | 2643221727 | 2644695578 | 267 |
| 32 | iso_pu_bacteria | 2643221728 | 2644700572 | 267 |
| 33 | iso_pu_bacteria | 8003014200 | 8003016322 | 267 |
| 34 | 3300005434 | Ga0070709_10008526 | Ga0070709_100085261 | 268 |
| 35 | 3300005458 | Ga0070681_10131010 | Ga0070681_101310102 | 268 |
| 36 | 3300005530 | Ga0070679_100066368 | Ga0070679_1000663682 | 268 |
| 37 | 3300005546 | Ga0070696_100120021 | Ga0070696_1001200212 | 268 |
| 38 | 3300025906 | Ga0207699_10005487 | Ga0207699_100054876 | 268 |
| 39 | 3300025912 | Ga0207707_10151528 | Ga0207707_101515282 | 268 |
| 40 | 3300025916 | Ga0207663_10225634 | Ga0207663_102256342 | 268 |
| 41 | 3300025931 | Ga0207644_10007872 | Ga0207644_100078726 | 268 |
| 42 | 3300031548 | Ga0307408_100330827 | Ga0307408_1003308272 | 268 |
| 43 | 3300031731 | Ga0307405_10442525 | Ga0307405_104425252 | 268 |
| 44 | 3300031911 | Ga0307412_10466957 | Ga0307412_104669571 | 268 |
| 45 | 3300032002 | Ga0307416_100379906 | Ga0307416_1003799062 | 268 |
| 46 | 3300032005 | Ga0307411_10057893 | Ga0307411_100578932 | 268 |
| 47 | 3300037471 | Ga0395905_0022985 | Ga0395905_0022985_55_894 | 268 |
| 48 | 3300042006 | Ga0439432_004051 | Ga0439432_004051_286_1107 | 268 |
| 49 | 3300042006 | Ga0439432_009679 | Ga0439432_009679_1180_2001 | 268 |
| 50 | 3300042007 | Ga0439449_0039598 | Ga0439449_0039598_752_1573 | 268 |
| 51 | 3300042014 | Ga0439457_027852 | Ga0439457_027852_136_957 | 268 |
| 52 | 3300047318 | Ga0495636_0003954 | Ga0495636_0003954_3476_4297 | 268 |
| 53 | 3300047318 | Ga0495636_0047562 | Ga0495636_0047562_521_1342 | 268 |
| 54 | 3300049663 | Ga0501223_018990 | Ga0501223_018990_266_1087 | 268 |
| 55 | 3300049705 | Ga0501225_0024754 | Ga0501225_0024754_442_1263 | 268 |
| 56 | 3300049763 | Ga0501266_012518 | Ga0501266_012518_114_935 | 268 |
| 57 | iso_pu_bacteria | 2643221593 | 2643975799 | 268 |
| 58 | 3300005293 | Ga0065715_10106015 | Ga0065715_101060154 | 269 |
| 59 | 3300037418 | Ga0395900_0244819 | Ga0395900_0244819_575_1417 | 269 |
| 60 | 3300037466 | Ga0395898_0683317 | Ga0395898_0683317_20_862 | 269 |
| 61 | 3300039453 | Ga0436362_0358162 | Ga0436362_0358162_2276_3115 | 269 |
| 62 | 3300044712 | Ga0453684_0000672 | Ga0453684_0000672_78294_79109 | 269 |
| 63 | 3300045051 | Ga0451576_0000268 | Ga0451576_0000268_83124_83939 | 269 |
| 64 | 3300003771 | Ga0055526_1017721 | Ga0055526_10177212 | 270 |
| 65 | 3300005293 | Ga0065715_10040322 | Ga0065715_100403222 | 270 |
| 66 | 3300005293 | Ga0065715_10171189 | Ga0065715_101711892 | 270 |
| 67 | 3300005339 | Ga0070660_100050695 | Ga0070660_1000506953 | 270 |
| 68 | 3300005344 | Ga0070661_100074982 | Ga0070661_1000749822 | 270 |
| 69 | 3300005355 | Ga0070671_100079144 | Ga0070671_1000791441 | 270 |
| 70 | 3300005366 | Ga0070659_100165585 | Ga0070659_1001655852 | 270 |
| 71 | 3300005456 | Ga0070678_100416600 | Ga0070678_1004166002 | 270 |
| 72 | 3300005530 | Ga0070679_100276983 | Ga0070679_1002769832 | 270 |
| 73 | 3300005539 | Ga0068853_100615271 | Ga0068853_1006152712 | 270 |
| 74 | 3300013100 | Ga0157373_10305861 | Ga0157373_103058612 | 270 |
| 75 | 3300013102 | Ga0157371_10133369 | Ga0157371_101333692 | 270 |
| 76 | 3300013105 | Ga0157369_10025483 | Ga0157369_100254833 | 270 |
| 77 | 3300013307 | Ga0157372_10283400 | Ga0157372_102834002 | 270 |
| 78 | 3300025909 | Ga0207705_10223641 | Ga0207705_102236412 | 270 |
| 79 | 3300025919 | Ga0207657_10013572 | Ga0207657_100135727 | 270 |
| 80 | 3300025921 | Ga0207652_10165559 | Ga0207652_101655592 | 270 |
| 81 | 3300025932 | Ga0207690_10123016 | Ga0207690_101230162 | 270 |
| 82 | 3300031911 | Ga0307412_10038451 | Ga0307412_100384512 | 270 |
| 83 | 3300031911 | Ga0307412_10052719 | Ga0307412_100527192 | 270 |
| 84 | 3300031995 | Ga0307409_100362196 | Ga0307409_1003621962 | 270 |
| 85 | 3300037418 | Ga0395900_0331717 | Ga0395900_0331717_474_1289 | 270 |
| 86 | 3300037466 | Ga0395898_0085937 | Ga0395898_0085937_1538_2353 | 270 |
| 87 | 3300037471 | Ga0395905_0002519 | Ga0395905_0002519_10475_11290 | 270 |
| 88 | 3300038443 | Ga0395901_0046440 | Ga0395901_0046440_3067_3882 | 270 |
| 89 | 3300038443 | Ga0395901_0109089 | Ga0395901_0109089_1294_2109 | 270 |
| 90 | 3300048903 | Ga0496100_0258249 | Ga0496100_0258249_232_1047 | 270 |
| 91 | 3300048904 | Ga0496101_0103379 | Ga0496101_0103379_1137_1952 | 270 |
| 92 | 3300048911 | Ga0496108_0143925 | Ga0496108_0143925_586_1401 | 270 |
| 93 | 3300049569 | Ga0501032_0010334 | Ga0501032_0010334_5335_6150 | 270 |
| 94 | 3300049570 | Ga0501033_0003528 | Ga0501033_0003528_9806_10633 | 270 |
| 95 | 3300049571 | Ga0501034_0008927 | Ga0501034_0008927_3326_4141 | 270 |
| 96 | 3300049572 | Ga0501036_0027265 | Ga0501036_0027265_798_1613 | 270 |
| 97 | 3300049573 | Ga0501037_0002138 | Ga0501037_0002138_9941_10756 | 270 |
| 98 | 3300049575 | Ga0501039_0011088 | Ga0501039_0011088_4198_5013 | 270 |
| 99 | 3300049579 | Ga0501043_0093771 | Ga0501043_0093771_1490_2305 | 270 |
| 100 | 3300049581 | Ga0501047_0016220 | Ga0501047_0016220_4970_5785 | 270 |
| 101 | 3300049584 | Ga0501068_0149597 | Ga0501068_0149597_252_1067 | 270 |
| 102 | 3300049587 | Ga0501071_0245557 | Ga0501071_0245557_352_1167 | 270 |
| 103 | 3300049589 | Ga0501073_0005037 | Ga0501073_0005037_5520_6335 | 270 |
| 104 | 3300049742 | Ga0501080_0002950 | Ga0501080_0002950_9883_10698 | 270 |
| 105 | 3300003775 | Ga0055524_1038124 | Ga0055524_10381241 | 271 |
| 106 | 3300003781 | Ga0055536_1013326 | Ga0055536_10133263 | 271 |
| 107 | 3300003794 | Ga0055531_10005719 | Ga0055531_100057197 | 271 |
| 108 | 3300005338 | Ga0068868_100074388 | Ga0068868_1000743883 | 271 |
| 109 | 3300014497 | Ga0182008_10088084 | Ga0182008_100880842 | 271 |
| 110 | 3300025245 | Ga0207425_1006891 | Ga0207425_10068913 | 271 |
| 111 | 3300025273 | Ga0209673_1009173 | Ga0209673_10091732 | 271 |
| 112 | 3300025284 | Ga0209130_1004539 | Ga0209130_10045392 | 271 |
| 113 | 3300025291 | Ga0209675_1030548 | Ga0209675_10305482 | 271 |
| 114 | 3300025291 | Ga0209675_1033308 | Ga0209675_10333082 | 271 |
| 115 | 3300025292 | Ga0209676_1000857 | Ga0209676_10008574 | 271 |
| 116 | 3300025292 | Ga0209676_1006052 | Ga0209676_10060523 | 271 |
| 117 | 3300025292 | Ga0209676_1006913 | Ga0209676_10069133 | 271 |
| 118 | 3300025292 | Ga0209676_1009988 | Ga0209676_10099882 | 271 |
| 119 | 3300025292 | Ga0209676_1016423 | Ga0209676_10164231 | 271 |
| 120 | 3300025294 | Ga0209025_1009657 | Ga0209025_10096575 | 271 |
| 121 | 3300025294 | Ga0209025_1058267 | Ga0209025_10582672 | 271 |
| 122 | 3300025295 | Ga0209564_1023138 | Ga0209564_10231382 | 271 |
| 123 | 3300025298 | Ga0209050_1001432 | Ga0209050_10014325 | 271 |
| 124 | 3300025299 | Ga0209256_1001506 | Ga0209256_100150618 | 271 |
| 125 | 3300025299 | Ga0209256_1004573 | Ga0209256_10045732 | 271 |
| 126 | 3300025299 | Ga0209256_1004581 | Ga0209256_10045812 | 271 |
| 127 | 3300025303 | Ga0209051_1003199 | Ga0209051_10031997 | 271 |
| 128 | 3300025304 | Ga0209257_1005633 | Ga0209257_10056334 | 271 |
| 129 | 3300025304 | Ga0209257_1005693 | Ga0209257_10056932 | 271 |
| 130 | 3300025972 | Ga0207668_10012110 | Ga0207668_100121105 | 271 |
| 131 | 3300026023 | Ga0207677_10185308 | Ga0207677_101853082 | 271 |
| 132 | 3300027471 | Ga0209995_1004583 | Ga0209995_10045832 | 271 |
| 133 | 3300027543 | Ga0209999_1001382 | Ga0209999_10013824 | 271 |
| 134 | 3300027552 | Ga0209982_1000688 | Ga0209982_10006884 | 271 |
| 135 | 3300027614 | Ga0209970_1002597 | Ga0209970_10025973 | 271 |
| 136 | 3300027665 | Ga0209983_1001226 | Ga0209983_10012266 | 271 |
| 137 | 3300030731 | Ga0316177_1104201 | Ga0316177_11042013 | 271 |
| 138 | 3300030733 | Ga0314311_1226009 | Ga0314311_12260097 | 271 |
| 139 | 3300032004 | Ga0307414_10081949 | Ga0307414_100819492 | 271 |
| 140 | 3300032005 | Ga0307411_10076219 | Ga0307411_100762191 | 271 |
| 141 | 3300032005 | Ga0307411_10275620 | Ga0307411_102756202 | 271 |
| 142 | 3300041404 | Ga0439436_0002958 | Ga0439436_0002958_1885_2727 | 271 |
| 143 | 3300042007 | Ga0439449_0014700 | Ga0439449_0014700_212_1042 | 271 |
| 144 | 3300046664 | Ga0495659_0012642 | Ga0495659_0012642_377_1210 | 271 |
| 145 | 3300047318 | Ga0495636_0013687 | Ga0495636_0013687_453_1334 | 271 |
| 146 | 3300047318 | Ga0495636_0059654 | Ga0495636_0059654_389_1222 | 271 |
| 147 | 3300048913 | Ga0496110_0206912 | Ga0496110_0206912_637_1518 | 271 |
| 148 | 3300048914 | Ga0496111_0124209 | Ga0496111_0124209_227_1108 | 271 |
| 149 | 3300049570 | Ga0501033_0310021 | Ga0501033_0310021_119_991 | 271 |
| 150 | 3300049579 | Ga0501043_0003623 | Ga0501043_0003623_9972_10787 | 271 |
| 151 | iso_pu_bacteria | 2941489479 | 2941493428 | 271 |
| 152 | iso_pu_bacteria | 2995948881 | 2995952477 | 271 |
| 153 | 3300003187 | JGI25151J46595_10004262 | JGI25151J46595_100042627 | 272 |
| 154 | 3300003323 | rootH1_10221059 | rootH1_102210592 | 272 |
| 155 | 3300003771 | Ga0055526_1000139 | Ga0055526_100013922 | 272 |
| 156 | 3300003773 | Ga0055537_1000323 | Ga0055537_100032312 | 272 |
| 157 | 3300003775 | Ga0055524_1000206 | Ga0055524_100020622 | 272 |
| 158 | 3300003784 | Ga0055534_1000164 | Ga0055534_100016431 | 272 |
| 159 | 3300003790 | Ga0055528_1000027 | Ga0055528_100002744 | 272 |
| 160 | 3300006173 | Ga0070716_100046311 | Ga0070716_1000463113 | 272 |
| 161 | 3300006175 | Ga0070712_100075739 | Ga0070712_1000757392 | 272 |
| 162 | 3300015689 | Ga0183360_10001 | Ga0183360_10001746 | 272 |
| 163 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005376 | 272 |
| 164 | 3300025263 | Ga0209565_1017237 | Ga0209565_10172372 | 272 |
| 165 | 3300025273 | Ga0209673_1000011 | Ga0209673_100001131 | 272 |
| 166 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004376 | 272 |
| 167 | 3300025294 | Ga0209025_1000005 | Ga0209025_100000522 | 272 |
| 168 | 3300025295 | Ga0209564_1000018 | Ga0209564_100001831 | 272 |
| 169 | 3300025297 | Ga0209758_1044666 | Ga0209758_10446661 | 272 |
| 170 | 3300025299 | Ga0209256_1000031 | Ga0209256_1000031375 | 272 |
| 171 | 3300025915 | Ga0207693_10045032 | Ga0207693_100450322 | 272 |
| 172 | 3300025939 | Ga0207665_10017580 | Ga0207665_100175804 | 272 |
| 173 | 3300032004 | Ga0307414_10035514 | Ga0307414_100355142 | 272 |
| 174 | 3300041413 | Ga0439465_0056326 | Ga0439465_0056326_345_1169 | 272 |
| 175 | 3300042010 | Ga0439452_025194 | Ga0439452_025194_261_1085 | 272 |
| 176 | 3300042876 | Ga0451577_0002646 | Ga0451577_0002646_18295_19149 | 272 |
| 177 | 3300046539 | Ga0495621_0002707 | Ga0495621_0002707_2866_3705 | 272 |
| 178 | 3300046616 | Ga0495668_0014086 | Ga0495668_0014086_178_1020 | 272 |
| 179 | 3300046664 | Ga0495659_0066314 | Ga0495659_0066314_405_1244 | 272 |
| 180 | 3300048907 | Ga0496104_0278493 | Ga0496104_0278493_212_1084 | 272 |
| 181 | 3300048924 | Ga0496121_0013987 | Ga0496121_0013987_4113_4946 | 272 |
| 182 | 3300049513 | Ga0501290_000566 | Ga0501290_000566_3852_4700 | 272 |
| 183 | 3300049568 | Ga0501031_0168281 | Ga0501031_0168281_397_1236 | 272 |
| 184 | 3300049570 | Ga0501033_0170077 | Ga0501033_0170077_108_947 | 272 |
| 185 | 3300049574 | Ga0501038_0023837 | Ga0501038_0023837_2137_2976 | 272 |
| 186 | 3300049581 | Ga0501047_0162054 | Ga0501047_0162054_74_913 | 272 |
| 187 | 3300049772 | Ga0501275_000454 | Ga0501275_000454_865_1713 | 272 |
| 188 | 3300049822 | Ga0501035_0059988 | Ga0501035_0059988_2365_3204 | 272 |
| 189 | 3300049823 | Ga0501044_0006108 | Ga0501044_0006108_466_1305 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2y4r-assembly1.cif.gz_B | crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa | 0.9272 | 6 | 262 |
| 1i2k-assembly1.cif.gz_A | aminodeoxychorismate lyase from escherichia coli | 0.9255 | 3 | 256 |
| 3lul-assembly1.cif.gz_A | crystal structure of putative 4-amino-4-deoxychorismate lyase. (yp_094631.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.78 a resolution | 0.9153 | 13 | 264 |
| 1et0-assembly1.cif.gz_A | crystal structure of aminodeoxychorismate lyase from escherichia coli | 0.9122 | 3 | 267 |
| 1et0-assembly1.cif.gz_A | crystal structure of aminodeoxychorismate lyase from escherichia coli | 0.9053 | 3 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xpfB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9509 | 118 | 262 | 3.20.10.10 |
| 3lulA02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9062 | 116 | 264 | 3.20.10.10 |
| 3qqmH02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9031 | 111 | 241 | 3.20.10.10 |
| 3wwiB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9028 | 118 | 262 | 3.20.10.10 |
| 4cmdA02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.8924 | 119 | 264 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4LS03-F1-model_v4 | Aminodeoxychorismate lyase (EC 4.1.3.38) | 0.9777 | 2 | 269 |
GO:0005829
GO:0008153 GO:0008696 GO:0030170 GO:0046656 |
| AF-A0A352QUN4-F1-model_v4 | Aminodeoxychorismate lyase (EC 4.1.3.38) | 0.9724 | 3 | 266 |
GO:0005829
GO:0008153 GO:0008696 GO:0030170 GO:0046656 |
| AF-A0A3B9K3I0-F1-model_v4 | Probable branched-chain-amino-acid aminotransferase (EC 4.1.3.38) | 0.9584 | 13 | 263 |
GO:0005829
GO:0008153 GO:0008696 GO:0030170 GO:0046656 |
| AF-A0A6J4LS03-F1-model_v4 | Aminodeoxychorismate lyase (EC 4.1.3.38) | 0.9565 | 2 | 269 |
GO:0005829
GO:0008153 GO:0008696 GO:0030170 GO:0046656 |
| AF-A0A0B8P106-F1-model_v4 | Aminodeoxychorismate lyase (EC 4.1.3.38) | 0.9504 | 124 | 262 |
GO:0005829
GO:0008153 GO:0008696 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar