F290682

General Info

Members Datasets Scaffolds Average Seq Length
189 137 188 262

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100610448|Ga0068863_1006104482
Length 287
Sequence VLFLFICLKYLFDIKTEFKIFAVPEMIQAYNFLASWQLFPEKGIYEKGERPKSAIYKIEAANENKQLVISHHWVDLENYGFDSNYRILADGALNDFEKHELADQAQASFPDSISFEIHFYKKGEVVMHVIHEIMPNGYLKVTQQALKDDGNKYCNTEIYHKQLSVLPYSASVAGALIRPTEEGMIKHKALTAMEEQTNMQLNQIRKQIELLALQAQEIQKRKDLSLMIYNSKISFKPNIGQTYYLYEKNDDSYMLSLVSPNEWGSAGPFKKFIATVRLLADHTWMEL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
97 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
100 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
101 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
102 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
121 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
122 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
123 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
124 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
131 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
132 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
134 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
137 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 0
Rhizoplane 0
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 3.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1014621 3300002155 Bacteria 962
2 rootL2_10143886 3300003322 Bacteria 1416
3 rootL2_10280658 3300003322 Bacteria 2024
4 rootH1_10015224 3300003323 Bacteria 25733
5 Ga0065712_10001970 3300005290 Bacteria 7695
6 Ga0070676_10069916 3300005328 Bacteria 2105
7 Ga0070676_10396180 3300005328 Bacteria 959
8 Ga0070690_100014240 3300005330 Bacteria 4715
9 Ga0070670_100056333 3300005331 Bacteria 3373
10 Ga0068869_100011711 3300005334 Bacteria 5764
11 Ga0068869_100117962 3300005334 Bacteria 2026
12 Ga0068869_100157168 3300005334 Bacteria 1767
13 Ga0070682_100000060 3300005337 Bacteria 105136
14 Ga0070689_100556811 3300005340 Bacteria 989
15 Ga0070687_100051884 3300005343 Unclassified 2126
16 Ga0070687_100182201 3300005343 Bacteria 1259
17 Ga0070661_100052436 3300005344 Bacteria 2986
18 Ga0070668_100027619 3300005347 Bacteria 4309
19 Ga0070668_100057815 3300005347 Unclassified 2999
20 Ga0070669_100024003 3300005353 Bacteria 4369
21 Ga0070675_100001080 3300005354 Bacteria 19673
22 Ga0070671_100002422 3300005355 Bacteria 14421
23 Ga0070674_100063320 3300005356 Unclassified 2588
24 Ga0070674_100321734 3300005356 Bacteria 1240
25 Ga0070674_100436064 3300005356 Unclassified 1078
26 Ga0070673_100015691 3300005364 Bacteria 5329
27 Ga0070688_100005132 3300005365 Bacteria 6867
28 Ga0070659_100027999 3300005366 Bacteria 4347
29 Ga0070700_100037485 3300005441 Bacteria 2949
30 Ga0070662_100085071 3300005457 Bacteria 2363
31 Ga0068867_100084078 3300005459 Bacteria 2403
32 Ga0068867_100189367 3300005459 Bacteria 1641
33 Ga0070698_100101241 3300005471 Bacteria 2853
34 Ga0068853_100234997 3300005539 Bacteria 1678
35 Ga0068853_100835411 3300005539 Bacteria 883
36 Ga0070672_100129121 3300005543 Bacteria 2076
37 Ga0070686_100034475 3300005544 Bacteria 3119
38 Ga0070664_100069188 3300005564 Bacteria 3020
39 Ga0068857_100010473 3300005577 Bacteria 8059
40 Ga0068857_100090270 3300005577 Bacteria 2742
41 Ga0068857_100131412 3300005577 Bacteria 2258
42 Ga0070702_100084191 3300005615 Bacteria 1912
43 Ga0068852_100000811 3300005616 Bacteria 20584
44 Ga0068852_100511944 3300005616 Bacteria 1196
45 Ga0068859_100026306 3300005617 Bacteria 5833
46 Ga0068859_100803304 3300005617 Bacteria 1028
47 Ga0068866_10011165 3300005718 Bacteria 3876
48 Ga0068861_100267739 3300005719 Bacteria 1466
49 Ga0068861_100553751 3300005719 Unclassified 1048
50 Ga0068870_10004910 3300005840 Bacteria 5789
51 Ga0068863_100610448 3300005841 Unclassified 1080
52 Ga0068858_100540553 3300005842 Bacteria 1128
53 Ga0075366_10160878 3300006195 Bacteria 1361
54 Ga0075366_10374590 3300006195 Bacteria 875
55 Ga0097621_100300335 3300006237 Bacteria 1418
56 Ga0068871_100205390 3300006358 Bacteria 1702
57 Ga0097620_100026306 3300006931 Bacteria 5833
58 Ga0097620_100803363 3300006931 Bacteria 1028
59 Ga0111539_10008708 3300009094 Bacteria 12873
60 Ga0111539_10707053 3300009094 Bacteria 1173
61 Ga0105248_10748186 3300009177 Bacteria 1103
62 Ga0105237_10116291 3300009545 Bacteria 2668
63 Ga0105249_10001595 3300009553 Bacteria 19863
64 Ga0157373_10030605 3300013100 Unclassified 3873
65 Ga0157373_10285984 3300013100 Unclassified 1169
66 Ga0157371_10430387 3300013102 Unclassified 968
67 Ga0157370_10032729 3300013104 Bacteria 5075
68 Ga0157378_10000923 3300013297 Bacteria 27055
69 Ga0157378_10149756 3300013297 Unclassified 2173
70 Ga0163162_10814013 3300013306 Bacteria 1051
71 Ga0157372_10162934 3300013307 Unclassified 2578
72 Ga0157372_10254626 3300013307 Bacteria 2038
73 Ga0157372_10329570 3300013307 Bacteria 1778
74 Ga0157372_10630730 3300013307 Bacteria 1249
75 Ga0157375_10002993 3300013308 Bacteria 14676
76 Ga0157375_10423533 3300013308 Bacteria 1497
77 Ga0163163_10274341 3300014325 Bacteria 1737
78 Ga0157380_10037228 3300014326 Bacteria 3768
79 Ga0157380_10200332 3300014326 Bacteria 1771
80 Ga0157377_10001241 3300014745 Bacteria 10911
81 Ga0163161_10163715 3300017792 Bacteria 1697
82 Ga0163161_10323335 3300017792 Bacteria 1220
83 Ga0207688_10036094 3300025901 Bacteria 2740
84 Ga0207647_10006657 3300025904 Bacteria 8398
85 Ga0207645_10025678 3300025907 Bacteria 3811
86 Ga0207645_10068874 3300025907 Bacteria 2263
87 Ga0207671_10118167 3300025914 Bacteria 2024
88 Ga0207662_10041932 3300025918 Bacteria 2696
89 Ga0207662_10231097 3300025918 Bacteria 1208
90 Ga0207659_10110475 3300025926 Bacteria 2089
91 Ga0207659_10156226 3300025926 Bacteria 1786
92 Ga0207644_10031219 3300025931 Bacteria 3710
93 Ga0207690_10009184 3300025932 Bacteria 5869
94 Ga0207706_10189735 3300025933 Bacteria 1804
95 Ga0207670_10516205 3300025936 Bacteria 972
96 Ga0207669_10069424 3300025937 Bacteria 2205
97 Ga0207691_10227913 3300025940 Bacteria 1614
98 Ga0207691_10532874 3300025940 Bacteria 996
99 Ga0207689_10026003 3300025942 Bacteria 4901
100 Ga0207689_10035347 3300025942 Unclassified 4152
101 Ga0207689_10039238 3300025942 Bacteria 3921
102 Ga0207689_10678526 3300025942 Unclassified 868
103 Ga0207651_10020466 3300025960 Bacteria 3994
104 Ga0207651_10035923 3300025960 Bacteria 3229
105 Ga0207668_10092153 3300025972 Bacteria 2229
106 Ga0207668_10092222 3300025972 Bacteria 2229
107 Ga0207640_10053554 3300025981 Bacteria 2634
108 Ga0207639_10773008 3300026041 Bacteria 894
109 Ga0207708_10029692 3300026075 Bacteria 4144
110 Ga0207641_10603320 3300026088 Unclassified 1075
111 Ga0207648_10001588 3300026089 Bacteria 24911
112 Ga0207648_10211242 3300026089 Bacteria 1723
113 Ga0207648_10229517 3300026089 Bacteria 1651
114 Ga0207676_10307652 3300026095 Bacteria 1449
115 Ga0207674_10103276 3300026116 Bacteria 2830
116 Ga0207674_10127926 3300026116 Bacteria 2505
117 Ga0207675_100168857 3300026118 Bacteria 2090
118 Ga0207683_10109076 3300026121 Bacteria 2477
119 Ga0207698_10001170 3300026142 Bacteria 15290
120 Ga0209999_1003586 3300027543 Unclassified 2779
121 Ga0209974_10041935 3300027876 Bacteria 1524
122 Ga0268265_10057422 3300028380 Bacteria 2966
123 Ga0268264_10460764 3300028381 Bacteria 1233
124 Ga0307513_10312845 3300031456 Bacteria 1332
125 Ga0307413_10285715 3300031824 Unclassified 1243
126 Ga0307407_10121319 3300031903 Unclassified 1658
127 Ga0307416_100556274 3300032002 Unclassified 1221
128 Ga0307411_10093809 3300032005 Bacteria 2103
129 Ga0395900_0349596 3300037418 Bacteria 1452
130 Ga0395905_0002191 3300037471 Bacteria 22056
131 Ga0395905_0314972 3300037471 Bacteria 1454
132 Ga0439436_0004431 3300041404 Bacteria 4301
133 Ga0439439_0007422 3300041406 Bacteria 2565
134 Ga0451851_0713291 3300041507 Bacteria 1346
135 Ga0439442_007688 3300042002 Bacteria 2173
136 Ga0439449_0097257 3300042007 Bacteria 1088
137 Ga0439457_000014 3300042014 Bacteria 36364
138 Ga0439457_020579 3300042014 Bacteria 1464
139 Ga0439462_0004044 3300042015 Bacteria 3558
140 Ga0439462_0005476 3300042015 Unclassified 3130
141 Ga0450897_001827 3300042128 Unclassified 1512
142 Ga0450894_011735 3300042131 Unclassified 1142
143 Ga0439434_0020130 3300042435 Bacteria 2003
144 Ga0451577_0021710 3300042876 Bacteria 5871
145 Ga0451577_0124347 3300042876 Bacteria 2311
146 Ga0451577_0307377 3300042876 Bacteria 1437
147 Ga0453683_0085205 3300044673 Bacteria 1980
148 Ga0453683_0086151 3300044673 Bacteria 1968
149 Ga0453684_0019317 3300044712 Bacteria 10386
150 Ga0453684_0049592 3300044712 Bacteria 5534
151 Ga0453684_0060657 3300044712 Bacteria 4861
152 Ga0453684_0207122 3300044712 Bacteria 2282
153 Ga0466957_0001332 3300044842 Bacteria 12896
154 Ga0466957_0001834 3300044842 Bacteria 11215
155 Ga0451576_0009056 3300045051 Bacteria 11591
156 Ga0451576_0044939 3300045051 Bacteria 4654
157 Ga0495668_0005362 3300046616 Bacteria 8738
158 Ga0495611_0113891 3300046648 Bacteria 1260
159 Ga0495672_0024051 3300047320 Unclassified 3932
160 Ga0495686_0115983 3300047472 Unclassified 1601
161 Ga0501036_0033100 3300049572 Bacteria 4371
162 Ga0501037_0106427 3300049573 Bacteria 2021
163 Ga0501038_0024681 3300049574 Bacteria 5360
164 Ga0501039_0052073 3300049575 Bacteria 3167
165 Ga0501043_0059025 3300049579 Bacteria 3010
166 Ga0501046_0029486 3300049580 Bacteria 4460
167 Ga0501047_0055240 3300049581 Bacteria 3840
168 Ga0501047_0192536 3300049581 Bacteria 1902
169 Ga0501202_003845 3300049652 Bacteria 2593
170 Ga0501206_015962 3300049653 Bacteria 1042
171 Ga0501235_031348 3300049669 Unclassified 1200
172 Ga0501225_0000559 3300049705 Bacteria 11640
173 Ga0501245_004029 3300049708 Bacteria 2010
174 Ga0501080_0552717 3300049742 Bacteria 1025
175 Ga0501035_0026074 3300049822 Bacteria 5353
176 Ga0501044_0004343 3300049823 Bacteria 15878
177 nmdc:mga0k408_16119_c1 3300050493 Bacteria 4141
178 nmdc:mga0k408_173057_c1 3300050493 Unclassified 1287
179 nmdc:mga0k408_91200_c2 3300050493 Bacteria 1421
180 nmdc:mga08y16_9431_c1 3300050511 Bacteria 10235
181 Ga0500644_0055056 3300053088 Unclassified 1379
182 Ga0500641_0036456 3300053096 Bacteria 1967
183 Ga0500559_0044567 3300053136 Bacteria 1941
184 Ga0500568_0001817 3300053139 Bacteria 13149
185 Ga0500604_0025015 3300053151 Bacteria 1714
186 Ga0500616_0171297 3300053153 Unclassified 985
187 Ga0500611_000034 3300053727 Bacteria 78957
188 Ga0466962_0163022 3300061719 Bacteria 1084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10254626 Ga0157372_102546262 231
2 3300053139 Ga0500568_0001817 Ga0500568_0001817_9982_10767 249
3 3300042002 Ga0439442_007688 Ga0439442_007688_941_1729 250
4 3300042014 Ga0439457_020579 Ga0439457_020579_623_1411 250
5 3300042015 Ga0439462_0004044 Ga0439462_0004044_2091_2879 250
6 3300042128 Ga0450897_001827 Ga0450897_001827_119_907 250
7 3300042131 Ga0450894_011735 Ga0450894_011735_202_990 250
8 3300042435 Ga0439434_0020130 Ga0439434_0020130_308_1096 250
9 3300042876 Ga0451577_0124347 Ga0451577_0124347_607_1476 250
10 3300046648 Ga0495611_0113891 Ga0495611_0113891_410_1198 250
11 3300053096 Ga0500641_0036456 Ga0500641_0036456_448_1236 250
12 3300025926 Ga0207659_10156226 Ga0207659_101562262 251
13 3300049581 Ga0501047_0055240 Ga0501047_0055240_2013_2807 251
14 3300005328 Ga0070676_10069916 Ga0070676_100699161 257
15 3300005334 Ga0068869_100011711 Ga0068869_1000117116 257
16 3300005347 Ga0070668_100057815 Ga0070668_1000578152 257
17 3300005459 Ga0068867_100084078 Ga0068867_1000840781 257
18 3300005577 Ga0068857_100090270 Ga0068857_1000902703 257
19 3300005617 Ga0068859_100803304 Ga0068859_1008033041 257
20 3300005718 Ga0068866_10011165 Ga0068866_100111653 257
21 3300005719 Ga0068861_100267739 Ga0068861_1002677392 257
22 3300006931 Ga0097620_100803363 Ga0097620_1008033632 257
23 3300025907 Ga0207645_10068874 Ga0207645_100688743 257
24 3300025942 Ga0207689_10035347 Ga0207689_100353472 257
25 3300025942 Ga0207689_10678526 Ga0207689_106785261 257
26 3300025972 Ga0207668_10092222 Ga0207668_100922222 257
27 3300026089 Ga0207648_10001588 Ga0207648_100015888 257
28 3300026116 Ga0207674_10127926 Ga0207674_101279262 257
29 3300026118 Ga0207675_100168857 Ga0207675_1001688573 257
30 3300061719 Ga0466962_0163022 Ga0466962_0163022_259_1053 257
31 iso_pu_bacteria 2738541278 2738727781 258
32 3300044673 Ga0453683_0085205 Ga0453683_0085205_30_836 259
33 3300044712 Ga0453684_0207122 Ga0453684_0207122_66_872 259
34 3300045051 Ga0451576_0009056 Ga0451576_0009056_4777_5583 259
35 3300013307 Ga0157372_10329570 Ga0157372_103295702 261
36 3300013307 Ga0157372_10630730 Ga0157372_106307302 261
37 3300042876 Ga0451577_0021710 Ga0451577_0021710_2751_3536 261
38 3300044712 Ga0453684_0019317 Ga0453684_0019317_8647_9432 261
39 3300045051 Ga0451576_0044939 Ga0451576_0044939_1059_1844 261
40 3300047320 Ga0495672_0024051 Ga0495672_0024051_2373_3158 261
41 3300002155 JGI24033J26618_1014621 JGI24033J26618_10146211 262
42 3300003322 rootL2_10143886 rootL2_101438861 262
43 3300003322 rootL2_10280658 rootL2_102806581 262
44 3300003323 rootH1_10015224 rootH1_1001522423 262
45 3300005290 Ga0065712_10001970 Ga0065712_100019702 262
46 3300005328 Ga0070676_10396180 Ga0070676_103961801 262
47 3300005330 Ga0070690_100014240 Ga0070690_1000142406 262
48 3300005331 Ga0070670_100056333 Ga0070670_1000563332 262
49 3300005334 Ga0068869_100117962 Ga0068869_1001179622 262
50 3300005334 Ga0068869_100157168 Ga0068869_1001571683 262
51 3300005337 Ga0070682_100000060 Ga0070682_10000006019 262
52 3300005340 Ga0070689_100556811 Ga0070689_1005568111 262
53 3300005343 Ga0070687_100051884 Ga0070687_1000518841 262
54 3300005343 Ga0070687_100182201 Ga0070687_1001822012 262
55 3300005344 Ga0070661_100052436 Ga0070661_1000524363 262
56 3300005347 Ga0070668_100027619 Ga0070668_1000276194 262
57 3300005353 Ga0070669_100024003 Ga0070669_1000240035 262
58 3300005354 Ga0070675_100001080 Ga0070675_10000108015 262
59 3300005355 Ga0070671_100002422 Ga0070671_1000024223 262
60 3300005356 Ga0070674_100063320 Ga0070674_1000633204 262
61 3300005356 Ga0070674_100321734 Ga0070674_1003217342 262
62 3300005356 Ga0070674_100436064 Ga0070674_1004360642 262
63 3300005364 Ga0070673_100015691 Ga0070673_1000156915 262
64 3300005365 Ga0070688_100005132 Ga0070688_1000051327 262
65 3300005366 Ga0070659_100027999 Ga0070659_1000279994 262
66 3300005441 Ga0070700_100037485 Ga0070700_1000374853 262
67 3300005457 Ga0070662_100085071 Ga0070662_1000850713 262
68 3300005459 Ga0068867_100189367 Ga0068867_1001893672 262
69 3300005471 Ga0070698_100101241 Ga0070698_1001012414 262
70 3300005539 Ga0068853_100234997 Ga0068853_1002349972 262
71 3300005539 Ga0068853_100835411 Ga0068853_1008354111 262
72 3300005543 Ga0070672_100129121 Ga0070672_1001291213 262
73 3300005544 Ga0070686_100034475 Ga0070686_1000344751 262
74 3300005564 Ga0070664_100069188 Ga0070664_1000691882 262
75 3300005577 Ga0068857_100010473 Ga0068857_1000104732 262
76 3300005577 Ga0068857_100131412 Ga0068857_1001314122 262
77 3300005615 Ga0070702_100084191 Ga0070702_1000841911 262
78 3300005616 Ga0068852_100000811 Ga0068852_10000081120 262
79 3300005616 Ga0068852_100511944 Ga0068852_1005119441 262
80 3300005617 Ga0068859_100026306 Ga0068859_1000263064 262
81 3300005719 Ga0068861_100553751 Ga0068861_1005537511 262
82 3300005840 Ga0068870_10004910 Ga0068870_100049104 262
83 3300005841 Ga0068863_100610448 Ga0068863_1006104482 262
84 3300005842 Ga0068858_100540553 Ga0068858_1005405532 262
85 3300006195 Ga0075366_10160878 Ga0075366_101608781 262
86 3300006195 Ga0075366_10374590 Ga0075366_103745901 262
87 3300006237 Ga0097621_100300335 Ga0097621_1003003351 262
88 3300006358 Ga0068871_100205390 Ga0068871_1002053902 262
89 3300006931 Ga0097620_100026306 Ga0097620_1000263065 262
90 3300009094 Ga0111539_10008708 Ga0111539_100087088 262
91 3300009094 Ga0111539_10707053 Ga0111539_107070531 262
92 3300009177 Ga0105248_10748186 Ga0105248_107481862 262
93 3300009545 Ga0105237_10116291 Ga0105237_101162914 262
94 3300009553 Ga0105249_10001595 Ga0105249_100015956 262
95 3300013100 Ga0157373_10030605 Ga0157373_100306055 262
96 3300013100 Ga0157373_10285984 Ga0157373_102859842 262
97 3300013102 Ga0157371_10430387 Ga0157371_104303871 262
98 3300013104 Ga0157370_10032729 Ga0157370_100327295 262
99 3300013297 Ga0157378_10000923 Ga0157378_1000092313 262
100 3300013297 Ga0157378_10149756 Ga0157378_101497562 262
101 3300013306 Ga0163162_10814013 Ga0163162_108140131 262
102 3300013307 Ga0157372_10162934 Ga0157372_101629345 262
103 3300013308 Ga0157375_10002993 Ga0157375_100029935 262
104 3300013308 Ga0157375_10423533 Ga0157375_104235331 262
105 3300014325 Ga0163163_10274341 Ga0163163_102743411 262
106 3300014326 Ga0157380_10037228 Ga0157380_100372282 262
107 3300014326 Ga0157380_10200332 Ga0157380_102003321 262
108 3300014745 Ga0157377_10001241 Ga0157377_100012419 262
109 3300017792 Ga0163161_10163715 Ga0163161_101637151 262
110 3300017792 Ga0163161_10323335 Ga0163161_103233351 262
111 3300025901 Ga0207688_10036094 Ga0207688_100360943 262
112 3300025904 Ga0207647_10006657 Ga0207647_100066574 262
113 3300025907 Ga0207645_10025678 Ga0207645_100256784 262
114 3300025914 Ga0207671_10118167 Ga0207671_101181672 262
115 3300025918 Ga0207662_10041932 Ga0207662_100419323 262
116 3300025918 Ga0207662_10231097 Ga0207662_102310971 262
117 3300025926 Ga0207659_10110475 Ga0207659_101104753 262
118 3300025931 Ga0207644_10031219 Ga0207644_100312191 262
119 3300025932 Ga0207690_10009184 Ga0207690_100091845 262
120 3300025933 Ga0207706_10189735 Ga0207706_101897351 262
121 3300025936 Ga0207670_10516205 Ga0207670_105162051 262
122 3300025937 Ga0207669_10069424 Ga0207669_100694242 262
123 3300025940 Ga0207691_10227913 Ga0207691_102279132 262
124 3300025940 Ga0207691_10532874 Ga0207691_105328742 262
125 3300025942 Ga0207689_10026003 Ga0207689_100260034 262
126 3300025942 Ga0207689_10039238 Ga0207689_100392381 262
127 3300025960 Ga0207651_10020466 Ga0207651_100204664 262
128 3300025960 Ga0207651_10035923 Ga0207651_100359233 262
129 3300025972 Ga0207668_10092153 Ga0207668_100921533 262
130 3300025981 Ga0207640_10053554 Ga0207640_100535543 262
131 3300026041 Ga0207639_10773008 Ga0207639_107730081 262
132 3300026075 Ga0207708_10029692 Ga0207708_100296924 262
133 3300026088 Ga0207641_10603320 Ga0207641_106033202 262
134 3300026089 Ga0207648_10211242 Ga0207648_102112422 262
135 3300026089 Ga0207648_10229517 Ga0207648_102295172 262
136 3300026095 Ga0207676_10307652 Ga0207676_103076522 262
137 3300026116 Ga0207674_10103276 Ga0207674_101032763 262
138 3300026121 Ga0207683_10109076 Ga0207683_101090762 262
139 3300026142 Ga0207698_10001170 Ga0207698_1000117014 262
140 3300027543 Ga0209999_1003586 Ga0209999_10035863 262
141 3300027876 Ga0209974_10041935 Ga0209974_100419352 262
142 3300028380 Ga0268265_10057422 Ga0268265_100574223 262
143 3300028381 Ga0268264_10460764 Ga0268264_104607641 262
144 3300031456 Ga0307513_10312845 Ga0307513_103128452 262
145 3300031824 Ga0307413_10285715 Ga0307413_102857152 262
146 3300031903 Ga0307407_10121319 Ga0307407_101213192 262
147 3300032002 Ga0307416_100556274 Ga0307416_1005562742 262
148 3300032005 Ga0307411_10093809 Ga0307411_100938091 262
149 3300037418 Ga0395900_0349596 Ga0395900_0349596_203_991 262
150 3300037471 Ga0395905_0002191 Ga0395905_0002191_14423_15211 262
151 3300037471 Ga0395905_0314972 Ga0395905_0314972_548_1336 262
152 3300041404 Ga0439436_0004431 Ga0439436_0004431_456_1250 262
153 3300041406 Ga0439439_0007422 Ga0439439_0007422_1451_2245 262
154 3300041507 Ga0451851_0713291 Ga0451851_0713291_74_868 262
155 3300042007 Ga0439449_0097257 Ga0439449_0097257_252_1046 262
156 3300042014 Ga0439457_000014 Ga0439457_000014_6484_7278 262
157 3300042015 Ga0439462_0005476 Ga0439462_0005476_298_1092 262
158 3300042876 Ga0451577_0307377 Ga0451577_0307377_242_1036 262
159 3300044673 Ga0453683_0086151 Ga0453683_0086151_488_1276 262
160 3300044712 Ga0453684_0049592 Ga0453684_0049592_4350_5144 262
161 3300044712 Ga0453684_0060657 Ga0453684_0060657_92_880 262
162 3300044842 Ga0466957_0001332 Ga0466957_0001332_7551_8345 262
163 3300044842 Ga0466957_0001834 Ga0466957_0001834_10172_10966 262
164 3300046616 Ga0495668_0005362 Ga0495668_0005362_3140_3934 262
165 3300047472 Ga0495686_0115983 Ga0495686_0115983_413_1201 262
166 3300049572 Ga0501036_0033100 Ga0501036_0033100_337_1125 262
167 3300049573 Ga0501037_0106427 Ga0501037_0106427_183_971 262
168 3300049574 Ga0501038_0024681 Ga0501038_0024681_188_976 262
169 3300049575 Ga0501039_0052073 Ga0501039_0052073_1037_1825 262
170 3300049579 Ga0501043_0059025 Ga0501043_0059025_816_1604 262
171 3300049580 Ga0501046_0029486 Ga0501046_0029486_2811_3599 262
172 3300049581 Ga0501047_0192536 Ga0501047_0192536_1053_1841 262
173 3300049652 Ga0501202_003845 Ga0501202_003845_791_1579 262
174 3300049653 Ga0501206_015962 Ga0501206_015962_12_803 262
175 3300049669 Ga0501235_031348 Ga0501235_031348_326_1114 262
176 3300049705 Ga0501225_0000559 Ga0501225_0000559_4549_5343 262
177 3300049708 Ga0501245_004029 Ga0501245_004029_140_928 262
178 3300049742 Ga0501080_0552717 Ga0501080_0552717_47_835 262
179 3300049822 Ga0501035_0026074 Ga0501035_0026074_3284_4072 262
180 3300049823 Ga0501044_0004343 Ga0501044_0004343_13697_14485 262
181 3300050493 nmdc:mga0k408_16119_c1 nmdc:mga0k408_16119_c1_2638_3426 262
182 3300050493 nmdc:mga0k408_173057_c1 nmdc:mga0k408_173057_c1_416_1204 262
183 3300050493 nmdc:mga0k408_91200_c2 nmdc:mga0k408_91200_c2_552_1346 262
184 3300050511 nmdc:mga08y16_9431_c1 nmdc:mga08y16_9431_c1_7098_7886 262
185 3300053088 Ga0500644_0055056 Ga0500644_0055056_450_1244 262
186 3300053136 Ga0500559_0044567 Ga0500559_0044567_63_917 262
187 3300053151 Ga0500604_0025015 Ga0500604_0025015_15_809 262
188 3300053153 Ga0500616_0171297 Ga0500616_0171297_87_881 262
189 3300053727 Ga0500611_000034 Ga0500611_000034_21129_21917 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10504

DUF2452

Protein of unknown function (DUF2452)

183

287

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qvf-assembly2.cif.gz_C tt_c0855 competence pilin from thermus thermophilus hb27 0.8294 28 64
5iw9-assembly1.cif.gz_B structure of bacteriophage t4 gp25, sheath polymerization initiator 0.7901 29 63
6ru2-assembly1.cif.gz_A crystal structure of glucuronoyl esterase from cerrena unicolor 0.7468 31 70
6rv7-assembly1.cif.gz_A crystal structure of glucuronoyl esterase from cerrena unicolor inactive s270a variant in complex with the aldouronic acid uxxr 0.7363 26 70
3dwq-assembly1.cif.gz_D crystal structure of the a-subunit of the ab5 toxin from e. coli with neu5gc-2,3gal-1,3glcnac 0.7238 31 65
ID Description Score Start End Superfamily
af_P08372_33_104_3.30.1300.30 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.901 29 61 3.30.1300.30
af_A1A5V9_1_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7931 29 61 3.40.50.300
5iw9B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7901 29 63 3.10.450.40
af_A0A0R0KBM6_49_178_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.733 29 62 3.30.420.10
af_Q4DPA3_509_629_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.7276 102 127 3.40.1110.10
ID Description Score Start End GO Terms
AF-A0A2A4XTX6-F1-model_v4 Lipocalin-like domain-containing protein 0.9758 5 136
AF-A0A537HQX8-F1-model_v4 DUF2452 domain-containing protein 0.971 160 262
AF-A0A3C0R7A2-F1-model_v4 DUF2452 domain-containing protein 0.9668 182 262
AF-A0A3C1LF52-F1-model_v4 DUF2452 domain-containing protein 0.9643 192 262
AF-A0A537HQX8-F1-model_v4 DUF2452 domain-containing protein 0.953 160 262

Feature Viewer

pLDDT pTM Quality
80.97 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map