F290760

General Info

Members Datasets Scaffolds Average Seq Length
189 134 378 163

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100331807|Ga0075428_1003318072
Length 186
Sequence MAEGRYLAKVPQGAGPKRALSLDEMLIAILADTHLPRGSRAIPEACLERVRAADLLLHAGDLSTAEVLENLRALGPPVAAVHGNIDSADLRRMLPERQVVDAAGARIGLLHDAGPRAGRLRRMRLAFPECEAVVFGHSHIPLHEEEDGFQIFNPGSPTDRRRQPRHSMGIARVAGGRVTFEHVWLD

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
84 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
85 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0
Rhizoplane 7.41
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100331807 3300006844 Bacteria 1634
2 Ga0068868_100229846 3300005338 Bacteria 1556
3 Ga0070668_100360292 3300005347 Bacteria 1233
4 Ga0070709_10960647 3300005434 Bacteria 678
5 Ga0070714_100061785 3300005435 Bacteria 3218
6 Ga0070714_100388579 3300005435 Bacteria 1317
7 Ga0070713_100399277 3300005436 Bacteria 1284
8 Ga0070713_100645777 3300005436 Bacteria 1007
9 Ga0070700_100174789 3300005441 Bacteria 1490
10 Ga0070700_101146881 3300005441 Bacteria 647
11 Ga0070678_101033025 3300005456 Bacteria 756
12 Ga0070706_100054360 3300005467 Bacteria 3696
13 Ga0070707_100384234 3300005468 Bacteria 1364
14 Ga0070699_100351545 3300005518 Bacteria 1328
15 Ga0070684_100578691 3300005535 Bacteria 1043
16 Ga0070672_101054316 3300005543 Bacteria 722
17 Ga0070693_100368210 3300005547 Bacteria 988
18 Ga0068856_100132190 3300005614 Bacteria 2500
19 Ga0068859_102183872 3300005617 Bacteria 611
20 Ga0068866_10396274 3300005718 Bacteria 889
21 Ga0070717_10309438 3300006028 Bacteria 1406
22 Ga0070717_10650637 3300006028 Bacteria 957
23 Ga0075363_100239299 3300006048 Bacteria 1043
24 Ga0075364_10112410 3300006051 Bacteria 1818
25 Ga0097620_102183866 3300006931 Bacteria 611
26 Ga0105240_12013307 3300009093 Bacteria 600
27 Ga0111539_10065478 3300009094 Bacteria 4293
28 Ga0111539_11522597 3300009094 Bacteria 776
29 Ga0111539_11898217 3300009094 Unclassified 691
30 Ga0105245_10213868 3300009098 Bacteria 1857
31 Ga0105245_10261046 3300009098 Bacteria 1686
32 Ga0105245_10277874 3300009098 Bacteria 1636
33 Ga0114129_10517929 3300009147 Bacteria 1555
34 Ga0105243_12109979 3300009148 Bacteria 599
35 Ga0105242_11266133 3300009176 Bacteria 760
36 Ga0105239_10370294 3300010375 Bacteria 1619
37 Ga0157374_11421499 3300013296 Unclassified 716
38 Ga0163163_10868926 3300014325 Bacteria 965
39 Ga0157380_10000037 3300014326 Bacteria 80856
40 Ga0207642_10070991 3300025899 Bacteria 1657
41 Ga0207684_10143505 3300025910 Bacteria 2053
42 Ga0207657_10421451 3300025919 Bacteria 1049
43 Ga0207649_10146464 3300025920 Bacteria 1622
44 Ga0207646_10407428 3300025922 Bacteria 1228
45 Ga0207646_10542192 3300025922 Bacteria 1046
46 Ga0207687_10235826 3300025927 Bacteria 1447
47 Ga0207690_10204274 3300025932 Bacteria 1502
48 Ga0207706_10767136 3300025933 Bacteria 821
49 Ga0207686_10338753 3300025934 Bacteria 1129
50 Ga0207670_10801237 3300025936 Bacteria 785
51 Ga0207691_10222006 3300025940 Bacteria 1638
52 Ga0207689_10627085 3300025942 Bacteria 905
53 Ga0207661_10375245 3300025944 Bacteria 1287
54 Ga0207640_10775652 3300025981 Bacteria 828
55 Ga0207658_10253557 3300025986 Bacteria 1496
56 Ga0207677_10096811 3300026023 Bacteria 2160
57 Ga0207677_10222058 3300026023 Bacteria 1516
58 Ga0207678_10253703 3300026067 Bacteria 1507
59 Ga0207708_10160728 3300026075 Bacteria 1774
60 Ga0207648_10662799 3300026089 Bacteria 965
61 Ga0207674_10705508 3300026116 Bacteria 974
62 Ga0207675_100035156 3300026118 Bacteria 4674
63 Ga0207675_100312407 3300026118 Bacteria 1533
64 Ga0207675_101923169 3300026118 Bacteria 610
65 Ga0207683_10264474 3300026121 Bacteria 1571
66 Ga0265327_10026121 3300031251 Bacteria 3389
67 Ga0307410_10592931 3300031852 Bacteria 923
68 Ga0307409_100117495 3300031995 Bacteria 2244
69 Ga0373944_0019006 3300035089 Bacteria 1968
70 Ga0373935_0256185 3300035692 Unclassified 1226
71 Ga0373935_0318559 3300035692 Bacteria 1103
72 Ga0373947_0012897 3300035725 Bacteria 4791
73 Ga0373947_0235540 3300035725 Bacteria 1207
74 Ga0373925_0039216 3300037068 Bacteria 3504
75 Ga0373925_1209585 3300037068 Bacteria 621
76 Ga0395899_0118867 3300037312 Bacteria 1895
77 Ga0395899_0408639 3300037312 Bacteria 897
78 Ga0395900_0122351 3300037418 Bacteria 2669
79 Ga0395900_0512177 3300037418 Bacteria 1149
80 Ga0395898_0042865 3300037466 Bacteria 4462
81 Ga0395898_0115534 3300037466 Bacteria 2571
82 Ga0395898_0189870 3300037466 Bacteria 1963
83 Ga0395898_0467353 3300037466 Bacteria 1201
84 Ga0395898_1049121 3300037466 Bacteria 750
85 Ga0395905_0021900 3300037471 Bacteria 6044
86 Ga0395905_0121376 3300037471 Bacteria 2456
87 Ga0395905_0604133 3300037471 Bacteria 999
88 Ga0395905_0618874 3300037471 Bacteria 985
89 Ga0395905_1170819 3300037471 Bacteria 672
90 Ga0436364_0142471 3300037853 Bacteria 2373
91 Ga0395901_0135219 3300038443 Bacteria 2591
92 Ga0395901_0554778 3300038443 Bacteria 1164
93 Ga0395901_0868321 3300038443 Bacteria 886
94 Ga0395901_1201391 3300038443 Bacteria 724
95 Ga0436365_0627314 3300039437 Bacteria 3221
96 Ga0436363_1613718 3300039450 Bacteria 798
97 Ga0451804_0355989 3300041463 Bacteria 803
98 Ga0466969_0003110 3300044656 Bacteria 8841
99 Ga0466965_0563296 3300044683 Bacteria 644
100 Ga0466961_0172503 3300044693 Bacteria 1345
101 Ga0466961_0248630 3300044693 Unclassified 1092
102 Ga0466961_0466152 3300044693 Bacteria 764
103 Ga0466961_0942195 3300044693 Unclassified 514
104 Ga0466963_0021097 3300044694 Bacteria 4104
105 Ga0466963_0048952 3300044694 Bacteria 2794
106 Ga0466963_0049457 3300044694 Bacteria 2780
107 Ga0466963_0194017 3300044694 Bacteria 1419
108 Ga0466963_0233679 3300044694 Bacteria 1289
109 Ga0466963_0492639 3300044694 Bacteria 865
110 Ga0466963_0656929 3300044694 Bacteria 740
111 Ga0466971_0032163 3300044719 Bacteria 2350
112 Ga0466957_0545852 3300044842 Bacteria 807
113 Ga0466960_0001497 3300044901 Bacteria 8506
114 Ga0466959_0034121 3300045049 Bacteria 3765
115 Ga0466959_0071491 3300045049 Bacteria 2512
116 Ga0466958_0043895 3300045836 Bacteria 2693
117 Ga0466958_0085725 3300045836 Bacteria 1943
118 Ga0466958_0258342 3300045836 Bacteria 1115
119 Ga0466967_0002863 3300045976 Bacteria 10963
120 Ga0466967_0031701 3300045976 Bacteria 4454
121 Ga0466967_0144890 3300045976 Bacteria 2215
122 Ga0495603_0249011 3300046455 Bacteria 1023
123 Ga0495603_0286367 3300046455 Bacteria 947
124 Ga0495582_0105089 3300046473 Bacteria 1583
125 Ga0495605_0086280 3300046474 Bacteria 1461
126 Ga0495596_0045585 3300046500 Bacteria 1724
127 Ga0495644_0134768 3300046523 Bacteria 942
128 Ga0495676_0186021 3300047321 Unclassified 1452
129 Ga0496101_0089354 3300048904 Bacteria 2289
130 Ga0496102_0011663 3300048905 Bacteria 7586
131 Ga0496103_0011787 3300048906 Bacteria 5186
132 Ga0496103_0057060 3300048906 Bacteria 2424
133 Ga0496104_0164284 3300048907 Bacteria 2129
134 Ga0496106_0110459 3300048909 Unclassified 2140
135 Ga0496107_0024286 3300048910 Bacteria 4288
136 Ga0496110_0074417 3300048913 Bacteria 3016
137 Ga0496110_0542262 3300048913 Bacteria 1057
138 Ga0496111_0083911 3300048914 Bacteria 2328
139 Ga0496111_0380413 3300048914 Bacteria 1044
140 Ga0496112_0122508 3300048915 Bacteria 2571
141 Ga0496112_0214636 3300048915 Bacteria 1881
142 Ga0496117_0005647 3300048920 Bacteria 13056
143 Ga0496117_0081685 3300048920 Bacteria 2120
144 Ga0496118_0000818 3300048921 Bacteria 49518
145 Ga0496118_0073501 3300048921 Bacteria 2449
146 Ga0496118_0298894 3300048921 Bacteria 885
147 Ga0496119_0019868 3300048922 Bacteria 4924
148 Ga0496120_0024079 3300048923 Bacteria 3801
149 Ga0496121_0064466 3300048924 Bacteria 2987
150 Ga0496121_0230846 3300048924 Bacteria 1296
151 Ga0496121_0402252 3300048924 Bacteria 896
152 Ga0496125_0053847 3300048928 Bacteria 3294
153 Ga0501031_0006831 3300049568 Bacteria 7446
154 Ga0501032_0016507 3300049569 Bacteria 5192
155 Ga0501033_0332247 3300049570 Bacteria 1066
156 Ga0501034_0055393 3300049571 Bacteria 3990
157 Ga0501036_0029410 3300049572 Bacteria 4641
158 Ga0501037_0073534 3300049573 Bacteria 2485
159 Ga0501038_0033396 3300049574 Bacteria 4533
160 Ga0501039_0045326 3300049575 Bacteria 3397
161 Ga0501043_0003920 3300049579 Bacteria 12203
162 Ga0501046_0002231 3300049580 Bacteria 18278
163 Ga0501047_0022808 3300049581 Bacteria 6009
164 Ga0501047_0223370 3300049581 Bacteria 1739
165 Ga0501048_0021445 3300049582 Bacteria 4730
166 Ga0501067_0007777 3300049583 Bacteria 5963
167 Ga0501069_0031873 3300049585 Bacteria 2901
168 Ga0501070_0381235 3300049586 Bacteria 1142
169 Ga0501071_0204725 3300049587 Unclassified 1483
170 Ga0501071_0623284 3300049587 Bacteria 830
171 Ga0501072_0030548 3300049588 Bacteria 4215
172 Ga0501073_0002965 3300049589 Bacteria 12733
173 Ga0501074_0482714 3300049590 Unclassified 878
174 Ga0501079_0271398 3300049741 Bacteria 1326
175 Ga0501080_0012929 3300049742 Bacteria 7662
176 Ga0501080_0120740 3300049742 Bacteria 2429
177 Ga0501083_0004342 3300049744 Bacteria 9986
178 Ga0501035_0021289 3300049822 Bacteria 5961
179 Ga0501044_0022674 3300049823 Bacteria 6685
180 nmdc:mga00v17_82205_c1 3300050491 Bacteria 2012
181 nmdc:mga05p37_344815_c1 3300050507 Bacteria 1755
182 nmdc:mga06r32_1383580_c1 3300050510 Unclassified 646
183 nmdc:mga0a205_980338_c1 3300050515 Unclassified 692
184 Ga0495655_0075024 3300053083 Unclassified 954
185 Ga0500658_0025394 3300053134 Bacteria 2277
186 Ga0500568_0111705 3300053139 Bacteria 1021
187 Ga0501084_0554075 3300054114 Unclassified 971
188 Ga0501082_0007046 3300060353 Bacteria 9702
189 Ga0466962_0386665 3300061719 Bacteria 699
190 Ga0075428_100331807
191 Ga0068868_100229846
192 Ga0070668_100360292
193 Ga0070709_10960647
194 Ga0070714_100061785
195 Ga0070714_100388579
196 Ga0070713_100399277
197 Ga0070713_100645777
198 Ga0070700_100174789
199 Ga0070700_101146881
200 Ga0070678_101033025
201 Ga0070706_100054360
202 Ga0070707_100384234
203 Ga0070699_100351545
204 Ga0070684_100578691
205 Ga0070672_101054316
206 Ga0070693_100368210
207 Ga0068856_100132190
208 Ga0068859_102183872
209 Ga0068866_10396274
210 Ga0070717_10309438
211 Ga0070717_10650637
212 Ga0075363_100239299
213 Ga0075364_10112410
214 Ga0097620_102183866
215 Ga0105240_12013307
216 Ga0111539_10065478
217 Ga0111539_11522597
218 Ga0111539_11898217
219 Ga0105245_10213868
220 Ga0105245_10261046
221 Ga0105245_10277874
222 Ga0114129_10517929
223 Ga0105243_12109979
224 Ga0105242_11266133
225 Ga0105239_10370294
226 Ga0157374_11421499
227 Ga0163163_10868926
228 Ga0157380_10000037
229 Ga0207642_10070991
230 Ga0207684_10143505
231 Ga0207657_10421451
232 Ga0207649_10146464
233 Ga0207646_10407428
234 Ga0207646_10542192
235 Ga0207687_10235826
236 Ga0207690_10204274
237 Ga0207706_10767136
238 Ga0207686_10338753
239 Ga0207670_10801237
240 Ga0207691_10222006
241 Ga0207689_10627085
242 Ga0207661_10375245
243 Ga0207640_10775652
244 Ga0207658_10253557
245 Ga0207677_10096811
246 Ga0207677_10222058
247 Ga0207678_10253703
248 Ga0207708_10160728
249 Ga0207648_10662799
250 Ga0207674_10705508
251 Ga0207675_100035156
252 Ga0207675_100312407
253 Ga0207675_101923169
254 Ga0207683_10264474
255 Ga0265327_10026121
256 Ga0307410_10592931
257 Ga0307409_100117495
258 Ga0373944_0019006
259 Ga0373935_0256185
260 Ga0373935_0318559
261 Ga0373947_0012897
262 Ga0373947_0235540
263 Ga0373925_0039216
264 Ga0373925_1209585
265 Ga0395899_0118867
266 Ga0395899_0408639
267 Ga0395900_0122351
268 Ga0395900_0512177
269 Ga0395898_0042865
270 Ga0395898_0115534
271 Ga0395898_0189870
272 Ga0395898_0467353
273 Ga0395898_1049121
274 Ga0395905_0021900
275 Ga0395905_0121376
276 Ga0395905_0604133
277 Ga0395905_0618874
278 Ga0395905_1170819
279 Ga0436364_0142471
280 Ga0395901_0135219
281 Ga0395901_0554778
282 Ga0395901_0868321
283 Ga0395901_1201391
284 Ga0436365_0627314
285 Ga0436363_1613718
286 Ga0451804_0355989
287 Ga0466969_0003110
288 Ga0466965_0563296
289 Ga0466961_0172503
290 Ga0466961_0248630
291 Ga0466961_0466152
292 Ga0466961_0942195
293 Ga0466963_0021097
294 Ga0466963_0048952
295 Ga0466963_0049457
296 Ga0466963_0194017
297 Ga0466963_0233679
298 Ga0466963_0492639
299 Ga0466963_0656929
300 Ga0466971_0032163
301 Ga0466957_0545852
302 Ga0466960_0001497
303 Ga0466959_0034121
304 Ga0466959_0071491
305 Ga0466958_0043895
306 Ga0466958_0085725
307 Ga0466958_0258342
308 Ga0466967_0002863
309 Ga0466967_0031701
310 Ga0466967_0144890
311 Ga0495603_0249011
312 Ga0495603_0286367
313 Ga0495582_0105089
314 Ga0495605_0086280
315 Ga0495596_0045585
316 Ga0495644_0134768
317 Ga0495676_0186021
318 Ga0496101_0089354
319 Ga0496102_0011663
320 Ga0496103_0011787
321 Ga0496103_0057060
322 Ga0496104_0164284
323 Ga0496106_0110459
324 Ga0496107_0024286
325 Ga0496110_0074417
326 Ga0496110_0542262
327 Ga0496111_0083911
328 Ga0496111_0380413
329 Ga0496112_0122508
330 Ga0496112_0214636
331 Ga0496117_0005647
332 Ga0496117_0081685
333 Ga0496118_0000818
334 Ga0496118_0073501
335 Ga0496118_0298894
336 Ga0496119_0019868
337 Ga0496120_0024079
338 Ga0496121_0064466
339 Ga0496121_0230846
340 Ga0496121_0402252
341 Ga0496125_0053847
342 Ga0501031_0006831
343 Ga0501032_0016507
344 Ga0501033_0332247
345 Ga0501034_0055393
346 Ga0501036_0029410
347 Ga0501037_0073534
348 Ga0501038_0033396
349 Ga0501039_0045326
350 Ga0501043_0003920
351 Ga0501046_0002231
352 Ga0501047_0022808
353 Ga0501047_0223370
354 Ga0501048_0021445
355 Ga0501067_0007777
356 Ga0501069_0031873
357 Ga0501070_0381235
358 Ga0501071_0204725
359 Ga0501071_0623284
360 Ga0501072_0030548
361 Ga0501073_0002965
362 Ga0501074_0482714
363 Ga0501079_0271398
364 Ga0501080_0012929
365 Ga0501080_0120740
366 Ga0501083_0004342
367 Ga0501035_0021289
368 Ga0501044_0022674
369 nmdc:mga00v17_82205_c1
370 nmdc:mga05p37_344815_c1
371 nmdc:mga06r32_1383580_c1
372 nmdc:mga0a205_980338_c1
373 Ga0495655_0075024
374 Ga0500658_0025394
375 Ga0500568_0111705
376 Ga0501084_0554075
377 Ga0501082_0007046
378 Ga0466962_0386665

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

25

176

0.94

PF00149

Metallophos

Calcineurin-like phosphoesterase

25

106

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.8011 2 162
5osi-assembly3.cif.gz_G structure of retromer vps29-vps35c subunits complexed with ridl harpin loop (163-176) 0.7993 1 162
5xcj-assembly1.cif.gz_A crystal structure of vps29 single mutant (d62a) from entamoeba histolytica 0.788 1 162
6tl0-assembly1.cif.gz_A solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 0.788 2 162
5w8m-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7844 2 164
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9 1 161 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8891 1 161 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8402 1 162 3.60.21.10
af_Q5AB94_1_173_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8264 1 136 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8216 1 162 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7W0U729-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9871 27 162 GO:0016787
GO:0046872
AF-A0A538I762-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9819 2 164 GO:0016787
GO:0046872
AF-A0A538IJZ4-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9815 1 164 GO:0016787
GO:0046872
AF-A0A7W1HB53-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9814 3 112 GO:0016787
GO:0046872
AF-A0A7W1JVR0-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9811 2 162 GO:0016787
GO:0046872

Map