F291202

General Info

Members Datasets Scaffolds Average Seq Length
189 138 174 274

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10035514|Ga0307414_100355142
Length 302
Sequence MASMAPDNAAASSKDPGRESWIFVGERRVSAIPPDDRALAYGDGLFETMRACRGELPWWDAHWSRLERGAVRLRLAMPSPAKVRSEAAQLLDGRDGVLKLQLGRGSGGRGYAPPLAPEPSWILSRHPLPSSHPAAGLTLRWCDTQLALQPALAGIKHCNRLEQVLARAEWQIPGAIDGDADEGLMRSTDGDVVCATAANLFVLHGERWRTPPVDRCGVAGVCRQWLLDRFEVEQARLSVADVETADAIVLTNAVRGILPVARLGSRRWAAHRRVAGWRRSLAQANPAFAVPGADPSNPPEMP

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221593 Lysobacter sp. Root690 Isolate Unclassified
8 2643221612 Lysobacter sp. Root76 Isolate Unclassified
9 2643221695 Lysobacter sp. Root494 Isolate Unclassified
10 2643221720 Lysobacter sp. Root916 Isolate Unclassified
11 2643221727 Lysobacter sp. Root96 Isolate Unclassified
12 2643221728 Lysobacter sp. Root983 Isolate Unclassified
13 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
14 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
82 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
101 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
118 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
132 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
135 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.06
Metatranscriptomes 0
Isolates 7.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.75
Nodule 0
Rhizoplane 3.17
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10004262 3300003187 Bacteria 7603
2 rootH2_10097869 3300003320 Bacteria 2698
3 rootH1_10221059 3300003323 Bacteria 1935
4 Ga0055526_1000139 3300003771 Bacteria 63930
5 Ga0055526_1017721 3300003771 Bacteria 2703
6 Ga0055537_1000323 3300003773 Bacteria 32553
7 Ga0055524_1000206 3300003775 Bacteria 63929
8 Ga0055524_1038124 3300003775 Bacteria 1262
9 Ga0055536_1013326 3300003781 Bacteria 2980
10 Ga0055534_1000164 3300003784 Bacteria 49529
11 Ga0055528_1000027 3300003790 Bacteria 126420
12 Ga0055531_10005719 3300003794 Bacteria 7207
13 Ga0055531_10016143 3300003794 Bacteria 3240
14 Ga0065715_10040322 3300005293 Bacteria 1091
15 Ga0065715_10106015 3300005293 Bacteria 2854
16 Ga0065715_10171189 3300005293 Bacteria 1536
17 Ga0068868_100074388 3300005338 Bacteria 2713
18 Ga0070660_100050695 3300005339 Bacteria 3194
19 Ga0070661_100074982 3300005344 Bacteria 2492
20 Ga0070671_100079144 3300005355 Bacteria 2747
21 Ga0070659_100165585 3300005366 Bacteria 1809
22 Ga0070709_10008526 3300005434 Bacteria 5633
23 Ga0070678_100416600 3300005456 Bacteria 1170
24 Ga0070681_10131010 3300005458 Bacteria 2440
25 Ga0068867_100032858 3300005459 Bacteria 3754
26 Ga0070679_100066368 3300005530 Bacteria 3597
27 Ga0070679_100276983 3300005530 Bacteria 1631
28 Ga0068853_100615271 3300005539 Bacteria 1032
29 Ga0070672_100000541 3300005543 Bacteria 22176
30 Ga0070696_100120021 3300005546 Bacteria 1902
31 Ga0070664_100212579 3300005564 Bacteria 1729
32 Ga0068852_100168154 3300005616 Bacteria 2053
33 Ga0070716_100046311 3300006173 Unclassified 2447
34 Ga0070716_100349246 3300006173 Bacteria 1046
35 Ga0070712_100075739 3300006175 Bacteria 2421
36 Ga0157373_10305861 3300013100 Bacteria 1129
37 Ga0157371_10133369 3300013102 Bacteria 1767
38 Ga0157369_10025483 3300013105 Bacteria 6567
39 Ga0157372_10283400 3300013307 Bacteria 1927
40 Ga0163163_10664914 3300014325 Bacteria 1105
41 Ga0182008_10088084 3300014497 Bacteria 1529
42 Ga0183360_10001 3300015689 Bacteria 3943671
43 Ga0207425_1006891 3300025245 Bacteria 3064
44 Ga0209565_1000005 3300025263 Bacteria 947317
45 Ga0209565_1017237 3300025263 Bacteria 1587
46 Ga0209673_1000011 3300025273 Bacteria 586604
47 Ga0209673_1009173 3300025273 Bacteria 4318
48 Ga0209130_1004539 3300025284 Bacteria 5222
49 Ga0209675_1000004 3300025291 Bacteria 947166
50 Ga0209675_1030548 3300025291 Bacteria 1283
51 Ga0209675_1033308 3300025291 Bacteria 1197
52 Ga0209676_1000857 3300025292 Bacteria 39244
53 Ga0209676_1006052 3300025292 Bacteria 6094
54 Ga0209676_1006913 3300025292 Bacteria 5477
55 Ga0209676_1009277 3300025292 Bacteria 4262
56 Ga0209676_1009988 3300025292 Bacteria 4018
57 Ga0209676_1016423 3300025292 Bacteria 2672
58 Ga0209025_1000005 3300025294 Bacteria 1272149
59 Ga0209025_1002782 3300025294 Bacteria 17649
60 Ga0209025_1009657 3300025294 Bacteria 6678
61 Ga0209025_1058267 3300025294 Bacteria 1468
62 Ga0209564_1000018 3300025295 Bacteria 586913
63 Ga0209564_1023138 3300025295 Bacteria 2168
64 Ga0209758_1044666 3300025297 Bacteria 1616
65 Ga0209050_1001432 3300025298 Bacteria 25688
66 Ga0209050_1043369 3300025298 Bacteria 1216
67 Ga0209256_1000031 3300025299 Bacteria 410189
68 Ga0209256_1001506 3300025299 Bacteria 23600
69 Ga0209256_1004573 3300025299 Bacteria 8574
70 Ga0209256_1004581 3300025299 Bacteria 8565
71 Ga0209051_1003199 3300025303 Bacteria 10929
72 Ga0209257_1005633 3300025304 Bacteria 8668
73 Ga0209257_1005693 3300025304 Bacteria 8572
74 Ga0209257_1005702 3300025304 Bacteria 8551
75 Ga0207699_10005487 3300025906 Bacteria 6073
76 Ga0207705_10223641 3300025909 Bacteria 1430
77 Ga0207707_10151528 3300025912 Bacteria 2027
78 Ga0207693_10045032 3300025915 Bacteria 3467
79 Ga0207663_10225634 3300025916 Bacteria 1365
80 Ga0207657_10013572 3300025919 Bacteria 7991
81 Ga0207652_10165559 3300025921 Bacteria 1982
82 Ga0207644_10007872 3300025931 Bacteria 6964
83 Ga0207690_10123016 3300025932 Bacteria 1887
84 Ga0207665_10017580 3300025939 Bacteria 4699
85 Ga0207665_10292462 3300025939 Bacteria 1215
86 Ga0207691_10005113 3300025940 Bacteria 12659
87 Ga0207668_10012110 3300025972 Bacteria 5270
88 Ga0207677_10185308 3300026023 Bacteria 1641
89 Ga0209995_1004583 3300027471 Bacteria 2213
90 Ga0209999_1001382 3300027543 Bacteria 4159
91 Ga0209982_1000688 3300027552 Bacteria 4313
92 Ga0209970_1002597 3300027614 Bacteria 3059
93 Ga0209983_1001226 3300027665 Bacteria 5694
94 Ga0316177_1104201 3300030731 Bacteria 5162
95 Ga0314311_1226009 3300030733 Bacteria 6816
96 Ga0307408_100330827 3300031548 Bacteria 1286
97 Ga0307405_10442525 3300031731 Bacteria 1028
98 Ga0307412_10038451 3300031911 Bacteria 3082
99 Ga0307412_10052719 3300031911 Bacteria 2695
100 Ga0307412_10466957 3300031911 Bacteria 1043
101 Ga0307409_100362196 3300031995 Bacteria 1372
102 Ga0307416_100379906 3300032002 Bacteria 1442
103 Ga0307414_10035514 3300032004 Bacteria 3318
104 Ga0307414_10081949 3300032004 Bacteria 2364
105 Ga0307414_10279585 3300032004 Bacteria 1402
106 Ga0307414_10472189 3300032004 Bacteria 1104
107 Ga0307411_10057893 3300032005 Bacteria 2562
108 Ga0307411_10076219 3300032005 Bacteria 2292
109 Ga0307411_10275620 3300032005 Bacteria 1336
110 Ga0395900_0244819 3300037418 Bacteria 1797
111 Ga0395900_0331717 3300037418 Bacteria 1499
112 Ga0395898_0085937 3300037466 Bacteria 3032
113 Ga0395898_0683317 3300037466 Bacteria 969
114 Ga0395905_0002519 3300037471 Bacteria 20234
115 Ga0395905_0022985 3300037471 Bacteria 5893
116 Ga0395901_0046440 3300038443 Bacteria 4511
117 Ga0395901_0109089 3300038443 Bacteria 2906
118 Ga0400483_231819 3300039062 Bacteria 3760
119 Ga0436362_0358162 3300039453 Bacteria 5283
120 Ga0439436_0002958 3300041404 Bacteria 5149
121 Ga0439465_0056326 3300041413 Bacteria 1295
122 Ga0439432_004051 3300042006 Bacteria 5375
123 Ga0439432_009679 3300042006 Bacteria 3354
124 Ga0439432_093981 3300042006 Bacteria 901
125 Ga0439449_0014700 3300042007 Bacteria 2942
126 Ga0439449_0039598 3300042007 Bacteria 1752
127 Ga0439452_025194 3300042010 Bacteria 1513
128 Ga0439457_027852 3300042014 Bacteria 1251
129 Ga0451577_0002646 3300042876 Bacteria 20977
130 Ga0453684_0000672 3300044712 Bacteria 122591
131 Ga0451576_0000268 3300045051 Bacteria 127422
132 Ga0495598_0054887 3300046537 Bacteria 1211
133 Ga0495621_0002707 3300046539 Bacteria 4804
134 Ga0495621_0050090 3300046539 Bacteria 1492
135 Ga0495668_0014086 3300046616 Bacteria 4699
136 Ga0495659_0012642 3300046664 Bacteria 2739
137 Ga0495659_0066314 3300046664 Bacteria 1344
138 Ga0495636_0003954 3300047318 Bacteria 5788
139 Ga0495636_0013687 3300047318 Bacteria 3220
140 Ga0495636_0042597 3300047318 Bacteria 1887
141 Ga0495636_0047562 3300047318 Bacteria 1791
142 Ga0495636_0059654 3300047318 Bacteria 1610
143 Ga0496100_0258249 3300048903 Bacteria 1291
144 Ga0496101_0103379 3300048904 Bacteria 2135
145 Ga0496104_0278493 3300048907 Bacteria 1586
146 Ga0496108_0143925 3300048911 Bacteria 2054
147 Ga0496110_0206912 3300048913 Bacteria 1783
148 Ga0496111_0124209 3300048914 Bacteria 1907
149 Ga0496121_0013987 3300048924 Bacteria 8570
150 Ga0501290_000566 3300049513 Bacteria 5604
151 Ga0501031_0168281 3300049568 Bacteria 1432
152 Ga0501032_0010334 3300049569 Bacteria 6731
153 Ga0501033_0003528 3300049570 Bacteria 12797
154 Ga0501033_0170077 3300049570 Bacteria 1565
155 Ga0501033_0310021 3300049570 Bacteria 1110
156 Ga0501034_0008927 3300049571 Bacteria 10538
157 Ga0501036_0027265 3300049572 Bacteria 4826
158 Ga0501037_0002138 3300049573 Bacteria 14302
159 Ga0501038_0023837 3300049574 Bacteria 5464
160 Ga0501039_0011088 3300049575 Bacteria 6868
161 Ga0501043_0003623 3300049579 Bacteria 12688
162 Ga0501043_0093771 3300049579 Bacteria 2360
163 Ga0501047_0016220 3300049581 Bacteria 7107
164 Ga0501047_0162054 3300049581 Bacteria 2108
165 Ga0501068_0149597 3300049584 Bacteria 1467
166 Ga0501071_0245557 3300049587 Bacteria 1350
167 Ga0501073_0005037 3300049589 Bacteria 9902
168 Ga0501223_018990 3300049663 Bacteria 1351
169 Ga0501225_0024754 3300049705 Bacteria 1652
170 Ga0501080_0002950 3300049742 Bacteria 14958
171 Ga0501266_012518 3300049763 Bacteria 1095
172 Ga0501275_000454 3300049772 Bacteria 4611
173 Ga0501035_0059988 3300049822 Bacteria 3387
174 Ga0501044_0006108 3300049823 Bacteria 13290

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0050090 Ga0495621_0050090_684_1436 226
2 3300042006 Ga0439432_093981 Ga0439432_093981_37_759 240
3 3300006173 Ga0070716_100349246 Ga0070716_1003492461 243
4 3300025939 Ga0207665_10292462 Ga0207665_102924622 243
5 3300032004 Ga0307414_10472189 Ga0307414_104721892 246
6 3300003320 rootH2_10097869 rootH2_100978692 251
7 3300032004 Ga0307414_10279585 Ga0307414_102795852 254
8 3300046537 Ga0495598_0054887 Ga0495598_0054887_192_1028 254
9 3300047318 Ga0495636_0042597 Ga0495636_0042597_186_1025 255
10 3300005459 Ga0068867_100032858 Ga0068867_1000328583 257
11 3300005543 Ga0070672_100000541 Ga0070672_10000054118 257
12 3300005564 Ga0070664_100212579 Ga0070664_1002125792 257
13 3300005616 Ga0068852_100168154 Ga0068852_1001681542 257
14 3300014325 Ga0163163_10664914 Ga0163163_106649142 257
15 3300025294 Ga0209025_1002782 Ga0209025_100278214 257
16 3300025940 Ga0207691_10005113 Ga0207691_1000511310 257
17 3300003794 Ga0055531_10016143 Ga0055531_100161433 264
18 3300025292 Ga0209676_1009277 Ga0209676_10092774 264
19 3300025298 Ga0209050_1043369 Ga0209050_10433692 264
20 3300025304 Ga0209257_1005702 Ga0209257_10057023 264
21 iso_pu_bacteria 2643221695 2644529942 264
22 3300039062 Ga0400483_231819 Ga0400483_231819_2812_3657 265
23 iso_pu_bacteria 2524614729 2525555890 265
24 iso_pu_bacteria 2627854209 2630650904 265
25 iso_pu_bacteria 2571042365 2572255275 267
26 iso_pu_bacteria 2643221559 2643818724 267
27 iso_pu_bacteria 2643221573 2643878379 267
28 iso_pu_bacteria 2643221586 2643940975 267
29 iso_pu_bacteria 2643221612 2644079983 267
30 iso_pu_bacteria 2643221720 2644659683 267
31 iso_pu_bacteria 2643221727 2644695578 267
32 iso_pu_bacteria 2643221728 2644700572 267
33 iso_pu_bacteria 8003014200 8003016322 267
34 3300005434 Ga0070709_10008526 Ga0070709_100085261 268
35 3300005458 Ga0070681_10131010 Ga0070681_101310102 268
36 3300005530 Ga0070679_100066368 Ga0070679_1000663682 268
37 3300005546 Ga0070696_100120021 Ga0070696_1001200212 268
38 3300025906 Ga0207699_10005487 Ga0207699_100054876 268
39 3300025912 Ga0207707_10151528 Ga0207707_101515282 268
40 3300025916 Ga0207663_10225634 Ga0207663_102256342 268
41 3300025931 Ga0207644_10007872 Ga0207644_100078726 268
42 3300031548 Ga0307408_100330827 Ga0307408_1003308272 268
43 3300031731 Ga0307405_10442525 Ga0307405_104425252 268
44 3300031911 Ga0307412_10466957 Ga0307412_104669571 268
45 3300032002 Ga0307416_100379906 Ga0307416_1003799062 268
46 3300032005 Ga0307411_10057893 Ga0307411_100578932 268
47 3300037471 Ga0395905_0022985 Ga0395905_0022985_55_894 268
48 3300042006 Ga0439432_004051 Ga0439432_004051_286_1107 268
49 3300042006 Ga0439432_009679 Ga0439432_009679_1180_2001 268
50 3300042007 Ga0439449_0039598 Ga0439449_0039598_752_1573 268
51 3300042014 Ga0439457_027852 Ga0439457_027852_136_957 268
52 3300047318 Ga0495636_0003954 Ga0495636_0003954_3476_4297 268
53 3300047318 Ga0495636_0047562 Ga0495636_0047562_521_1342 268
54 3300049663 Ga0501223_018990 Ga0501223_018990_266_1087 268
55 3300049705 Ga0501225_0024754 Ga0501225_0024754_442_1263 268
56 3300049763 Ga0501266_012518 Ga0501266_012518_114_935 268
57 iso_pu_bacteria 2643221593 2643975799 268
58 3300005293 Ga0065715_10106015 Ga0065715_101060154 269
59 3300037418 Ga0395900_0244819 Ga0395900_0244819_575_1417 269
60 3300037466 Ga0395898_0683317 Ga0395898_0683317_20_862 269
61 3300039453 Ga0436362_0358162 Ga0436362_0358162_2276_3115 269
62 3300044712 Ga0453684_0000672 Ga0453684_0000672_78294_79109 269
63 3300045051 Ga0451576_0000268 Ga0451576_0000268_83124_83939 269
64 3300003771 Ga0055526_1017721 Ga0055526_10177212 270
65 3300005293 Ga0065715_10040322 Ga0065715_100403222 270
66 3300005293 Ga0065715_10171189 Ga0065715_101711892 270
67 3300005339 Ga0070660_100050695 Ga0070660_1000506953 270
68 3300005344 Ga0070661_100074982 Ga0070661_1000749822 270
69 3300005355 Ga0070671_100079144 Ga0070671_1000791441 270
70 3300005366 Ga0070659_100165585 Ga0070659_1001655852 270
71 3300005456 Ga0070678_100416600 Ga0070678_1004166002 270
72 3300005530 Ga0070679_100276983 Ga0070679_1002769832 270
73 3300005539 Ga0068853_100615271 Ga0068853_1006152712 270
74 3300013100 Ga0157373_10305861 Ga0157373_103058612 270
75 3300013102 Ga0157371_10133369 Ga0157371_101333692 270
76 3300013105 Ga0157369_10025483 Ga0157369_100254833 270
77 3300013307 Ga0157372_10283400 Ga0157372_102834002 270
78 3300025909 Ga0207705_10223641 Ga0207705_102236412 270
79 3300025919 Ga0207657_10013572 Ga0207657_100135727 270
80 3300025921 Ga0207652_10165559 Ga0207652_101655592 270
81 3300025932 Ga0207690_10123016 Ga0207690_101230162 270
82 3300031911 Ga0307412_10038451 Ga0307412_100384512 270
83 3300031911 Ga0307412_10052719 Ga0307412_100527192 270
84 3300031995 Ga0307409_100362196 Ga0307409_1003621962 270
85 3300037418 Ga0395900_0331717 Ga0395900_0331717_474_1289 270
86 3300037466 Ga0395898_0085937 Ga0395898_0085937_1538_2353 270
87 3300037471 Ga0395905_0002519 Ga0395905_0002519_10475_11290 270
88 3300038443 Ga0395901_0046440 Ga0395901_0046440_3067_3882 270
89 3300038443 Ga0395901_0109089 Ga0395901_0109089_1294_2109 270
90 3300048903 Ga0496100_0258249 Ga0496100_0258249_232_1047 270
91 3300048904 Ga0496101_0103379 Ga0496101_0103379_1137_1952 270
92 3300048911 Ga0496108_0143925 Ga0496108_0143925_586_1401 270
93 3300049569 Ga0501032_0010334 Ga0501032_0010334_5335_6150 270
94 3300049570 Ga0501033_0003528 Ga0501033_0003528_9806_10633 270
95 3300049571 Ga0501034_0008927 Ga0501034_0008927_3326_4141 270
96 3300049572 Ga0501036_0027265 Ga0501036_0027265_798_1613 270
97 3300049573 Ga0501037_0002138 Ga0501037_0002138_9941_10756 270
98 3300049575 Ga0501039_0011088 Ga0501039_0011088_4198_5013 270
99 3300049579 Ga0501043_0093771 Ga0501043_0093771_1490_2305 270
100 3300049581 Ga0501047_0016220 Ga0501047_0016220_4970_5785 270
101 3300049584 Ga0501068_0149597 Ga0501068_0149597_252_1067 270
102 3300049587 Ga0501071_0245557 Ga0501071_0245557_352_1167 270
103 3300049589 Ga0501073_0005037 Ga0501073_0005037_5520_6335 270
104 3300049742 Ga0501080_0002950 Ga0501080_0002950_9883_10698 270
105 3300003775 Ga0055524_1038124 Ga0055524_10381241 271
106 3300003781 Ga0055536_1013326 Ga0055536_10133263 271
107 3300003794 Ga0055531_10005719 Ga0055531_100057197 271
108 3300005338 Ga0068868_100074388 Ga0068868_1000743883 271
109 3300014497 Ga0182008_10088084 Ga0182008_100880842 271
110 3300025245 Ga0207425_1006891 Ga0207425_10068913 271
111 3300025273 Ga0209673_1009173 Ga0209673_10091732 271
112 3300025284 Ga0209130_1004539 Ga0209130_10045392 271
113 3300025291 Ga0209675_1030548 Ga0209675_10305482 271
114 3300025291 Ga0209675_1033308 Ga0209675_10333082 271
115 3300025292 Ga0209676_1000857 Ga0209676_10008574 271
116 3300025292 Ga0209676_1006052 Ga0209676_10060523 271
117 3300025292 Ga0209676_1006913 Ga0209676_10069133 271
118 3300025292 Ga0209676_1009988 Ga0209676_10099882 271
119 3300025292 Ga0209676_1016423 Ga0209676_10164231 271
120 3300025294 Ga0209025_1009657 Ga0209025_10096575 271
121 3300025294 Ga0209025_1058267 Ga0209025_10582672 271
122 3300025295 Ga0209564_1023138 Ga0209564_10231382 271
123 3300025298 Ga0209050_1001432 Ga0209050_10014325 271
124 3300025299 Ga0209256_1001506 Ga0209256_100150618 271
125 3300025299 Ga0209256_1004573 Ga0209256_10045732 271
126 3300025299 Ga0209256_1004581 Ga0209256_10045812 271
127 3300025303 Ga0209051_1003199 Ga0209051_10031997 271
128 3300025304 Ga0209257_1005633 Ga0209257_10056334 271
129 3300025304 Ga0209257_1005693 Ga0209257_10056932 271
130 3300025972 Ga0207668_10012110 Ga0207668_100121105 271
131 3300026023 Ga0207677_10185308 Ga0207677_101853082 271
132 3300027471 Ga0209995_1004583 Ga0209995_10045832 271
133 3300027543 Ga0209999_1001382 Ga0209999_10013824 271
134 3300027552 Ga0209982_1000688 Ga0209982_10006884 271
135 3300027614 Ga0209970_1002597 Ga0209970_10025973 271
136 3300027665 Ga0209983_1001226 Ga0209983_10012266 271
137 3300030731 Ga0316177_1104201 Ga0316177_11042013 271
138 3300030733 Ga0314311_1226009 Ga0314311_12260097 271
139 3300032004 Ga0307414_10081949 Ga0307414_100819492 271
140 3300032005 Ga0307411_10076219 Ga0307411_100762191 271
141 3300032005 Ga0307411_10275620 Ga0307411_102756202 271
142 3300041404 Ga0439436_0002958 Ga0439436_0002958_1885_2727 271
143 3300042007 Ga0439449_0014700 Ga0439449_0014700_212_1042 271
144 3300046664 Ga0495659_0012642 Ga0495659_0012642_377_1210 271
145 3300047318 Ga0495636_0013687 Ga0495636_0013687_453_1334 271
146 3300047318 Ga0495636_0059654 Ga0495636_0059654_389_1222 271
147 3300048913 Ga0496110_0206912 Ga0496110_0206912_637_1518 271
148 3300048914 Ga0496111_0124209 Ga0496111_0124209_227_1108 271
149 3300049570 Ga0501033_0310021 Ga0501033_0310021_119_991 271
150 3300049579 Ga0501043_0003623 Ga0501043_0003623_9972_10787 271
151 iso_pu_bacteria 2941489479 2941493428 271
152 iso_pu_bacteria 2995948881 2995952477 271
153 3300003187 JGI25151J46595_10004262 JGI25151J46595_100042627 272
154 3300003323 rootH1_10221059 rootH1_102210592 272
155 3300003771 Ga0055526_1000139 Ga0055526_100013922 272
156 3300003773 Ga0055537_1000323 Ga0055537_100032312 272
157 3300003775 Ga0055524_1000206 Ga0055524_100020622 272
158 3300003784 Ga0055534_1000164 Ga0055534_100016431 272
159 3300003790 Ga0055528_1000027 Ga0055528_100002744 272
160 3300006173 Ga0070716_100046311 Ga0070716_1000463113 272
161 3300006175 Ga0070712_100075739 Ga0070712_1000757392 272
162 3300015689 Ga0183360_10001 Ga0183360_10001746 272
163 3300025263 Ga0209565_1000005 Ga0209565_1000005376 272
164 3300025263 Ga0209565_1017237 Ga0209565_10172372 272
165 3300025273 Ga0209673_1000011 Ga0209673_100001131 272
166 3300025291 Ga0209675_1000004 Ga0209675_1000004376 272
167 3300025294 Ga0209025_1000005 Ga0209025_100000522 272
168 3300025295 Ga0209564_1000018 Ga0209564_100001831 272
169 3300025297 Ga0209758_1044666 Ga0209758_10446661 272
170 3300025299 Ga0209256_1000031 Ga0209256_1000031375 272
171 3300025915 Ga0207693_10045032 Ga0207693_100450322 272
172 3300025939 Ga0207665_10017580 Ga0207665_100175804 272
173 3300032004 Ga0307414_10035514 Ga0307414_100355142 272
174 3300041413 Ga0439465_0056326 Ga0439465_0056326_345_1169 272
175 3300042010 Ga0439452_025194 Ga0439452_025194_261_1085 272
176 3300042876 Ga0451577_0002646 Ga0451577_0002646_18295_19149 272
177 3300046539 Ga0495621_0002707 Ga0495621_0002707_2866_3705 272
178 3300046616 Ga0495668_0014086 Ga0495668_0014086_178_1020 272
179 3300046664 Ga0495659_0066314 Ga0495659_0066314_405_1244 272
180 3300048907 Ga0496104_0278493 Ga0496104_0278493_212_1084 272
181 3300048924 Ga0496121_0013987 Ga0496121_0013987_4113_4946 272
182 3300049513 Ga0501290_000566 Ga0501290_000566_3852_4700 272
183 3300049568 Ga0501031_0168281 Ga0501031_0168281_397_1236 272
184 3300049570 Ga0501033_0170077 Ga0501033_0170077_108_947 272
185 3300049574 Ga0501038_0023837 Ga0501038_0023837_2137_2976 272
186 3300049581 Ga0501047_0162054 Ga0501047_0162054_74_913 272
187 3300049772 Ga0501275_000454 Ga0501275_000454_865_1713 272
188 3300049822 Ga0501035_0059988 Ga0501035_0059988_2365_3204 272
189 3300049823 Ga0501044_0006108 Ga0501044_0006108_466_1305 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

44

263

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4r-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa 0.9272 6 262
1i2k-assembly1.cif.gz_A aminodeoxychorismate lyase from escherichia coli 0.9255 3 256
3lul-assembly1.cif.gz_A crystal structure of putative 4-amino-4-deoxychorismate lyase. (yp_094631.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.78 a resolution 0.9153 13 264
1et0-assembly1.cif.gz_A crystal structure of aminodeoxychorismate lyase from escherichia coli 0.9122 3 267
1et0-assembly1.cif.gz_A crystal structure of aminodeoxychorismate lyase from escherichia coli 0.9053 3 267
ID Description Score Start End Superfamily
2xpfB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9509 118 262 3.20.10.10
3lulA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9062 116 264 3.20.10.10
3qqmH02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9031 111 241 3.20.10.10
3wwiB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9028 118 262 3.20.10.10
4cmdA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.8924 119 264 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A6J4LS03-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9777 2 269 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A352QUN4-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9724 3 266 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A3B9K3I0-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 4.1.3.38) 0.9584 13 263 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A6J4LS03-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9565 2 269 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A0B8P106-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9504 124 262 GO:0005829
GO:0008153
GO:0008696

Feature Viewer

pLDDT pTM Quality
94.3 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map