F290397

General Info

Members Datasets Scaffolds Average Seq Length
189 120 378 134

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100525646|Ga0070670_1005256462
Length 157
Sequence MERYGAYPNIDTSLLQEVPWETFAVADREAIILFDGTCAFCEGSVKFIARRDPGRYFRFGASQSAQGARLLASHGLTREMTRSMVLIEDGQVFLRSTASLRIAGHLPYPWRLASVFIWVPRPIRDGVYRVVAAVRHRIAGKSNACEIPPPEIRERMI

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
51 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
63 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
64 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
65 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
66 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
67 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
68 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
69 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
70 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
71 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
91 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
96 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
97 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
117 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.41
Nodule 0
Rhizoplane 1.59
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 25.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100525646 3300005331 Bacteria 1054
2 Ga0070683_101312513 3300005329 Bacteria 695
3 Ga0070680_100110880 3300005336 Unclassified 2284
4 Ga0070689_100088913 3300005340 Bacteria 2432
5 Ga0070669_100279542 3300005353 Bacteria 1337
6 Ga0070669_100292714 3300005353 Unclassified 1308
7 Ga0070675_100052598 3300005354 Bacteria 3349
8 Ga0070675_100058589 3300005354 Bacteria 3177
9 Ga0070675_100113974 3300005354 Bacteria 2290
10 Ga0070675_100467159 3300005354 Bacteria 1133
11 Ga0070675_100530300 3300005354 Bacteria 1063
12 Ga0070674_100742576 3300005356 Bacteria 843
13 Ga0070673_100974997 3300005364 Unclassified 788
14 Ga0070700_100061241 3300005441 Unclassified 2374
15 Ga0070700_100428836 3300005441 Unclassified 1001
16 Ga0070694_100836368 3300005444 Unclassified 757
17 Ga0068867_100287534 3300005459 Unclassified 1350
18 Ga0068867_100791258 3300005459 Bacteria 845
19 Ga0070672_100798713 3300005543 Bacteria 830
20 Ga0070696_101264265 3300005546 Unclassified 625
21 Ga0068854_100514171 3300005578 Bacteria 1010
22 Ga0068854_100799800 3300005578 Bacteria 822
23 Ga0068864_100857590 3300005618 Bacteria 895
24 Ga0068864_101414445 3300005618 Unclassified 697
25 Ga0068870_10242666 3300005840 Bacteria 1113
26 Ga0068858_102065440 3300005842 Unclassified 563
27 Ga0068860_100518956 3300005843 Bacteria 1191
28 Ga0075368_10188249 3300006042 Bacteria 871
29 Ga0075364_10219478 3300006051 Bacteria 1290
30 Ga0075364_10687778 3300006051 Bacteria 698
31 Ga0075367_10016780 3300006178 Bacteria 4004
32 Ga0097621_100528772 3300006237 Bacteria 1071
33 Ga0075370_10317907 3300006353 Bacteria 927
34 Ga0075370_10466007 3300006353 Bacteria 761
35 Ga0075428_100003975 3300006844 Bacteria 16226
36 Ga0075434_100135484 3300006871 Bacteria 2482
37 Ga0075429_100476134 3300006880 Bacteria 1094
38 Ga0075436_100267457 3300006914 Bacteria 1220
39 Ga0111539_10050237 3300009094 Bacteria 4968
40 Ga0111539_10263012 3300009094 Unclassified 2008
41 Ga0111539_10337653 3300009094 Unclassified 1754
42 Ga0111539_10419868 3300009094 Bacteria 1558
43 Ga0111539_10488508 3300009094 Unclassified 1434
44 Ga0105245_10868395 3300009098 Bacteria 943
45 Ga0114129_10005889 3300009147 Bacteria 17362
46 Ga0114129_10254860 3300009147 Bacteria 2354
47 Ga0105242_10410727 3300009176 Bacteria 1266
48 Ga0105248_10162208 3300009177 Unclassified 2521
49 Ga0105248_10276230 3300009177 Bacteria 1891
50 Ga0105248_12573176 3300009177 Unclassified 580
51 Ga0105249_10799290 3300009553 Bacteria 1007
52 Ga0105249_12717170 3300009553 Bacteria 567
53 Ga0163162_10120150 3300013306 Bacteria 2731
54 Ga0157380_10016655 3300014326 Bacteria 5427
55 Ga0157380_10059691 3300014326 Bacteria 3045
56 Ga0157380_10086420 3300014326 Bacteria 2577
57 Ga0157380_10119912 3300014326 Bacteria 2226
58 Ga0157380_10159603 3300014326 Bacteria 1958
59 Ga0157380_10355457 3300014326 Unclassified 1372
60 Ga0157380_10388743 3300014326 Bacteria 1319
61 Ga0157380_10461314 3300014326 Unclassified 1223
62 Ga0157380_10964139 3300014326 Bacteria 884
63 Ga0157380_11213931 3300014326 Bacteria 798
64 Ga0157380_12253389 3300014326 Bacteria 609
65 Ga0157380_12370298 3300014326 Unclassified 596
66 Ga0157380_12872373 3300014326 Unclassified 548
67 Ga0157379_11821465 3300014968 Unclassified 598
68 Ga0207681_10126943 3300025923 Bacteria 1880
69 Ga0207681_10162953 3300025923 Unclassified 1683
70 Ga0207681_11400386 3300025923 Unclassified 587
71 Ga0207659_11228877 3300025926 Bacteria 644
72 Ga0207686_10154365 3300025934 Bacteria 1602
73 Ga0207670_10056014 3300025936 Bacteria 2667
74 Ga0207670_10905674 3300025936 Unclassified 739
75 Ga0207669_10307171 3300025937 Bacteria 1208
76 Ga0207669_11905883 3300025937 Bacteria 508
77 Ga0207691_10798673 3300025940 Bacteria 793
78 Ga0207711_10031148 3300025941 Bacteria 4501
79 Ga0207711_10209225 3300025941 Unclassified 1781
80 Ga0207661_10604160 3300025944 Unclassified 1007
81 Ga0207712_10178897 3300025961 Unclassified 1664
82 Ga0207708_10009219 3300026075 Bacteria 7305
83 Ga0207708_10353970 3300026075 Bacteria 1205
84 Ga0207708_10395230 3300026075 Unclassified 1142
85 Ga0207648_10331480 3300026089 Bacteria 1369
86 Ga0207676_10397083 3300026095 Bacteria 1288
87 Ga0207676_11346059 3300026095 Unclassified 709
88 Ga0207675_100205379 3300026118 Bacteria 1893
89 Ga0209813_10068041 3300027866 Bacteria 1152
90 Ga0209974_10262422 3300027876 Bacteria 653
91 Ga0207428_10003390 3300027907 Bacteria 15489
92 Ga0207428_10017398 3300027907 Bacteria 6171
93 Ga0207428_10085969 3300027907 Bacteria 2448
94 Ga0268265_11679132 3300028380 Bacteria 641
95 Ga0307408_101126978 3300031548 Unclassified 729
96 Ga0307405_10479472 3300031731 Bacteria 993
97 Ga0307413_10282019 3300031824 Bacteria 1250
98 Ga0307413_10507919 3300031824 Unclassified 969
99 Ga0307410_10163926 3300031852 Unclassified 1668
100 Ga0307416_102647361 3300032002 Bacteria 599
101 Ga0307416_102994408 3300032002 Unclassified 565
102 Ga0307411_10289310 3300032005 Bacteria 1308
103 Ga0307415_100951829 3300032126 Bacteria 795
104 Ga0373933_0656785 3300035724 Bacteria 689
105 Ga0439439_0175746 3300041406 Unclassified 615
106 Ga0451789_1048740 3300041443 Bacteria 678
107 Ga0451839_1089230 3300041496 Unclassified 889
108 Ga0439431_0190858 3300041997 Unclassified 594
109 Ga0439441_058222 3300042001 Bacteria 809
110 Ga0439462_0055759 3300042015 Unclassified 1066
111 Ga0450923_114773 3300042125 Bacteria 631
112 Ga0439446_0017826 3300042156 Bacteria 1986
113 Ga0450908_032532 3300042184 Unclassified 905
114 Ga0439444_0019247 3300042437 Unclassified 1189
115 Ga0451576_1702971 3300045051 Unclassified 653
116 Ga0495638_0027498 3300046460 Bacteria 3681
117 Ga0495586_0737912 3300046535 Bacteria 568
118 Ga0495672_0043797 3300047320 Bacteria 2689
119 Ga0496105_0801100 3300048908 Unclassified 716
120 Ga0496114_0222766 3300048917 Bacteria 1656
121 Ga0501032_0004443 3300049569 Bacteria 10572
122 Ga0501033_0169466 3300049570 Bacteria 1568
123 Ga0501034_0069240 3300049571 Bacteria 3539
124 Ga0501036_0001303 3300049572 Bacteria 19110
125 Ga0501036_0057237 3300049572 Bacteria 3302
126 Ga0501037_0054707 3300049573 Bacteria 2918
127 Ga0501037_0517990 3300049573 Unclassified 807
128 Ga0501038_0071987 3300049574 Bacteria 2930
129 Ga0501038_1137238 3300049574 Unclassified 569
130 Ga0501039_0048965 3300049575 Bacteria 3267
131 Ga0501041_0744057 3300049577 Bacteria 628
132 Ga0501042_0026243 3300049578 Bacteria 4095
133 Ga0501042_0079184 3300049578 Bacteria 2354
134 Ga0501042_0317452 3300049578 Bacteria 1126
135 Ga0501043_0016530 3300049579 Bacteria 5783
136 Ga0501046_0003241 3300049580 Bacteria 14957
137 Ga0501048_0010439 3300049582 Bacteria 6935
138 Ga0501048_0108138 3300049582 Unclassified 1963
139 Ga0501068_0002507 3300049584 Bacteria 9752
140 Ga0501069_0003145 3300049585 Bacteria 8461
141 Ga0501069_0442496 3300049585 Bacteria 772
142 Ga0501070_0069367 3300049586 Bacteria 2918
143 Ga0501071_0032588 3300049587 Bacteria 3701
144 Ga0501071_0701069 3300049587 Bacteria 779
145 Ga0501073_0006658 3300049589 Bacteria 8605
146 Ga0501073_0007408 3300049589 Bacteria 8154
147 Ga0501073_0493631 3300049589 Bacteria 847
148 Ga0501074_0004959 3300049590 Bacteria 9538
149 Ga0501074_0036262 3300049590 Unclassified 3573
150 Ga0501074_0284784 3300049590 Bacteria 1175
151 Ga0501074_0401577 3300049590 Bacteria 972
152 Ga0501074_0476770 3300049590 Bacteria 884
153 Ga0501074_0492131 3300049590 Bacteria 869
154 Ga0501075_0070215 3300049591 Bacteria 2647
155 Ga0501076_0071753 3300049592 Bacteria 2771
156 Ga0501076_0182305 3300049592 Bacteria 1712
157 Ga0501077_0170847 3300049593 Bacteria 1381
158 Ga0501079_0027994 3300049741 Bacteria 4323
159 Ga0501079_1614169 3300049741 Bacteria 510
160 Ga0501080_0240739 3300049742 Unclassified 1651
161 Ga0501080_0285099 3300049742 Bacteria 1501
162 Ga0501080_1023134 3300049742 Bacteria 716
163 Ga0501081_0052574 3300049743 Bacteria 2812
164 Ga0501035_0074468 3300049822 Bacteria 3003
165 Ga0501044_0239511 3300049823 Bacteria 1758
166 Ga0501045_0077683 3300049824 Bacteria 2446
167 Ga0501045_0216343 3300049824 Bacteria 1427
168 nmdc:mga00v17_579029_c1 3300050491 Unclassified 725
169 nmdc:mga0k408_447290_c1 3300050493 Unclassified 767
170 nmdc:mga06z11_85029_c1 3300050494 Bacteria 1706
171 nmdc:mga04h51_68255_c1 3300050495 Bacteria 1235
172 nmdc:mga07m45_796600_c1 3300050496 Unclassified 542
173 nmdc:mga05p37_333788_c1 3300050507 Unclassified 1790
174 nmdc:mga09592_1011245_c1 3300050508 Bacteria 694
175 nmdc:mga09592_166362_c1 3300050508 Bacteria 1906
176 nmdc:mga08y16_10247_c1 3300050511 Bacteria 9836
177 nmdc:mga08y16_17702_c1 3300050511 Bacteria 7505
178 nmdc:mga08y16_39700_c1 3300050511 Bacteria 4937
179 nmdc:mga0n895_844724_c1 3300050512 Bacteria 904
180 nmdc:mga08x19_687729_c1 3300050514 Bacteria 726
181 Ga0495595_0101035 3300053084 Bacteria 1392
182 Ga0500641_0008483 3300053096 Bacteria 3669
183 Ga0500568_0002642 3300053139 Bacteria 10406
184 Ga0501084_0237936 3300054114 Bacteria 1537
185 Ga0501084_0702162 3300054114 Bacteria 853
186 Ga0501082_0005362 3300060353 Bacteria 11126
187 Ga0501082_0117010 3300060353 Bacteria 2309
188 Ga0501082_0687823 3300060353 Bacteria 895
189 Ga0530510_0351746 3300061734 Bacteria 1107
190 Ga0070670_100525646
191 Ga0070683_101312513
192 Ga0070680_100110880
193 Ga0070689_100088913
194 Ga0070669_100279542
195 Ga0070669_100292714
196 Ga0070675_100052598
197 Ga0070675_100058589
198 Ga0070675_100113974
199 Ga0070675_100467159
200 Ga0070675_100530300
201 Ga0070674_100742576
202 Ga0070673_100974997
203 Ga0070700_100061241
204 Ga0070700_100428836
205 Ga0070694_100836368
206 Ga0068867_100287534
207 Ga0068867_100791258
208 Ga0070672_100798713
209 Ga0070696_101264265
210 Ga0068854_100514171
211 Ga0068854_100799800
212 Ga0068864_100857590
213 Ga0068864_101414445
214 Ga0068870_10242666
215 Ga0068858_102065440
216 Ga0068860_100518956
217 Ga0075368_10188249
218 Ga0075364_10219478
219 Ga0075364_10687778
220 Ga0075367_10016780
221 Ga0097621_100528772
222 Ga0075370_10317907
223 Ga0075370_10466007
224 Ga0075428_100003975
225 Ga0075434_100135484
226 Ga0075429_100476134
227 Ga0075436_100267457
228 Ga0111539_10050237
229 Ga0111539_10263012
230 Ga0111539_10337653
231 Ga0111539_10419868
232 Ga0111539_10488508
233 Ga0105245_10868395
234 Ga0114129_10005889
235 Ga0114129_10254860
236 Ga0105242_10410727
237 Ga0105248_10162208
238 Ga0105248_10276230
239 Ga0105248_12573176
240 Ga0105249_10799290
241 Ga0105249_12717170
242 Ga0163162_10120150
243 Ga0157380_10016655
244 Ga0157380_10059691
245 Ga0157380_10086420
246 Ga0157380_10119912
247 Ga0157380_10159603
248 Ga0157380_10355457
249 Ga0157380_10388743
250 Ga0157380_10461314
251 Ga0157380_10964139
252 Ga0157380_11213931
253 Ga0157380_12253389
254 Ga0157380_12370298
255 Ga0157380_12872373
256 Ga0157379_11821465
257 Ga0207681_10126943
258 Ga0207681_10162953
259 Ga0207681_11400386
260 Ga0207659_11228877
261 Ga0207686_10154365
262 Ga0207670_10056014
263 Ga0207670_10905674
264 Ga0207669_10307171
265 Ga0207669_11905883
266 Ga0207691_10798673
267 Ga0207711_10031148
268 Ga0207711_10209225
269 Ga0207661_10604160
270 Ga0207712_10178897
271 Ga0207708_10009219
272 Ga0207708_10353970
273 Ga0207708_10395230
274 Ga0207648_10331480
275 Ga0207676_10397083
276 Ga0207676_11346059
277 Ga0207675_100205379
278 Ga0209813_10068041
279 Ga0209974_10262422
280 Ga0207428_10003390
281 Ga0207428_10017398
282 Ga0207428_10085969
283 Ga0268265_11679132
284 Ga0307408_101126978
285 Ga0307405_10479472
286 Ga0307413_10282019
287 Ga0307413_10507919
288 Ga0307410_10163926
289 Ga0307416_102647361
290 Ga0307416_102994408
291 Ga0307411_10289310
292 Ga0307415_100951829
293 Ga0373933_0656785
294 Ga0439439_0175746
295 Ga0451789_1048740
296 Ga0451839_1089230
297 Ga0439431_0190858
298 Ga0439441_058222
299 Ga0439462_0055759
300 Ga0450923_114773
301 Ga0439446_0017826
302 Ga0450908_032532
303 Ga0439444_0019247
304 Ga0451576_1702971
305 Ga0495638_0027498
306 Ga0495586_0737912
307 Ga0495672_0043797
308 Ga0496105_0801100
309 Ga0496114_0222766
310 Ga0501032_0004443
311 Ga0501033_0169466
312 Ga0501034_0069240
313 Ga0501036_0001303
314 Ga0501036_0057237
315 Ga0501037_0054707
316 Ga0501037_0517990
317 Ga0501038_0071987
318 Ga0501038_1137238
319 Ga0501039_0048965
320 Ga0501041_0744057
321 Ga0501042_0026243
322 Ga0501042_0079184
323 Ga0501042_0317452
324 Ga0501043_0016530
325 Ga0501046_0003241
326 Ga0501048_0010439
327 Ga0501048_0108138
328 Ga0501068_0002507
329 Ga0501069_0003145
330 Ga0501069_0442496
331 Ga0501070_0069367
332 Ga0501071_0032588
333 Ga0501071_0701069
334 Ga0501073_0006658
335 Ga0501073_0007408
336 Ga0501073_0493631
337 Ga0501074_0004959
338 Ga0501074_0036262
339 Ga0501074_0284784
340 Ga0501074_0401577
341 Ga0501074_0476770
342 Ga0501074_0492131
343 Ga0501075_0070215
344 Ga0501076_0071753
345 Ga0501076_0182305
346 Ga0501077_0170847
347 Ga0501079_0027994
348 Ga0501079_1614169
349 Ga0501080_0240739
350 Ga0501080_0285099
351 Ga0501080_1023134
352 Ga0501081_0052574
353 Ga0501035_0074468
354 Ga0501044_0239511
355 Ga0501045_0077683
356 Ga0501045_0216343
357 nmdc:mga00v17_579029_c1
358 nmdc:mga0k408_447290_c1
359 nmdc:mga06z11_85029_c1
360 nmdc:mga04h51_68255_c1
361 nmdc:mga07m45_796600_c1
362 nmdc:mga05p37_333788_c1
363 nmdc:mga09592_1011245_c1
364 nmdc:mga09592_166362_c1
365 nmdc:mga08y16_10247_c1
366 nmdc:mga08y16_17702_c1
367 nmdc:mga08y16_39700_c1
368 nmdc:mga0n895_844724_c1
369 nmdc:mga08x19_687729_c1
370 Ga0495595_0101035
371 Ga0500641_0008483
372 Ga0500568_0002642
373 Ga0501084_0237936
374 Ga0501084_0702162
375 Ga0501082_0005362
376 Ga0501082_0117010
377 Ga0501082_0687823
378 Ga0530510_0351746

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04134

DCC1-like

DCC1-like thiol-disulfide oxidoreductase

32

141

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ju5-assembly1.cif.gz_B crystal structure of the dimeric form of the bb' domains of human protein disulfide isomerase 0.6433 8 67
3grx-assembly1.cif.gz_A nmr structure of escherichia coli glutaredoxin 3-glutathione mixed disulfide complex, 20 structures 0.6327 8 84
5lkd-assembly1.cif.gz_B crystal structure of the xi glutathione transferase ecm4 from saccharomyces cerevisiae in complex with glutathione 0.6045 4 40
4fqu-assembly4.cif.gz_H-2 glutathionyl-hydroquinone reductase pcpf of sphingobium chlorophenolicum 0.5857 5 40
4pur-assembly1.cif.gz_A crystal structure of mgla from francisella tularensis 0.5841 9 116
ID Description Score Start End Superfamily
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9391 12 119 3.40.30.10
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9379 12 119 3.40.30.10
af_Q54M17_35_145_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9057 12 119 3.40.30.10
af_A0A0R0FU59_17_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.902 15 120 3.40.30.10
af_Q9LR85_76_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8995 12 119 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V9LJ50-F1-model_v4 DUF393 domain-containing protein 0.9503 9 86 GO:0015035
AF-A0A1I6PI95-F1-model_v4 Predicted thiol-disulfide oxidoreductase YuxK, DCC family 0.9438 8 136 GO:0015035
AF-A0A0D8J8E9-F1-model_v4 Thiol-disulfide oxidoreductase 0.9438 6 121 GO:0015035
AF-A0A7Z8YQB4-F1-model_v4 Protein of uncharacterized function, DUF393 0.9407 8 117 GO:0015035
AF-A0A0W1AVL1-F1-model_v4 Thiol-disulfide oxidoreductase DCC 0.9392 6 136 GO:0015035

Map