F290595

General Info

Members Datasets Scaffolds Average Seq Length
189 135 378 90

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100013080|Ga0070699_1000130807
Length 106
Sequence MRRRLRISLRSISARIRHVIRRRVVVHGLVQGVFFRDSTRRIAQRHGVAGWVANRPDGAVEAVFEGEVDAVERLVAFSREGPRGAQVESVEVIEEQPEGVTGFGVR

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
99 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
100 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
101 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.12
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 15.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100013080 3300005518 Bacteria 7151
2 JGI25407J50210_10005867 3300003373 Bacteria 3036
3 JGI25407J50210_10012009 3300003373 Bacteria 2218
4 Ga0070676_11107802 3300005328 Unclassified 598
5 Ga0070691_10807441 3300005341 Bacteria 572
6 Ga0070692_11327582 3300005345 Bacteria 517
7 Ga0070675_100095992 3300005354 Bacteria 2490
8 Ga0070675_100451229 3300005354 Bacteria 1153
9 Ga0070674_100005677 3300005356 Bacteria 7233
10 Ga0070659_100331897 3300005366 Bacteria 1273
11 Ga0070714_100083244 3300005435 Bacteria 2789
12 Ga0070710_11262371 3300005437 Unclassified 548
13 Ga0070711_101193362 3300005439 Bacteria 658
14 Ga0070700_100627242 3300005441 Bacteria 846
15 Ga0070708_100427231 3300005445 Bacteria 1250
16 Ga0070708_100552697 3300005445 Bacteria 1086
17 Ga0070678_100196718 3300005456 Bacteria 1661
18 Ga0068867_100940402 3300005459 Bacteria 780
19 Ga0070706_100011710 3300005467 Bacteria 8138
20 Ga0070707_100000876 3300005468 Bacteria 29832
21 Ga0070698_100179876 3300005471 Bacteria 2053
22 Ga0070699_100014218 3300005518 Bacteria 6847
23 Ga0070679_100363336 3300005530 Bacteria 1395
24 Ga0070679_101541099 3300005530 Bacteria 612
25 Ga0070697_100908038 3300005536 Bacteria 782
26 Ga0070696_101428693 3300005546 Unclassified 590
27 Ga0070665_101590333 3300005548 Bacteria 662
28 Ga0070704_101401565 3300005549 Bacteria 641
29 Ga0068870_10101436 3300005840 Bacteria 1627
30 Ga0081455_10119591 3300005937 Unclassified 2077
31 Ga0081538_10000024 3300005981 Bacteria 130974
32 Ga0081538_10028028 3300005981 Bacteria 3886
33 Ga0081538_10063475 3300005981 Bacteria 2097
34 Ga0081538_10065027 3300005981 Bacteria 2058
35 Ga0081538_10107323 3300005981 Bacteria 1383
36 Ga0081540_1001223 3300005983 Bacteria 22441
37 Ga0070717_10012551 3300006028 Bacteria 6463
38 Ga0075428_100061248 3300006844 Bacteria 4121
39 Ga0075430_100109726 3300006846 Bacteria 2301
40 Ga0075431_100041054 3300006847 Bacteria 4770
41 Ga0075431_100668145 3300006847 Bacteria 1018
42 Ga0075433_10055183 3300006852 Bacteria 3468
43 Ga0075433_11775441 3300006852 Unclassified 530
44 Ga0075434_100109878 3300006871 Bacteria 2767
45 Ga0075434_101053479 3300006871 Archaea 827
46 Ga0075429_100006550 3300006880 Bacteria 10083
47 Ga0075429_100995852 3300006880 Bacteria 733
48 Ga0068865_100416178 3300006881 Bacteria 1104
49 Ga0068865_100551123 3300006881 Bacteria 968
50 Ga0075436_100042874 3300006914 Bacteria 3120
51 Ga0075435_100861522 3300007076 Bacteria 790
52 Ga0111539_10080007 3300009094 Bacteria 3844
53 Ga0111539_11268688 3300009094 Bacteria 855
54 Ga0105245_10523419 3300009098 Bacteria 1205
55 Ga0114129_10005388 3300009147 Bacteria 18059
56 Ga0114129_10186415 3300009147 Bacteria 2819
57 Ga0114129_10198194 3300009147 Bacteria 2721
58 Ga0114129_10454346 3300009147 Unclassified 1680
59 Ga0114129_12060349 3300009147 Unclassified 689
60 Ga0114129_13478391 3300009147 Unclassified 504
61 Ga0105243_10230787 3300009148 Bacteria 1642
62 Ga0105242_10187463 3300009176 Bacteria 1829
63 Ga0105242_12304687 3300009176 Bacteria 585
64 Ga0105249_12598023 3300009553 Unclassified 579
65 Ga0105239_11614143 3300010375 Bacteria 750
66 Ga0105246_10537263 3300011119 Bacteria 999
67 Ga0163162_10459359 3300013306 Bacteria 1405
68 Ga0157372_10490787 3300013307 Bacteria 1432
69 Ga0163163_10677095 3300014325 Bacteria 1095
70 Ga0157376_10856839 3300014969 Bacteria 924
71 Ga0206354_10605129 3300020081 Bacteria 2012
72 Ga0206353_10797205 3300020082 Bacteria 1006
73 Ga0213873_10174517 3300021358 Bacteria 657
74 Ga0213875_10013742 3300021388 Bacteria 3965
75 Ga0207643_10114231 3300025908 Bacteria 1593
76 Ga0207684_10299995 3300025910 Bacteria 1385
77 Ga0207663_10698474 3300025916 Bacteria 803
78 Ga0207662_10446061 3300025918 Bacteria 884
79 Ga0207652_10212660 3300025921 Bacteria 1741
80 Ga0207646_10011476 3300025922 Bacteria 8579
81 Ga0207659_10521586 3300025926 Bacteria 1007
82 Ga0207659_10574200 3300025926 Unclassified 960
83 Ga0207687_11633912 3300025927 Bacteria 553
84 Ga0207664_10137365 3300025929 Bacteria 2064
85 Ga0207690_10743460 3300025932 Bacteria 808
86 Ga0207686_11478383 3300025934 Unclassified 560
87 Ga0207669_10059020 3300025937 Bacteria 2344
88 Ga0207669_10196208 3300025937 Bacteria 1461
89 Ga0207704_10018334 3300025938 Bacteria 3652
90 Ga0207704_11753629 3300025938 Bacteria 534
91 Ga0207665_11113130 3300025939 Bacteria 630
92 Ga0207651_10952537 3300025960 Unclassified 766
93 Ga0207712_10770111 3300025961 Bacteria 844
94 Ga0207712_11305784 3300025961 Unclassified 648
95 Ga0207668_10176720 3300025972 Bacteria 1680
96 Ga0207648_10923298 3300026089 Bacteria 816
97 Ga0207648_12115513 3300026089 Unclassified 524
98 Ga0207675_100985035 3300026118 Bacteria 861
99 Ga0207683_10254737 3300026121 Bacteria 1602
100 Ga0207428_10117239 3300027907 Bacteria 2044
101 Ga0268266_10868215 3300028379 Bacteria 872
102 Ga0307408_100677924 3300031548 Bacteria 924
103 Ga0307405_10024142 3300031731 Bacteria 3468
104 Ga0307413_10003837 3300031824 Bacteria 6417
105 Ga0307410_11285594 3300031852 Bacteria 639
106 Ga0307406_11044915 3300031901 Unclassified 703
107 Ga0307407_10066419 3300031903 Bacteria 2127
108 Ga0307409_100028862 3300031995 Bacteria 3961
109 Ga0307409_100583917 3300031995 Unclassified 1102
110 Ga0307416_100108493 3300032002 Bacteria 2439
111 Ga0307416_100118646 3300032002 Bacteria 2351
112 Ga0307416_102007272 3300032002 Bacteria 681
113 Ga0307416_102614448 3300032002 Bacteria 602
114 Ga0307414_10429539 3300032004 Bacteria 1154
115 Ga0307411_10024982 3300032005 Bacteria 3571
116 Ga0307411_10622827 3300032005 Bacteria 931
117 Ga0307415_100135465 3300032126 Bacteria 1872
118 Ga0307415_100540278 3300032126 Unclassified 1027
119 Ga0307415_100823744 3300032126 Bacteria 849
120 Ga0373946_0099357 3300035171 Bacteria 1302
121 Ga0373935_0103650 3300035692 Bacteria 1879
122 Ga0373947_0120851 3300035725 Bacteria 1664
123 Ga0395899_0796821 3300037312 Unclassified 584
124 Ga0395900_0100037 3300037418 Bacteria 2978
125 Ga0395900_0177412 3300037418 Unclassified 2166
126 Ga0395898_0019075 3300037466 Bacteria 6982
127 Ga0395898_0826964 3300037466 Unclassified 866
128 Ga0395898_1100755 3300037466 Bacteria 728
129 Ga0395905_0311437 3300037471 Bacteria 1463
130 Ga0395905_0848480 3300037471 Bacteria 816
131 Ga0436364_1442778 3300037853 Bacteria 4872
132 Ga0395901_0008730 3300038443 Bacteria 10243
133 Ga0395901_0022800 3300038443 Bacteria 6419
134 Ga0395901_0195702 3300038443 Bacteria 2120
135 Ga0436365_1160376 3300039437 Bacteria 4965
136 Ga0436362_0643635 3300039453 Bacteria 930
137 Ga0451835_0002915 3300041492 Bacteria 624
138 Ga0451839_0804328 3300041496 Bacteria 553
139 Ga0439457_011271 3300042014 Bacteria 2038
140 Ga0450918_022315 3300042531 Bacteria 1106
141 Ga0466960_0156493 3300044901 Bacteria 1221
142 Ga0466967_0033423 3300045976 Bacteria 4354
143 Ga0495603_0078837 3300046455 Bacteria 1931
144 Ga0495582_0008331 3300046473 Bacteria 5721
145 Ga0495616_0203568 3300046513 Bacteria 869
146 Ga0495630_0069005 3300046517 Bacteria 2659
147 Ga0495661_0142808 3300046665 Unclassified 1301
148 Ga0496100_1386874 3300048903 Bacteria 555
149 Ga0496102_1581204 3300048905 Unclassified 574
150 Ga0496106_1587400 3300048909 Bacteria 501
151 Ga0496110_0381947 3300048913 Bacteria 1284
152 Ga0501036_0899274 3300049572 Unclassified 727
153 Ga0501038_0788608 3300049574 Bacteria 707
154 Ga0501039_1446288 3300049575 Unclassified 529
155 Ga0501040_0222585 3300049576 Bacteria 1343
156 Ga0501040_0409866 3300049576 Bacteria 974
157 Ga0501042_0483122 3300049578 Bacteria 899
158 Ga0501042_0548354 3300049578 Bacteria 840
159 Ga0501042_1384348 3300049578 Unclassified 513
160 Ga0501067_0452398 3300049583 Bacteria 717
161 Ga0501069_0766585 3300049585 Archaea 584
162 Ga0501072_0588219 3300049588 Bacteria 878
163 Ga0501072_1030758 3300049588 Bacteria 641
164 Ga0501076_0639616 3300049592 Unclassified 878
165 Ga0501076_1139827 3300049592 Bacteria 642
166 Ga0501077_0869698 3300049593 Bacteria 580
167 Ga0501079_0921875 3300049741 Bacteria 688
168 Ga0501081_0852594 3300049743 Unclassified 686
169 Ga0501035_1057687 3300049822 Bacteria 636
170 Ga0501045_0539125 3300049824 Bacteria 866
171 nmdc:mga05p37_1275_c1 3300050507 Bacteria 29263
172 nmdc:mga05p37_141447_c1 3300050507 Bacteria 2948
173 nmdc:mga05p37_1439341_c1 3300050507 Bacteria 691
174 nmdc:mga05p37_515907_c1 3300050507 Bacteria 1368
175 nmdc:mga09592_75665_c1 3300050508 Bacteria 2863
176 nmdc:mga0qj67_1047868_c1 3300050509 Unclassified 638
177 nmdc:mga0qj67_1238614_c1 3300050509 Bacteria 579
178 nmdc:mga0qj67_70566_c1 3300050509 Bacteria 2787
179 nmdc:mga06r32_2085179_c1 3300050510 Unclassified 500
180 nmdc:mga06r32_32957_c1 3300050510 Bacteria 4878
181 nmdc:mga06r32_55927_c1 3300050510 Bacteria 3786
182 nmdc:mga08y16_1043224_c1 3300050511 Bacteria 795
183 nmdc:mga08y16_70219_c1 3300050511 Bacteria 3651
184 nmdc:mga0n895_21172_c1 3300050512 Bacteria 6077
185 nmdc:mga0n895_770009_c1 3300050512 Bacteria 954
186 nmdc:mga0rr50_47931_c1 3300050513 Bacteria 3155
187 nmdc:mga08x19_114756_c1 3300050514 Bacteria 1800
188 Ga0530510_0312724 3300061734 Bacteria 1177
189 Ga0530510_0838315 3300061734 Unclassified 702
190 Ga0070699_100013080
191 JGI25407J50210_10005867
192 JGI25407J50210_10012009
193 Ga0070676_11107802
194 Ga0070691_10807441
195 Ga0070692_11327582
196 Ga0070675_100095992
197 Ga0070675_100451229
198 Ga0070674_100005677
199 Ga0070659_100331897
200 Ga0070714_100083244
201 Ga0070710_11262371
202 Ga0070711_101193362
203 Ga0070700_100627242
204 Ga0070708_100427231
205 Ga0070708_100552697
206 Ga0070678_100196718
207 Ga0068867_100940402
208 Ga0070706_100011710
209 Ga0070707_100000876
210 Ga0070698_100179876
211 Ga0070699_100014218
212 Ga0070679_100363336
213 Ga0070679_101541099
214 Ga0070697_100908038
215 Ga0070696_101428693
216 Ga0070665_101590333
217 Ga0070704_101401565
218 Ga0068870_10101436
219 Ga0081455_10119591
220 Ga0081538_10000024
221 Ga0081538_10028028
222 Ga0081538_10063475
223 Ga0081538_10065027
224 Ga0081538_10107323
225 Ga0081540_1001223
226 Ga0070717_10012551
227 Ga0075428_100061248
228 Ga0075430_100109726
229 Ga0075431_100041054
230 Ga0075431_100668145
231 Ga0075433_10055183
232 Ga0075433_11775441
233 Ga0075434_100109878
234 Ga0075434_101053479
235 Ga0075429_100006550
236 Ga0075429_100995852
237 Ga0068865_100416178
238 Ga0068865_100551123
239 Ga0075436_100042874
240 Ga0075435_100861522
241 Ga0111539_10080007
242 Ga0111539_11268688
243 Ga0105245_10523419
244 Ga0114129_10005388
245 Ga0114129_10186415
246 Ga0114129_10198194
247 Ga0114129_10454346
248 Ga0114129_12060349
249 Ga0114129_13478391
250 Ga0105243_10230787
251 Ga0105242_10187463
252 Ga0105242_12304687
253 Ga0105249_12598023
254 Ga0105239_11614143
255 Ga0105246_10537263
256 Ga0163162_10459359
257 Ga0157372_10490787
258 Ga0163163_10677095
259 Ga0157376_10856839
260 Ga0206354_10605129
261 Ga0206353_10797205
262 Ga0213873_10174517
263 Ga0213875_10013742
264 Ga0207643_10114231
265 Ga0207684_10299995
266 Ga0207663_10698474
267 Ga0207662_10446061
268 Ga0207652_10212660
269 Ga0207646_10011476
270 Ga0207659_10521586
271 Ga0207659_10574200
272 Ga0207687_11633912
273 Ga0207664_10137365
274 Ga0207690_10743460
275 Ga0207686_11478383
276 Ga0207669_10059020
277 Ga0207669_10196208
278 Ga0207704_10018334
279 Ga0207704_11753629
280 Ga0207665_11113130
281 Ga0207651_10952537
282 Ga0207712_10770111
283 Ga0207712_11305784
284 Ga0207668_10176720
285 Ga0207648_10923298
286 Ga0207648_12115513
287 Ga0207675_100985035
288 Ga0207683_10254737
289 Ga0207428_10117239
290 Ga0268266_10868215
291 Ga0307408_100677924
292 Ga0307405_10024142
293 Ga0307413_10003837
294 Ga0307410_11285594
295 Ga0307406_11044915
296 Ga0307407_10066419
297 Ga0307409_100028862
298 Ga0307409_100583917
299 Ga0307416_100108493
300 Ga0307416_100118646
301 Ga0307416_102007272
302 Ga0307416_102614448
303 Ga0307414_10429539
304 Ga0307411_10024982
305 Ga0307411_10622827
306 Ga0307415_100135465
307 Ga0307415_100540278
308 Ga0307415_100823744
309 Ga0373946_0099357
310 Ga0373935_0103650
311 Ga0373947_0120851
312 Ga0395899_0796821
313 Ga0395900_0100037
314 Ga0395900_0177412
315 Ga0395898_0019075
316 Ga0395898_0826964
317 Ga0395898_1100755
318 Ga0395905_0311437
319 Ga0395905_0848480
320 Ga0436364_1442778
321 Ga0395901_0008730
322 Ga0395901_0022800
323 Ga0395901_0195702
324 Ga0436365_1160376
325 Ga0436362_0643635
326 Ga0451835_0002915
327 Ga0451839_0804328
328 Ga0439457_011271
329 Ga0450918_022315
330 Ga0466960_0156493
331 Ga0466967_0033423
332 Ga0495603_0078837
333 Ga0495582_0008331
334 Ga0495616_0203568
335 Ga0495630_0069005
336 Ga0495661_0142808
337 Ga0496100_1386874
338 Ga0496102_1581204
339 Ga0496106_1587400
340 Ga0496110_0381947
341 Ga0501036_0899274
342 Ga0501038_0788608
343 Ga0501039_1446288
344 Ga0501040_0222585
345 Ga0501040_0409866
346 Ga0501042_0483122
347 Ga0501042_0548354
348 Ga0501042_1384348
349 Ga0501067_0452398
350 Ga0501069_0766585
351 Ga0501072_0588219
352 Ga0501072_1030758
353 Ga0501076_0639616
354 Ga0501076_1139827
355 Ga0501077_0869698
356 Ga0501079_0921875
357 Ga0501081_0852594
358 Ga0501035_1057687
359 Ga0501045_0539125
360 nmdc:mga05p37_1275_c1
361 nmdc:mga05p37_141447_c1
362 nmdc:mga05p37_1439341_c1
363 nmdc:mga05p37_515907_c1
364 nmdc:mga09592_75665_c1
365 nmdc:mga0qj67_1047868_c1
366 nmdc:mga0qj67_1238614_c1
367 nmdc:mga0qj67_70566_c1
368 nmdc:mga06r32_2085179_c1
369 nmdc:mga06r32_32957_c1
370 nmdc:mga06r32_55927_c1
371 nmdc:mga08y16_1043224_c1
372 nmdc:mga08y16_70219_c1
373 nmdc:mga0n895_21172_c1
374 nmdc:mga0n895_770009_c1
375 nmdc:mga0rr50_47931_c1
376 nmdc:mga08x19_114756_c1
377 Ga0530510_0312724
378 Ga0530510_0838315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00708

Acylphosphatase

Acylphosphatase

22

105

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w4d-assembly1.cif.gz_B acylphosphatase variant g91a from pyrococcus horikoshii 0.9914 3 91
1v3z-assembly1.cif.gz_B crystal structure of acylphosphatase from pyrococcus horikoshii 0.9891 3 91
3tnv-assembly1.cif.gz_A acylphosphatase with thermophilic surface and mesophilic core 0.9857 3 91
4ojh-assembly2.cif.gz_B the crystal structure of truncated, y86e mutant of s. solfataricus acylphosphatase 0.984 3 91
1ulr-assembly1.cif.gz_A crystal structure of tt0497 from thermus thermophilus hb8 0.9786 6 91
ID Description Score Start End Superfamily
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9857 3 91 3.30.70.100
af_A4I1P4_95_208_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9827 3 79 3.30.70.100
2hltA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9775 5 91 3.30.70.100
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9643 3 91 3.30.70.100
3trgA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9625 4 91 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2G6YH50-F1-model_v4 deleted 1.007 5 91
AF-A0A2A3HR17-F1-model_v4 deleted 1.006 4 91
AF-A0A1C6NEZ1-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.005 5 91 GO:0003998
AF-A0A2N3G7A5-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.004 2 91 GO:0003998
AF-A0A538EEC3-F1-model_v4 acylphosphatase (EC 3.6.1.7) 1.003 1 91 GO:0003998

Map