F290767

General Info

Members Datasets Scaffolds Average Seq Length
189 143 378 117

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100176515|Ga0075430_1001765153
Length 136
Sequence MSIRRTPVRIKSDVNHGAMMKHYLLSIYQPDGPLPPPEFLDKVMKDVGALRQAMKDANAWVFGGGLHPPSTATVVRSRDGDVLTTDGPFAEGKEHLGGFCIIKVTDLDAALEWGSRLARVLAPLSIEVRPFQGDPH

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
76 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
84 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
125 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
126 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
129 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 2558860280 Kutzneria sp. 744 Isolate Unclassified
133 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
134 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
135 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
136 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
137 2858882152 Micromonospora noduli MED15 Isolate Nodule
138 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
139 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
140 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
141 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
142 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
143 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 0
Isolates 6.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 1.06
Rhizoplane 1.59
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100176515 3300006846 Bacteria 1777
2 JGI25406J46586_10002986 3300003203 Bacteria 7990
3 JGI25406J46586_10043371 3300003203 Bacteria 1566
4 Ga0065704_10685604 3300005289 Bacteria 567
5 Ga0065715_10233692 3300005293 Bacteria 1224
6 Ga0070714_100961776 3300005435 Bacteria 830
7 Ga0070713_100136911 3300005436 Bacteria 2165
8 Ga0070708_101496312 3300005445 Bacteria 629
9 Ga0070678_100926675 3300005456 Bacteria 797
10 Ga0070685_10371157 3300005466 Bacteria 983
11 Ga0070706_100088651 3300005467 Bacteria 2868
12 Ga0070706_100996184 3300005467 Bacteria 773
13 Ga0070706_101384741 3300005467 Bacteria 644
14 Ga0070698_100001173 3300005471 Bacteria 29070
15 Ga0070698_100197490 3300005471 Bacteria 1948
16 Ga0070699_100359126 3300005518 Bacteria 1313
17 Ga0070679_100245784 3300005530 Bacteria 1746
18 Ga0070665_101204075 3300005548 Bacteria 768
19 Ga0070664_101536087 3300005564 Bacteria 630
20 Ga0068859_100801040 3300005617 Bacteria 1030
21 Ga0068863_101027983 3300005841 Bacteria 827
22 Ga0068860_100986321 3300005843 Bacteria 860
23 Ga0081455_10047672 3300005937 Bacteria 3708
24 Ga0081455_10100090 3300005937 Bacteria 2330
25 Ga0081539_10006529 3300005985 Bacteria 11132
26 Ga0081539_10006779 3300005985 Bacteria 10748
27 Ga0081539_10009712 3300005985 Bacteria 7965
28 Ga0070717_10001096 3300006028 Bacteria 18218
29 Ga0068871_100589919 3300006358 Bacteria 1010
30 Ga0075428_100529746 3300006844 Bacteria 1260
31 Ga0075430_100506666 3300006846 Bacteria 996
32 Ga0075430_101237917 3300006846 Bacteria 614
33 Ga0075431_100051660 3300006847 Bacteria 4239
34 Ga0075431_101854600 3300006847 Bacteria 559
35 Ga0075434_100048516 3300006871 Bacteria 4213
36 Ga0075434_100606048 3300006871 Bacteria 1114
37 Ga0075434_101513685 3300006871 Bacteria 680
38 Ga0075429_100576788 3300006880 Bacteria 986
39 Ga0075436_100044424 3300006914 Bacteria 3064
40 Ga0099794_10454151 3300007265 Bacteria 672
41 Ga0114129_10244615 3300009147 Bacteria 2411
42 Ga0114129_10408636 3300009147 Bacteria 1788
43 Ga0114129_10413029 3300009147 Bacteria 1777
44 Ga0114129_10853081 3300009147 Bacteria 1158
45 Ga0114129_11181886 3300009147 Bacteria 954
46 Ga0105248_12140353 3300009177 Bacteria 636
47 Ga0105237_10454950 3300009545 Bacteria 1286
48 Ga0157378_11493600 3300013297 Bacteria 720
49 Ga0157377_11357310 3300014745 Bacteria 558
50 Ga0207642_10733232 3300025899 Bacteria 625
51 Ga0207684_10030607 3300025910 Bacteria 4581
52 Ga0207684_10725355 3300025910 Bacteria 843
53 Ga0207687_10387065 3300025927 Bacteria 1147
54 Ga0207700_10494100 3300025928 Bacteria 1082
55 Ga0207700_11143284 3300025928 Bacteria 696
56 Ga0207664_11354598 3300025929 Bacteria 632
57 Ga0207669_10723159 3300025937 Bacteria 820
58 Ga0207711_10296236 3300025941 Bacteria 1492
59 Ga0207689_10132380 3300025942 Bacteria 2052
60 Ga0207651_11553521 3300025960 Bacteria 596
61 Ga0207677_11686644 3300026023 Bacteria 587
62 Ga0207708_10076031 3300026075 Bacteria 2575
63 Ga0207641_10607869 3300026088 Bacteria 1071
64 Ga0207641_11445848 3300026088 Bacteria 689
65 Ga0207675_100063582 3300026118 Bacteria 3448
66 Ga0207675_100234336 3300026118 Bacteria 1772
67 Ga0207683_10430270 3300026121 Bacteria 1216
68 Ga0268266_11268482 3300028379 Bacteria 712
69 Ga0268265_11696360 3300028380 Bacteria 638
70 Ga0268264_11140074 3300028381 Bacteria 789
71 Ga0307515_10020141 3300028794 Bacteria 11925
72 Ga0307511_10000753 3300030521 Bacteria 34607
73 Ga0307512_10024391 3300030522 Bacteria 5382
74 Ga0307513_10025382 3300031456 Bacteria 6868
75 Ga0307408_100027307 3300031548 Bacteria 3932
76 Ga0307408_101298975 3300031548 Bacteria 682
77 Ga0307508_10015569 3300031616 Bacteria 6929
78 Ga0307516_10014865 3300031730 Bacteria 8217
79 Ga0307405_10008190 3300031731 Bacteria 5285
80 Ga0307413_10837092 3300031824 Bacteria 776
81 Ga0307410_10007498 3300031852 Bacteria 5976
82 Ga0307410_10074881 3300031852 Bacteria 2359
83 Ga0307406_10001300 3300031901 Bacteria 13998
84 Ga0307406_10366713 3300031901 Bacteria 1131
85 Ga0307406_10603551 3300031901 Bacteria 905
86 Ga0307406_10875360 3300031901 Bacteria 763
87 Ga0307407_10047148 3300031903 Bacteria 2443
88 Ga0307412_10040917 3300031911 Bacteria 3001
89 Ga0307409_100018043 3300031995 Bacteria 4726
90 Ga0307409_100098508 3300031995 Bacteria 2418
91 Ga0307409_101101818 3300031995 Bacteria 815
92 Ga0307416_100002626 3300032002 Bacteria 10392
93 Ga0307416_100305543 3300032002 Bacteria 1584
94 Ga0307416_100693643 3300032002 Bacteria 1107
95 Ga0307416_101394831 3300032002 Bacteria 806
96 Ga0307414_10046693 3300032004 Bacteria 2975
97 Ga0307414_10679105 3300032004 Bacteria 931
98 Ga0307411_10004461 3300032005 Bacteria 6710
99 Ga0307411_10497742 3300032005 Bacteria 1030
100 Ga0307411_10812858 3300032005 Bacteria 824
101 Ga0307411_11756710 3300032005 Bacteria 575
102 Ga0307415_100004939 3300032126 Bacteria 7013
103 Ga0307415_100022927 3300032126 Bacteria 3865
104 Ga0307415_100024495 3300032126 Bacteria 3769
105 Ga0307415_100719550 3300032126 Bacteria 903
106 Ga0373947_1083145 3300035725 Bacteria 546
107 Ga0373937_0358570 3300036401 Bacteria 1382
108 Ga0395905_0357067 3300037471 Bacteria 1354
109 Ga0436365_0156949 3300039437 Bacteria 595
110 Ga0451795_0680869 3300041456 Bacteria 620
111 Ga0451853_0436614 3300041512 Bacteria 1037
112 Ga0439448_0196289 3300042005 Bacteria 707
113 Ga0439463_039331 3300042016 Bacteria 1201
114 Ga0466969_0042435 3300044656 Bacteria 2271
115 Ga0466963_1092856 3300044694 Bacteria 561
116 Ga0466957_0558188 3300044842 Bacteria 798
117 Ga0451576_0015467 3300045051 Bacteria 8451
118 Ga0495638_0458113 3300046460 Bacteria 650
119 Ga0495651_0617055 3300046462 Bacteria 683
120 Ga0495632_0257544 3300046519 Bacteria 781
121 Ga0495593_0616070 3300047673 Bacteria 545
122 Ga0496104_0696226 3300048907 Bacteria 924
123 Ga0496114_0326296 3300048917 Bacteria 1357
124 Ga0496126_0003751 3300048929 Bacteria 18892
125 Ga0501031_0005031 3300049568 Bacteria 8594
126 Ga0501032_0038977 3300049569 Bacteria 3234
127 Ga0501033_0076930 3300049570 Bacteria 2449
128 Ga0501036_0005311 3300049572 Bacteria 10425
129 Ga0501037_0088947 3300049573 Bacteria 2235
130 Ga0501038_0014851 3300049574 Bacteria 7091
131 Ga0501039_0001932 3300049575 Bacteria 15359
132 Ga0501040_0000943 3300049576 Bacteria 18323
133 Ga0501041_0000254 3300049577 Bacteria 25126
134 Ga0501042_0000460 3300049578 Bacteria 20994
135 Ga0501043_0008092 3300049579 Bacteria 8297
136 Ga0501046_0000353 3300049580 Bacteria 46190
137 Ga0501048_0000672 3300049582 Bacteria 24785
138 Ga0501068_0061752 3300049584 Bacteria 2277
139 Ga0501069_0121579 3300049585 Bacteria 1491
140 Ga0501070_0482825 3300049586 Bacteria 997
141 Ga0501071_0004979 3300049587 Bacteria 8487
142 Ga0501072_0038610 3300049588 Bacteria 3747
143 Ga0501075_0000081 3300049591 Bacteria 43290
144 Ga0501076_0060123 3300049592 Bacteria 3022
145 Ga0501077_0005055 3300049593 Bacteria 8000
146 Ga0501249_217480 3300049679 Bacteria 508
147 Ga0501079_0001117 3300049741 Bacteria 18679
148 Ga0501080_0067021 3300049742 Bacteria 3339
149 Ga0501081_0052805 3300049743 Bacteria 2805
150 Ga0501083_0083649 3300049744 Bacteria 2114
151 Ga0501045_0002918 3300049824 Bacteria 11686
152 nmdc:mga05p37_107828_c1 3300050507 Bacteria 3426
153 nmdc:mga05p37_14783_c1 3300050507 Bacteria 9375
154 nmdc:mga05p37_281670_c1 3300050507 Bacteria 1982
155 nmdc:mga05p37_53232_c1 3300050507 Bacteria 4977
156 nmdc:mga09592_775742_c1 3300050508 Bacteria 812
157 nmdc:mga0qj67_25298_c1 3300050509 Bacteria 4586
158 nmdc:mga0qj67_628613_c1 3300050509 Bacteria 858
159 nmdc:mga06r32_288217_c1 3300050510 Bacteria 1629
160 nmdc:mga06r32_77433_c1 3300050510 Bacteria 3231
161 nmdc:mga08y16_1327303_c1 3300050511 Bacteria 685
162 nmdc:mga0n895_1025542_c1 3300050512 Bacteria 805
163 nmdc:mga0n895_104640_c1 3300050512 Bacteria 2843
164 nmdc:mga0n895_1372097_c1 3300050512 Bacteria 676
165 nmdc:mga0n895_764623_c1 3300050512 Bacteria 958
166 Ga0500643_017202 3300053087 Bacteria 2427
167 Ga0500651_0286094 3300053093 Bacteria 949
168 Ga0500641_0347918 3300053096 Bacteria 596
169 Ga0500562_010258 3300053108 Bacteria 2373
170 Ga0500562_073050 3300053108 Bacteria 926
171 Ga0500594_0009928 3300053118 Bacteria 2199
172 Ga0500652_114024 3300053131 Bacteria 1130
173 Ga0501084_0114384 3300054114 Bacteria 2268
174 Ga0590071_051162 3300059421 Bacteria 1002
175 Ga0590075_033633 3300059424 Bacteria 1302
176 Ga0590077_072213 3300059426 Bacteria 789
177 Ga0501082_0001519 3300060353 Bacteria 20438
178 2559426446 2558860280 Bacteria 11429938
179 2855676312 2855670206 Bacteria 7120389
180 2855681451 2855676851 Bacteria 7063653
181 2857289353 2857288857 Bacteria 7189066
182 2858855283 2858848962 Bacteria 6963058
183 2858888850 2858882152 Bacteria 7230291
184 2858889122 2858888857 Bacteria 7060307
185 2858897302 2858895516 Bacteria 7378898
186 2869049468 2869048445 Bacteria 6875584
187 2869063438 2869061728 Bacteria 7112407
188 2869074654 2869068681 Bacteria 7205615
189 2912758969 2912757875 Bacteria 7940295
190 Ga0075430_100176515
191 JGI25406J46586_10002986
192 JGI25406J46586_10043371
193 Ga0065704_10685604
194 Ga0065715_10233692
195 Ga0070714_100961776
196 Ga0070713_100136911
197 Ga0070708_101496312
198 Ga0070678_100926675
199 Ga0070685_10371157
200 Ga0070706_100088651
201 Ga0070706_100996184
202 Ga0070706_101384741
203 Ga0070698_100001173
204 Ga0070698_100197490
205 Ga0070699_100359126
206 Ga0070679_100245784
207 Ga0070665_101204075
208 Ga0070664_101536087
209 Ga0068859_100801040
210 Ga0068863_101027983
211 Ga0068860_100986321
212 Ga0081455_10047672
213 Ga0081455_10100090
214 Ga0081539_10006529
215 Ga0081539_10006779
216 Ga0081539_10009712
217 Ga0070717_10001096
218 Ga0068871_100589919
219 Ga0075428_100529746
220 Ga0075430_100506666
221 Ga0075430_101237917
222 Ga0075431_100051660
223 Ga0075431_101854600
224 Ga0075434_100048516
225 Ga0075434_100606048
226 Ga0075434_101513685
227 Ga0075429_100576788
228 Ga0075436_100044424
229 Ga0099794_10454151
230 Ga0114129_10244615
231 Ga0114129_10408636
232 Ga0114129_10413029
233 Ga0114129_10853081
234 Ga0114129_11181886
235 Ga0105248_12140353
236 Ga0105237_10454950
237 Ga0157378_11493600
238 Ga0157377_11357310
239 Ga0207642_10733232
240 Ga0207684_10030607
241 Ga0207684_10725355
242 Ga0207687_10387065
243 Ga0207700_10494100
244 Ga0207700_11143284
245 Ga0207664_11354598
246 Ga0207669_10723159
247 Ga0207711_10296236
248 Ga0207689_10132380
249 Ga0207651_11553521
250 Ga0207677_11686644
251 Ga0207708_10076031
252 Ga0207641_10607869
253 Ga0207641_11445848
254 Ga0207675_100063582
255 Ga0207675_100234336
256 Ga0207683_10430270
257 Ga0268266_11268482
258 Ga0268265_11696360
259 Ga0268264_11140074
260 Ga0307515_10020141
261 Ga0307511_10000753
262 Ga0307512_10024391
263 Ga0307513_10025382
264 Ga0307408_100027307
265 Ga0307408_101298975
266 Ga0307508_10015569
267 Ga0307516_10014865
268 Ga0307405_10008190
269 Ga0307413_10837092
270 Ga0307410_10007498
271 Ga0307410_10074881
272 Ga0307406_10001300
273 Ga0307406_10366713
274 Ga0307406_10603551
275 Ga0307406_10875360
276 Ga0307407_10047148
277 Ga0307412_10040917
278 Ga0307409_100018043
279 Ga0307409_100098508
280 Ga0307409_101101818
281 Ga0307416_100002626
282 Ga0307416_100305543
283 Ga0307416_100693643
284 Ga0307416_101394831
285 Ga0307414_10046693
286 Ga0307414_10679105
287 Ga0307411_10004461
288 Ga0307411_10497742
289 Ga0307411_10812858
290 Ga0307411_11756710
291 Ga0307415_100004939
292 Ga0307415_100022927
293 Ga0307415_100024495
294 Ga0307415_100719550
295 Ga0373947_1083145
296 Ga0373937_0358570
297 Ga0395905_0357067
298 Ga0436365_0156949
299 Ga0451795_0680869
300 Ga0451853_0436614
301 Ga0439448_0196289
302 Ga0439463_039331
303 Ga0466969_0042435
304 Ga0466963_1092856
305 Ga0466957_0558188
306 Ga0451576_0015467
307 Ga0495638_0458113
308 Ga0495651_0617055
309 Ga0495632_0257544
310 Ga0495593_0616070
311 Ga0496104_0696226
312 Ga0496114_0326296
313 Ga0496126_0003751
314 Ga0501031_0005031
315 Ga0501032_0038977
316 Ga0501033_0076930
317 Ga0501036_0005311
318 Ga0501037_0088947
319 Ga0501038_0014851
320 Ga0501039_0001932
321 Ga0501040_0000943
322 Ga0501041_0000254
323 Ga0501042_0000460
324 Ga0501043_0008092
325 Ga0501046_0000353
326 Ga0501048_0000672
327 Ga0501068_0061752
328 Ga0501069_0121579
329 Ga0501070_0482825
330 Ga0501071_0004979
331 Ga0501072_0038610
332 Ga0501075_0000081
333 Ga0501076_0060123
334 Ga0501077_0005055
335 Ga0501249_217480
336 Ga0501079_0001117
337 Ga0501080_0067021
338 Ga0501081_0052805
339 Ga0501083_0083649
340 Ga0501045_0002918
341 nmdc:mga05p37_107828_c1
342 nmdc:mga05p37_14783_c1
343 nmdc:mga05p37_281670_c1
344 nmdc:mga05p37_53232_c1
345 nmdc:mga09592_775742_c1
346 nmdc:mga0qj67_25298_c1
347 nmdc:mga0qj67_628613_c1
348 nmdc:mga06r32_288217_c1
349 nmdc:mga06r32_77433_c1
350 nmdc:mga08y16_1327303_c1
351 nmdc:mga0n895_1025542_c1
352 nmdc:mga0n895_104640_c1
353 nmdc:mga0n895_1372097_c1
354 nmdc:mga0n895_764623_c1
355 Ga0500643_017202
356 Ga0500651_0286094
357 Ga0500641_0347918
358 Ga0500562_010258
359 Ga0500562_073050
360 Ga0500594_0009928
361 Ga0500652_114024
362 Ga0501084_0114384
363 Ga0590071_051162
364 Ga0590075_033633
365 Ga0590077_072213
366 Ga0501082_0001519
367 2559426446
368 2855676312
369 2855681451
370 2857289353
371 2858855283
372 2858888850
373 2858889122
374 2858897302
375 2869049468
376 2869063438
377 2869074654
378 2912758969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

20

132

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9128 2 117
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8981 2 117
4g67-assembly1.cif.gz_A crystal structure of a cog1565 superfamily member and likely methyl transferase from burkholderia thailandensis bound to s-adenosyl-homocysteine 0.8619 12 42
4f3n-assembly1.cif.gz_A high resolution native crystal structure of an uncharacterized acr, cog1565 superfamily protein from burkholderia thailandensis, solved by iodide ion sad 0.8542 12 42
2ivm-assembly1.cif.gz_A crystal structure of a transcriptional regulator 0.6822 3 114
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9128 2 117 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8981 2 117 3.30.70.1060
4f3nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8542 12 42 3.40.50.12710
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7427 3 117 3.30.70.1060
af_P71888_58_138_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.716 2 111 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A399VG70-F1-model_v4 deleted 0.9859 1 113
AF-A0A399VG70-F1-model_v4 deleted 0.9774 1 113
AF-A0A512DDB6-F1-model_v4 YCII-related domain-containing protein 0.9701 1 112
AF-A0A0K8QD08-F1-model_v4 Uncharacterized protein R00369 0.9634 25 115
AF-Q82NU5-F1-model_v4 YCII-related domain-containing protein 0.9624 2 115

Map