F291165

General Info

Members Datasets Scaffolds Average Seq Length
189 125 378 179

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10000029|Ga0307513_10000029148
Length 186
Sequence MKRAYVEKKLALGLAIGICLSLAACGSSEQEELQQWMTEQRNLTKPKIEPLPEPTKFAPQAYTQEGAIEPFSSQKLTQALHRDSNQATSNAALIAPELSRRKEPLEAMPLDAVAMVGSLIKLGHPVALVRVDNLLYQVRVGNYLGQNYGRITKISETEVGLREIVQDAAGEWIERTATLQLQEGSK

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
39 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
40 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
41 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
42 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
64 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
69 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
119 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
120 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
121 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
122 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
123 2738543013 Variovorax sp. BT01 Isolate Unclassified
124 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
125 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.58
Nodule 1.59
Rhizoplane 0
Rhizosphere 70.37
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10000029 3300031456 Bacteria 191823
2 JGI25155J39150_1000024 3300002704 Bacteria 133561
3 JGI25156J39149_1000005 3300002705 Bacteria 263980
4 JGI25154J39366_1000017 3300002738 Bacteria 252448
5 JGI25157J39369_1000003 3300002741 Bacteria 274935
6 rootH2_10244060 3300003320 Bacteria 1545
7 rootL2_10011836 3300003322 Bacteria 1596
8 Ga0055526_1005206 3300003771 Bacteria 7553
9 Ga0065714_10140838 3300005288 Bacteria 1156
10 Ga0068868_100493213 3300005338 Bacteria 1072
11 Ga0068868_100952818 3300005338 Bacteria 783
12 Ga0070660_100036391 3300005339 Bacteria 3729
13 Ga0070714_100458901 3300005435 Bacteria 1211
14 Ga0070679_100049573 3300005530 Bacteria 4182
15 Ga0070679_100075283 3300005530 Bacteria 3365
16 Ga0068853_100039191 3300005539 Bacteria 4041
17 Ga0068855_100041620 3300005563 Bacteria 5445
18 Ga0068855_101707442 3300005563 Bacteria 642
19 Ga0068857_101238235 3300005577 Bacteria 723
20 Ga0075365_10000849 3300006038 Bacteria 12670
21 Ga0075365_10060741 3300006038 Bacteria 2522
22 Ga0075368_10147446 3300006042 Unclassified 982
23 Ga0075363_100081230 3300006048 Bacteria 1773
24 Ga0075362_10072608 3300006177 Bacteria 1574
25 Ga0075362_10148006 3300006177 Bacteria 1125
26 Ga0075362_10163068 3300006177 Bacteria 1074
27 Ga0075367_10018544 3300006178 Bacteria 3843
28 Ga0075367_10058595 3300006178 Bacteria 2292
29 Ga0075366_10154964 3300006195 Unclassified 1388
30 Ga0075366_10384837 3300006195 Bacteria 863
31 Ga0075366_10502277 3300006195 Bacteria 750
32 Ga0075370_10174045 3300006353 Bacteria 1266
33 Ga0099826_10263668 3300006948 Bacteria 900
34 Ga0105240_10014239 3300009093 Bacteria 10865
35 Ga0105245_10005324 3300009098 Bacteria 11302
36 Ga0105245_10937852 3300009098 Bacteria 908
37 Ga0105243_11302184 3300009148 Bacteria 744
38 Ga0105241_10032628 3300009174 Bacteria 3905
39 Ga0105242_10004610 3300009176 Bacteria 10684
40 Ga0105238_10181476 3300009551 Bacteria 2082
41 Ga0105239_10388932 3300010375 Bacteria 1577
42 Ga0157326_1003137 3300012513 Bacteria 1747
43 Ga0157369_11043455 3300013105 Bacteria 836
44 Ga0157374_11031047 3300013296 Bacteria 842
45 Ga0157378_10243208 3300013297 Bacteria 1720
46 Ga0182008_10204638 3300014497 Bacteria 1005
47 Ga0157376_10213524 3300014969 Bacteria 1783
48 Ga0209435_100002 3300025206 Bacteria 794178
49 Ga0209646_1000001 3300025246 Bacteria 3092932
50 Ga0209026_1000001 3300025250 Bacteria 1228671
51 Ga0209759_1000001 3300025256 Bacteria 2799452
52 Ga0209565_1020793 3300025263 Bacteria 1381
53 Ga0209130_1002041 3300025284 Bacteria 10991
54 Ga0209675_1024509 3300025291 Bacteria 1540
55 Ga0209025_1030505 3300025294 Bacteria 2580
56 Ga0209564_1001126 3300025295 Bacteria 31456
57 Ga0207705_11030372 3300025909 Bacteria 635
58 Ga0207654_10250201 3300025911 Bacteria 1187
59 Ga0207695_10069385 3300025913 Bacteria 3607
60 Ga0207657_10506970 3300025919 Bacteria 945
61 Ga0207652_10368347 3300025921 Bacteria 1297
62 Ga0207652_10377547 3300025921 Bacteria 1279
63 Ga0207687_10005372 3300025927 Bacteria 8475
64 Ga0207664_10656968 3300025929 Bacteria 942
65 Ga0207690_10275105 3300025932 Bacteria 1310
66 Ga0207686_10093816 3300025934 Bacteria 1988
67 Ga0207689_10066243 3300025942 Bacteria 2970
68 Ga0207667_10182664 3300025949 Bacteria 2153
69 Ga0207677_10043525 3300026023 Bacteria 2985
70 Ga0207677_10097641 3300026023 Bacteria 2153
71 Ga0207677_11069981 3300026023 Bacteria 734
72 Ga0207702_10286971 3300026078 Bacteria 1558
73 Ga0207676_10187162 3300026095 Bacteria 1818
74 Ga0207674_10418125 3300026116 Bacteria 1295
75 Ga0207674_10777634 3300026116 Bacteria 924
76 Ga0209995_1046811 3300027471 Bacteria 732
77 Ga0209282_1353004 3300027666 Bacteria 600
78 Ga0209971_1000794 3300027682 Bacteria 8155
79 Ga0209813_10239876 3300027866 Unclassified 685
80 Ga0268265_10874556 3300028380 Bacteria 881
81 Ga0307515_10178226 3300028794 Bacteria 2087
82 Ga0265330_10000091 3300031235 Bacteria 76638
83 Ga0265332_10000027 3300031238 Bacteria 190796
84 Ga0265332_10000028 3300031238 Bacteria 184029
85 Ga0265332_10032303 3300031238 Bacteria 2281
86 Ga0265325_10004832 3300031241 Bacteria 8436
87 Ga0307513_10000038 3300031456 Bacteria 174780
88 Ga0307513_10124650 3300031456 Bacteria 2535
89 Ga0307408_100016100 3300031548 Bacteria 4986
90 Ga0307408_100351567 3300031548 Bacteria 1251
91 Ga0265314_10000054 3300031711 Bacteria 184029
92 Ga0265314_10011493 3300031711 Bacteria 7303
93 Ga0265342_10112911 3300031712 Bacteria 1536
94 Ga0307406_10129389 3300031901 Bacteria 1770
95 Ga0307406_10154968 3300031901 Bacteria 1639
96 Ga0307406_10268460 3300031901 Bacteria 1295
97 Ga0373936_0338881 3300035113 Bacteria 683
98 Ga0395899_0014027 3300037312 Bacteria 6118
99 Ga0395900_0022916 3300037418 Bacteria 6390
100 Ga0395900_0107255 3300037418 Bacteria 2869
101 Ga0395900_0164673 3300037418 Bacteria 2260
102 Ga0395900_0289488 3300037418 Bacteria 1627
103 Ga0395900_1303035 3300037418 Bacteria 640
104 Ga0395900_1456795 3300037418 Bacteria 597
105 Ga0395898_0004867 3300037466 Bacteria 14583
106 Ga0395898_0052306 3300037466 Bacteria 3990
107 Ga0395898_1350826 3300037466 Bacteria 641
108 Ga0395905_0000027 3300037471 Bacteria 297239
109 Ga0395905_0001411 3300037471 Bacteria 29041
110 Ga0395905_0002382 3300037471 Bacteria 20928
111 Ga0395905_0018805 3300037471 Bacteria 6553
112 Ga0395905_0029853 3300037471 Bacteria 5139
113 Ga0395905_0050684 3300037471 Bacteria 3888
114 Ga0395905_0101002 3300037471 Bacteria 2708
115 Ga0395905_0115139 3300037471 Bacteria 2526
116 Ga0395905_0139932 3300037471 Bacteria 2277
117 Ga0395905_0217249 3300037471 Bacteria 1790
118 Ga0395905_1165142 3300037471 Bacteria 674
119 Ga0395905_1342995 3300037471 Bacteria 619
120 Ga0395901_0002166 3300038443 Bacteria 20057
121 Ga0395901_0030378 3300038443 Bacteria 5567
122 Ga0395901_0041769 3300038443 Bacteria 4753
123 Ga0395901_0128364 3300038443 Bacteria 2665
124 Ga0395901_0150103 3300038443 Bacteria 2449
125 Ga0395901_0152047 3300038443 Bacteria 2432
126 Ga0395901_0333368 3300038443 Bacteria 1568
127 Ga0439431_0050417 3300041997 Bacteria 1078
128 Ga0439434_0293681 3300042435 Bacteria 561
129 Ga0451577_0000388 3300042876 Bacteria 81462
130 Ga0451577_0061001 3300042876 Bacteria 3362
131 Ga0466969_0014765 3300044656 Bacteria 4103
132 Ga0466969_0055675 3300044656 Bacteria 1934
133 Ga0466972_0015029 3300044658 Bacteria 3871
134 Ga0466972_0050331 3300044658 Bacteria 2011
135 Ga0466972_0468378 3300044658 Bacteria 592
136 Ga0466965_0186391 3300044683 Bacteria 1096
137 Ga0466966_0010790 3300044684 Bacteria 6071
138 Ga0466966_0054515 3300044684 Bacteria 2534
139 Ga0466966_0500016 3300044684 Bacteria 731
140 Ga0466961_0004019 3300044693 Bacteria 9210
141 Ga0466961_0418347 3300044693 Bacteria 812
142 Ga0466963_0358532 3300044694 Bacteria 1027
143 Ga0466964_0153156 3300044706 Bacteria 1071
144 Ga0453684_0000187 3300044712 Bacteria 272378
145 Ga0453684_0125957 3300044712 Bacteria 3083
146 Ga0453684_0371199 3300044712 Bacteria 1608
147 Ga0466968_0083119 3300044735 Bacteria 1410
148 Ga0466970_0210755 3300044765 Bacteria 1082
149 Ga0466957_0095369 3300044842 Bacteria 1868
150 Ga0466959_0018757 3300045049 Bacteria 5081
151 Ga0466959_0089932 3300045049 Bacteria 2206
152 Ga0466959_0378121 3300045049 Bacteria 964
153 Ga0451576_0001083 3300045051 Bacteria 49865
154 Ga0451576_0037438 3300045051 Bacteria 5139
155 Ga0466958_0274826 3300045836 Bacteria 1079
156 Ga0466967_0685427 3300045976 Bacteria 1014
157 Ga0501300_000189 3300049523 Bacteria 9319
158 Ga0501031_0001571 3300049568 Bacteria 14232
159 Ga0501034_0025995 3300049571 Bacteria 5963
160 Ga0501036_0804210 3300049572 Bacteria 774
161 Ga0501043_0513311 3300049579 Bacteria 894
162 Ga0501046_0145832 3300049580 Bacteria 1788
163 Ga0501249_011662 3300049679 Bacteria 1848
164 Ga0501080_0025688 3300049742 Bacteria 5470
165 Ga0501083_0065507 3300049744 Bacteria 2420
166 Ga0501267_021275 3300049764 Bacteria 718
167 Ga0501035_0432719 3300049822 Unclassified 1091
168 Ga0501044_0042214 3300049823 Bacteria 4745
169 nmdc:mga03683_143491_c1 3300050489 Bacteria 1074
170 nmdc:mga03683_583490_c1 3300050489 Bacteria 546
171 nmdc:mga03n38_118271_c1 3300050490 Bacteria 1299
172 nmdc:mga0yw44_104438_c1 3300050492 Bacteria 1809
173 nmdc:mga0yw44_2309_c1 3300050492 Bacteria 8072
174 nmdc:mga0yw44_389015_c1 3300050492 Bacteria 942
175 nmdc:mga0k408_281234_c1 3300050493 Bacteria 993
176 nmdc:mga0k408_343212_c1 3300050493 Bacteria 890
177 nmdc:mga06z11_130682_c1 3300050494 Unclassified 1410
178 nmdc:mga04h51_115215_c1 3300050495 Unclassified 995
179 nmdc:mga07m45_233865_c1 3300050496 Bacteria 1069
180 Ga0500583_0122724 3300053092 Bacteria 1286
181 Ga0500562_019000 3300053108 Bacteria 1775
182 Ga0500593_205320 3300053117 Bacteria 707
183 Ga0500645_002688 3300053730 Bacteria 7731
184 Ga0500645_008369 3300053730 Bacteria 3537
185 Ga0500645_053902 3300053730 Bacteria 1170
186 Ga0466962_0048800 3300061719 Bacteria 2023
187 2739250151 2738543013 Bacteria 5618633
188 2894024141 2894023352 Bacteria 5167372
189 2974322339 2974320154 Bacteria 4571377
190 Ga0307513_10000029
191 JGI25155J39150_1000024
192 JGI25156J39149_1000005
193 JGI25154J39366_1000017
194 JGI25157J39369_1000003
195 rootH2_10244060
196 rootL2_10011836
197 Ga0055526_1005206
198 Ga0065714_10140838
199 Ga0068868_100493213
200 Ga0068868_100952818
201 Ga0070660_100036391
202 Ga0070714_100458901
203 Ga0070679_100049573
204 Ga0070679_100075283
205 Ga0068853_100039191
206 Ga0068855_100041620
207 Ga0068855_101707442
208 Ga0068857_101238235
209 Ga0075365_10000849
210 Ga0075365_10060741
211 Ga0075368_10147446
212 Ga0075363_100081230
213 Ga0075362_10072608
214 Ga0075362_10148006
215 Ga0075362_10163068
216 Ga0075367_10018544
217 Ga0075367_10058595
218 Ga0075366_10154964
219 Ga0075366_10384837
220 Ga0075366_10502277
221 Ga0075370_10174045
222 Ga0099826_10263668
223 Ga0105240_10014239
224 Ga0105245_10005324
225 Ga0105245_10937852
226 Ga0105243_11302184
227 Ga0105241_10032628
228 Ga0105242_10004610
229 Ga0105238_10181476
230 Ga0105239_10388932
231 Ga0157326_1003137
232 Ga0157369_11043455
233 Ga0157374_11031047
234 Ga0157378_10243208
235 Ga0182008_10204638
236 Ga0157376_10213524
237 Ga0209435_100002
238 Ga0209646_1000001
239 Ga0209026_1000001
240 Ga0209759_1000001
241 Ga0209565_1020793
242 Ga0209130_1002041
243 Ga0209675_1024509
244 Ga0209025_1030505
245 Ga0209564_1001126
246 Ga0207705_11030372
247 Ga0207654_10250201
248 Ga0207695_10069385
249 Ga0207657_10506970
250 Ga0207652_10368347
251 Ga0207652_10377547
252 Ga0207687_10005372
253 Ga0207664_10656968
254 Ga0207690_10275105
255 Ga0207686_10093816
256 Ga0207689_10066243
257 Ga0207667_10182664
258 Ga0207677_10043525
259 Ga0207677_10097641
260 Ga0207677_11069981
261 Ga0207702_10286971
262 Ga0207676_10187162
263 Ga0207674_10418125
264 Ga0207674_10777634
265 Ga0209995_1046811
266 Ga0209282_1353004
267 Ga0209971_1000794
268 Ga0209813_10239876
269 Ga0268265_10874556
270 Ga0307515_10178226
271 Ga0265330_10000091
272 Ga0265332_10000027
273 Ga0265332_10000028
274 Ga0265332_10032303
275 Ga0265325_10004832
276 Ga0307513_10000038
277 Ga0307513_10124650
278 Ga0307408_100016100
279 Ga0307408_100351567
280 Ga0265314_10000054
281 Ga0265314_10011493
282 Ga0265342_10112911
283 Ga0307406_10129389
284 Ga0307406_10154968
285 Ga0307406_10268460
286 Ga0373936_0338881
287 Ga0395899_0014027
288 Ga0395900_0022916
289 Ga0395900_0107255
290 Ga0395900_0164673
291 Ga0395900_0289488
292 Ga0395900_1303035
293 Ga0395900_1456795
294 Ga0395898_0004867
295 Ga0395898_0052306
296 Ga0395898_1350826
297 Ga0395905_0000027
298 Ga0395905_0001411
299 Ga0395905_0002382
300 Ga0395905_0018805
301 Ga0395905_0029853
302 Ga0395905_0050684
303 Ga0395905_0101002
304 Ga0395905_0115139
305 Ga0395905_0139932
306 Ga0395905_0217249
307 Ga0395905_1165142
308 Ga0395905_1342995
309 Ga0395901_0002166
310 Ga0395901_0030378
311 Ga0395901_0041769
312 Ga0395901_0128364
313 Ga0395901_0150103
314 Ga0395901_0152047
315 Ga0395901_0333368
316 Ga0439431_0050417
317 Ga0439434_0293681
318 Ga0451577_0000388
319 Ga0451577_0061001
320 Ga0466969_0014765
321 Ga0466969_0055675
322 Ga0466972_0015029
323 Ga0466972_0050331
324 Ga0466972_0468378
325 Ga0466965_0186391
326 Ga0466966_0010790
327 Ga0466966_0054515
328 Ga0466966_0500016
329 Ga0466961_0004019
330 Ga0466961_0418347
331 Ga0466963_0358532
332 Ga0466964_0153156
333 Ga0453684_0000187
334 Ga0453684_0125957
335 Ga0453684_0371199
336 Ga0466968_0083119
337 Ga0466970_0210755
338 Ga0466957_0095369
339 Ga0466959_0018757
340 Ga0466959_0089932
341 Ga0466959_0378121
342 Ga0451576_0001083
343 Ga0451576_0037438
344 Ga0466958_0274826
345 Ga0466967_0685427
346 Ga0501300_000189
347 Ga0501031_0001571
348 Ga0501034_0025995
349 Ga0501036_0804210
350 Ga0501043_0513311
351 Ga0501046_0145832
352 Ga0501249_011662
353 Ga0501080_0025688
354 Ga0501083_0065507
355 Ga0501267_021275
356 Ga0501035_0432719
357 Ga0501044_0042214
358 nmdc:mga03683_143491_c1
359 nmdc:mga03683_583490_c1
360 nmdc:mga03n38_118271_c1
361 nmdc:mga0yw44_104438_c1
362 nmdc:mga0yw44_2309_c1
363 nmdc:mga0yw44_389015_c1
364 nmdc:mga0k408_281234_c1
365 nmdc:mga0k408_343212_c1
366 nmdc:mga06z11_130682_c1
367 nmdc:mga04h51_115215_c1
368 nmdc:mga07m45_233865_c1
369 Ga0500583_0122724
370 Ga0500562_019000
371 Ga0500593_205320
372 Ga0500645_002688
373 Ga0500645_008369
374 Ga0500645_053902
375 Ga0466962_0048800
376 2739250151
377 2894024141
378 2974322339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04351

PilP

Pilus assembly protein, PilP

32

181

0.96

Map