F290309

General Info

Members Datasets Scaffolds Average Seq Length
189 129 184 201

Family's Representative Sequence

Representative Sequence 3300004801|Ga0058860_11785091|Ga0058860_117850912
Length 221
Sequence LFARAAGCLEQAFHPAGDLLTENSDVMPTEVDAEHVTSAARPDQFPAESLPEIAFLGRSNVGKSSLLNCLTGKKGLAFTSSKPGCTQLINFFRINGEMFFVDLPGYGFARVPLEVKARWKSLIESYLLKRNTLTTAVVLIDSRRGWMEPDLELKSWLEFQRIPYLVVATKIDKLNQKEQHRNLNSIAKELSGSELFPFSAVTGRGAREIWQAISKTKKLRQ

Samples

Sample ID Description Type Environment
1 2738543010 Bacillus sp. YR335 Isolate Unclassified
2 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
3 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
90 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
91 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
92 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
120 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
121 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
122 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
128 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
129 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.42
Metatranscriptomes 7.94
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 1.59
Nodule 0.53
Rhizoplane 2.12
Rhizosphere 72.49
Stem 0
Stem Tuber 0
Unclassified 22.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006777J48905_1095125 3300003308 Unclassified 973
2 JGI25405J52794_10023715 3300003911 Bacteria 1250
3 Ga0058861_11576545 3300004800 Bacteria 1397
4 Ga0058860_11785091 3300004801 Bacteria 1136
5 Ga0058862_12741148 3300004803 Unclassified 1048
6 Ga0070683_100096141 3300005329 Bacteria 2786
7 Ga0068869_100448580 3300005334 Unclassified 1069
8 Ga0070680_100102690 3300005336 Bacteria 2375
9 Ga0070661_100040640 3300005344 Bacteria 3394
10 Ga0070661_100343942 3300005344 Bacteria 1169
11 Ga0070659_100094493 3300005366 Bacteria 2401
12 Ga0070714_100254496 3300005435 Bacteria 1625
13 Ga0070711_100445921 3300005439 Bacteria 1059
14 Ga0070681_10018233 3300005458 Bacteria 7015
15 Ga0070684_100231533 3300005535 Bacteria 1687
16 Ga0070697_100327481 3300005536 Bacteria 1320
17 Ga0070697_100847709 3300005536 Unclassified 809
18 Ga0068853_100037586 3300005539 Bacteria 4119
19 Ga0068855_100031831 3300005563 Bacteria 6297
20 Ga0068856_100002503 3300005614 Bacteria 18908
21 Ga0068856_100058716 3300005614 Bacteria 3800
22 Ga0068856_100096999 3300005614 Bacteria 2937
23 Ga0068856_100610277 3300005614 Bacteria 1112
24 Ga0068852_100649857 3300005616 Bacteria 1062
25 Ga0068863_100329788 3300005841 Bacteria 1484
26 Ga0068858_100446643 3300005842 Bacteria 1246
27 Ga0081455_10006093 3300005937 Bacteria 13042
28 Ga0081455_10125467 3300005937 Bacteria 2015
29 Ga0081539_10060896 3300005985 Bacteria 2070
30 Ga0070717_10199489 3300006028 Bacteria 1752
31 Ga0068871_100700151 3300006358 Bacteria 928
32 Ga0068871_100750058 3300006358 Unclassified 897
33 Ga0075430_100115244 3300006846 Bacteria 2239
34 Ga0075430_100149291 3300006846 Bacteria 1946
35 Ga0075433_10162377 3300006852 Bacteria 1988
36 Ga0075429_100068694 3300006880 Bacteria 3084
37 Ga0105240_10026134 3300009093 Bacteria 7661
38 Ga0105241_10067150 3300009174 Bacteria 2775
39 Ga0105237_10721557 3300009545 Bacteria 1003
40 Ga0105238_10011617 3300009551 Bacteria 8870
41 Ga0105239_10954136 3300010375 Bacteria 985
42 Ga0157373_10511175 3300013100 Bacteria 868
43 Ga0157371_10023466 3300013102 Bacteria 4511
44 Ga0157370_10044809 3300013104 Bacteria 4248
45 Ga0157370_10570844 3300013104 Bacteria 1036
46 Ga0157369_10027527 3300013105 Bacteria 6300
47 Ga0157369_10035507 3300013105 Bacteria 5465
48 Ga0157369_10115647 3300013105 Bacteria 2849
49 Ga0157369_10194290 3300013105 Bacteria 2132
50 Ga0157369_10247172 3300013105 Bacteria 1862
51 Ga0157374_10001249 3300013296 Bacteria 21701
52 Ga0157374_10034693 3300013296 Bacteria 4611
53 Ga0157378_10595065 3300013297 Bacteria 1116
54 Ga0157372_10231836 3300013307 Bacteria 2141
55 Ga0157372_10657194 3300013307 Bacteria 1221
56 Ga0157372_11034365 3300013307 Unclassified 951
57 Ga0163163_11462312 3300014325 Bacteria 745
58 Ga0157380_11289880 3300014326 Bacteria 777
59 Ga0157379_10263027 3300014968 Bacteria 1568
60 Ga0157376_10029690 3300014969 Bacteria 4357
61 Ga0206349_1188575 3300020075 Bacteria 3851
62 Ga0206350_10825619 3300020080 Bacteria 1018
63 Ga0206353_11281317 3300020082 Unclassified 1314
64 Ga0213876_10013157 3300021384 Bacteria 4397
65 Ga0213876_10219844 3300021384 Bacteria 1010
66 Ga0213876_10335254 3300021384 Unclassified 804
67 Ga0213875_10000005 3300021388 Bacteria 595146
68 Ga0213875_10000027 3300021388 Bacteria 190420
69 Ga0213875_10000796 3300021388 Bacteria 23564
70 Ga0213875_10001193 3300021388 Bacteria 17776
71 Ga0213875_10026387 3300021388 Bacteria 2763
72 Ga0213875_10152161 3300021388 Unclassified 1084
73 Ga0213871_10000665 3300021441 Bacteria 4953
74 Ga0207699_10172095 3300025906 Bacteria 1449
75 Ga0207707_10063118 3300025912 Bacteria 3224
76 Ga0207695_10677971 3300025913 Bacteria 912
77 Ga0207671_10771337 3300025914 Bacteria 763
78 Ga0207663_10452815 3300025916 Bacteria 990
79 Ga0207660_10130017 3300025917 Unclassified 1916
80 Ga0207657_10124933 3300025919 Bacteria 2114
81 Ga0207649_10497413 3300025920 Bacteria 927
82 Ga0207652_10156929 3300025921 Bacteria 2039
83 Ga0207694_10113812 3300025924 Bacteria 2154
84 Ga0207700_10203896 3300025928 Bacteria 1668
85 Ga0207664_10217720 3300025929 Bacteria 1655
86 Ga0207706_10202161 3300025933 Bacteria 1743
87 Ga0207661_10371862 3300025944 Unclassified 1292
88 Ga0207667_10022557 3300025949 Bacteria 6950
89 Ga0207667_10700194 3300025949 Bacteria 1015
90 Ga0207639_10023876 3300026041 Bacteria 4419
91 Ga0207678_10449773 3300026067 Bacteria 1119
92 Ga0207702_10009586 3300026078 Bacteria 8129
93 Ga0207702_10071744 3300026078 Bacteria 2983
94 Ga0207702_10077377 3300026078 Bacteria 2877
95 Ga0207702_10627306 3300026078 Bacteria 1056
96 Ga0207641_10176303 3300026088 Bacteria 1955
97 Ga0207676_10349037 3300026095 Bacteria 1368
98 Ga0207428_10001374 3300027907 Bacteria 25780
99 Ga0268266_10482197 3300028379 Bacteria 1182
100 Ga0268266_11254420 3300028379 Unclassified 716
101 Ga0316577_10000181 3300031733 Bacteria 20471
102 Ga0307414_11115619 3300032004 Unclassified 729
103 Ga0373945_0086938 3300035116 Bacteria 1205
104 Ga0373953_0248988 3300035117 Unclassified 772
105 Ga0373943_0550386 3300035170 Unclassified 677
106 Ga0373935_0013280 3300035692 Bacteria 4969
107 Ga0373935_0034257 3300035692 Bacteria 3165
108 Ga0373947_0196957 3300035725 Bacteria 1317
109 Ga0373937_0012682 3300036401 Bacteria 7416
110 Ga0316584_0094249 3300036712 Bacteria 2242
111 Ga0373925_0110620 3300037068 Bacteria 2122
112 Ga0395900_0226084 3300037418 Bacteria 1884
113 Ga0395905_0934546 3300037471 Bacteria 770
114 Ga0436364_0025760 3300037853 Bacteria 3320
115 Ga0436364_0191556 3300037853 Bacteria 908
116 Ga0436364_0301698 3300037853 Bacteria 10821
117 Ga0436364_0317618 3300037853 Bacteria 89116
118 Ga0436364_0446012 3300037853 Bacteria 193523
119 Ga0436364_0493035 3300037853 Bacteria 35512
120 Ga0436364_0548583 3300037853 Unclassified 895
121 Ga0436364_0760276 3300037853 Bacteria 1321
122 Ga0436364_0761948 3300037853 Bacteria 2031
123 Ga0436364_0794010 3300037853 Bacteria 1733
124 Ga0436364_0870811 3300037853 Bacteria 2967
125 Ga0436364_0997237 3300037853 Bacteria 21177
126 Ga0436364_1033893 3300037853 Bacteria 1332
127 Ga0436364_1058180 3300037853 Bacteria 3478
128 Ga0436364_1316794 3300037853 Bacteria 2006
129 Ga0436364_1332298 3300037853 Unclassified 672
130 Ga0436364_1466037 3300037853 Unclassified 1499
131 Ga0400490_02052 3300038726 Bacteria 29647
132 Ga0400491_18892 3300038727 Bacteria 3987
133 Ga0400483_218310 3300039062 Bacteria 4159
134 Ga0400489_65890 3300039093 Bacteria 27169
135 Ga0436365_0266715 3300039437 Bacteria 2899
136 Ga0436365_0287215 3300039437 Bacteria 1801
137 Ga0436365_0746493 3300039437 Bacteria 2242
138 Ga0436365_1377132 3300039437 Bacteria 3149
139 Ga0436365_1827853 3300039437 Bacteria 4632
140 Ga0436360_0325515 3300039438 Bacteria 1606
141 Ga0436360_0965759 3300039438 Bacteria 1420
142 Ga0436360_1294485 3300039438 Bacteria 10623
143 Ga0436361_0683315 3300039447 Bacteria 65588
144 Ga0436361_1207485 3300039447 Bacteria 1147
145 Ga0436363_0228721 3300039450 Bacteria 3456
146 Ga0436363_0719316 3300039450 Unclassified 711
147 Ga0436363_0941550 3300039450 Bacteria 1843
148 Ga0436363_1181567 3300039450 Bacteria 1899
149 Ga0436362_0242795 3300039453 Bacteria 816
150 Ga0436362_0384939 3300039453 Bacteria 2513
151 Ga0436362_0645364 3300039453 Bacteria 2216
152 Ga0436362_1001625 3300039453 Bacteria 6176
153 Ga0436362_1049167 3300039453 Bacteria 2565
154 Ga0453683_1024238 3300044673 Bacteria 549
155 Ga0466966_0025085 3300044684 Bacteria 3897
156 Ga0466963_0503279 3300044694 Unclassified 855
157 Ga0466970_0066915 3300044765 Bacteria 1929
158 Ga0466959_0128040 3300045049 Bacteria 1801
159 Ga0466967_0497560 3300045976 Bacteria 1196
160 Ga0496104_0513262 3300048907 Unclassified 1110
161 Ga0496109_0000015 3300048912 Bacteria 214913
162 Ga0496112_0007839 3300048915 Bacteria 9506
163 Ga0496115_0232502 3300048918 Bacteria 1520
164 Ga0501312_000241 3300049528 Bacteria 3929
165 Ga0501315_018115 3300049531 Bacteria 927
166 Ga0501317_003866 3300049533 Bacteria 1523
167 Ga0501324_006181 3300049540 Bacteria 1002
168 Ga0501332_07879 3300049548 Bacteria 685
169 nmdc:mga05p37_227427_c1 3300050507 Bacteria 2249
170 nmdc:mga0qj67_100553_c1 3300050509 Bacteria 2331
171 nmdc:mga0qj67_504257_c1 3300050509 Bacteria 973
172 nmdc:mga06r32_722554_c1 3300050510 Unclassified 961
173 nmdc:mga08y16_32525_c1 3300050511 Bacteria 5482
174 nmdc:mga0n895_442012_c1 3300050512 Bacteria 1314
175 nmdc:mga0rr50_176381_c1 3300050513 Bacteria 1744
176 Ga0500641_0037809 3300053096 Bacteria 1937
177 Ga0500555_002078 3300053103 Bacteria 5889
178 Ga0500617_094414 3300053124 Bacteria 1274
179 Ga0587082_055310 3300059504 Unclassified 768
180 Ga0587090_022365 3300059510 Bacteria 998
181 Ga0587107_052942 3300059652 Bacteria 694
182 Ga0501082_1032173 3300060353 Bacteria 719
183 Ga0466962_0382687 3300061719 Unclassified 703
184 Ga0530510_0806689 3300061734 Bacteria 716

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_1024238 Ga0453683_1024238_35_532 165
2 3300050513 nmdc:mga0rr50_176381_c1 nmdc:mga0rr50_176381_c1_53_550 165
3 3300005841 Ga0068863_100329788 Ga0068863_1003297882 179
4 3300025914 Ga0207671_10771337 Ga0207671_107713372 179
5 3300026088 Ga0207641_10176303 Ga0207641_101763032 179
6 3300049528 Ga0501312_000241 Ga0501312_000241_2208_2792 183
7 3300049531 Ga0501315_018115 Ga0501315_018115_211_795 183
8 iso_pu_bacteria 2984527788 2984530744 186
9 iso_pu_bacteria 2738543010 2739229969 187
10 3300006358 Ga0068871_100750058 Ga0068871_1007500582 189
11 3300037471 Ga0395905_0934546 Ga0395905_0934546_170_751 189
12 3300039453 Ga0436362_0384939 Ga0436362_0384939_1782_2381 189
13 iso_pu_bacteria 2925326138 2925326529 189
14 iso_pu_bacteria 8054795415 8054800330 189
15 3300005536 Ga0070697_100327481 Ga0070697_1003274812 190
16 3300006846 Ga0075430_100115244 Ga0075430_1001152442 190
17 3300009545 Ga0105237_10721557 Ga0105237_107215572 190
18 3300010375 Ga0105239_10954136 Ga0105239_109541362 190
19 3300013297 Ga0157378_10595065 Ga0157378_105950652 190
20 3300013307 Ga0157372_11034365 Ga0157372_110343651 190
21 3300014325 Ga0163163_11462312 Ga0163163_114623121 190
22 3300014968 Ga0157379_10263027 Ga0157379_102630272 190
23 3300035117 Ga0373953_0248988 Ga0373953_0248988_55_630 190
24 3300035692 Ga0373935_0034257 Ga0373935_0034257_2362_2937 190
25 3300035725 Ga0373947_0196957 Ga0373947_0196957_202_777 190
26 3300036401 Ga0373937_0012682 Ga0373937_0012682_4823_5398 190
27 3300037068 Ga0373925_0110620 Ga0373925_0110620_736_1311 190
28 3300050509 nmdc:mga0qj67_100553_c1 nmdc:mga0qj67_100553_c1_1460_2038 190
29 iso_pu_bacteria 8057473075 8057475872 190
30 3300005536 Ga0070697_100847709 Ga0070697_1008477091 191
31 3300005937 Ga0081455_10125467 Ga0081455_101254673 191
32 3300009093 Ga0105240_10026134 Ga0105240_100261343 191
33 3300009551 Ga0105238_10011617 Ga0105238_100116173 191
34 3300025906 Ga0207699_10172095 Ga0207699_101720952 191
35 3300025913 Ga0207695_10677971 Ga0207695_106779712 191
36 3300025924 Ga0207694_10113812 Ga0207694_101138122 191
37 3300049533 Ga0501317_003866 Ga0501317_003866_610_1194 191
38 3300049540 Ga0501324_006181 Ga0501324_006181_283_867 191
39 3300049548 Ga0501332_07879 Ga0501332_07879_60_644 191
40 3300036712 Ga0316584_0094249 Ga0316584_0094249_502_1086 192
41 3300038726 Ga0400490_02052 Ga0400490_02052_26086_26670 192
42 3300038727 Ga0400491_18892 Ga0400491_18892_2109_2693 192
43 3300048912 Ga0496109_0000015 Ga0496109_0000015_152047_152625 192
44 3300006852 Ga0075433_10162377 Ga0075433_101623772 193
45 3300014326 Ga0157380_11289880 Ga0157380_112898802 193
46 3300031733 Ga0316577_10000181 Ga0316577_1000018116 193
47 3300039062 Ga0400483_218310 Ga0400483_218310_1322_1909 193
48 3300050512 nmdc:mga0n895_442012_c1 nmdc:mga0n895_442012_c1_84_677 193
49 3300060353 Ga0501082_1032173 Ga0501082_1032173_30_623 193
50 3300004801 Ga0058860_11785091 Ga0058860_117850912 194
51 3300005334 Ga0068869_100448580 Ga0068869_1004485802 194
52 3300005842 Ga0068858_100446643 Ga0068858_1004466432 194
53 3300005985 Ga0081539_10060896 Ga0081539_100608962 194
54 3300026095 Ga0207676_10349037 Ga0207676_103490372 194
55 3300032004 Ga0307414_11115619 Ga0307414_111156192 194
56 3300025919 Ga0207657_10124933 Ga0207657_101249332 196
57 3300037853 Ga0436364_0794010 Ga0436364_0794010_812_1405 196
58 3300039093 Ga0400489_65890 Ga0400489_65890_10525_11121 196
59 3300005344 Ga0070661_100040640 Ga0070661_1000406402 197
60 3300005344 Ga0070661_100343942 Ga0070661_1003439422 197
61 3300005366 Ga0070659_100094493 Ga0070659_1000944932 197
62 3300005439 Ga0070711_100445921 Ga0070711_1004459212 197
63 3300005539 Ga0068853_100037586 Ga0068853_1000375862 197
64 3300005563 Ga0068855_100031831 Ga0068855_1000318312 197
65 3300005614 Ga0068856_100002503 Ga0068856_1000025036 197
66 3300005614 Ga0068856_100096999 Ga0068856_1000969992 197
67 3300006028 Ga0070717_10199489 Ga0070717_101994892 197
68 3300006358 Ga0068871_100700151 Ga0068871_1007001511 197
69 3300009174 Ga0105241_10067150 Ga0105241_100671502 197
70 3300013102 Ga0157371_10023466 Ga0157371_100234664 197
71 3300013104 Ga0157370_10570844 Ga0157370_105708442 197
72 3300013105 Ga0157369_10027527 Ga0157369_100275272 197
73 3300013105 Ga0157369_10035507 Ga0157369_100355073 197
74 3300013105 Ga0157369_10194290 Ga0157369_101942902 197
75 3300013296 Ga0157374_10001249 Ga0157374_1000124911 197
76 3300013296 Ga0157374_10034693 Ga0157374_100346933 197
77 3300013307 Ga0157372_10231836 Ga0157372_102318362 197
78 3300014969 Ga0157376_10029690 Ga0157376_100296902 197
79 3300021384 Ga0213876_10335254 Ga0213876_103352541 197
80 3300025916 Ga0207663_10452815 Ga0207663_104528152 197
81 3300025920 Ga0207649_10497413 Ga0207649_104974132 197
82 3300025921 Ga0207652_10156929 Ga0207652_101569292 197
83 3300025928 Ga0207700_10203896 Ga0207700_102038962 197
84 3300025933 Ga0207706_10202161 Ga0207706_102021612 197
85 3300025949 Ga0207667_10022557 Ga0207667_100225573 197
86 3300025949 Ga0207667_10700194 Ga0207667_107001941 197
87 3300026041 Ga0207639_10023876 Ga0207639_100238762 197
88 3300026078 Ga0207702_10009586 Ga0207702_100095862 197
89 3300026078 Ga0207702_10071744 Ga0207702_100717442 197
90 3300028379 Ga0268266_10482197 Ga0268266_104821972 197
91 3300039437 Ga0436365_1827853 Ga0436365_1827853_2648_3262 197
92 3300039450 Ga0436363_0719316 Ga0436363_0719316_83_682 197
93 3300039453 Ga0436362_1049167 Ga0436362_1049167_1926_2540 197
94 3300048915 Ga0496112_0007839 Ga0496112_0007839_879_1475 197
95 3300053096 Ga0500641_0037809 Ga0500641_0037809_1121_1714 197
96 3300053103 Ga0500555_002078 Ga0500555_002078_2379_2972 197
97 3300053124 Ga0500617_094414 Ga0500617_094414_284_877 197
98 3300003911 JGI25405J52794_10023715 JGI25405J52794_100237152 198
99 3300004800 Ga0058861_11576545 Ga0058861_115765453 198
100 3300004803 Ga0058862_12741148 Ga0058862_127411482 198
101 3300005329 Ga0070683_100096141 Ga0070683_1000961412 198
102 3300005336 Ga0070680_100102690 Ga0070680_1001026902 198
103 3300005458 Ga0070681_10018233 Ga0070681_100182334 198
104 3300005535 Ga0070684_100231533 Ga0070684_1002315332 198
105 3300005614 Ga0068856_100058716 Ga0068856_1000587163 198
106 3300005614 Ga0068856_100610277 Ga0068856_1006102772 198
107 3300005616 Ga0068852_100649857 Ga0068852_1006498572 198
108 3300005937 Ga0081455_10006093 Ga0081455_100060935 198
109 3300006846 Ga0075430_100149291 Ga0075430_1001492912 198
110 3300006880 Ga0075429_100068694 Ga0075429_1000686942 198
111 3300013100 Ga0157373_10511175 Ga0157373_105111752 198
112 3300013104 Ga0157370_10044809 Ga0157370_100448092 198
113 3300013105 Ga0157369_10115647 Ga0157369_101156473 198
114 3300013105 Ga0157369_10247172 Ga0157369_102471722 198
115 3300013307 Ga0157372_10657194 Ga0157372_106571942 198
116 3300020075 Ga0206349_1188575 Ga0206349_11885753 198
117 3300020080 Ga0206350_10825619 Ga0206350_108256192 198
118 3300020082 Ga0206353_11281317 Ga0206353_112813173 198
119 3300021388 Ga0213875_10000027 Ga0213875_1000002768 198
120 3300021388 Ga0213875_10000796 Ga0213875_100007964 198
121 3300021388 Ga0213875_10001193 Ga0213875_1000119312 198
122 3300021388 Ga0213875_10026387 Ga0213875_100263872 198
123 3300025912 Ga0207707_10063118 Ga0207707_100631182 198
124 3300025917 Ga0207660_10130017 Ga0207660_101300172 198
125 3300025944 Ga0207661_10371862 Ga0207661_103718622 198
126 3300026067 Ga0207678_10449773 Ga0207678_104497732 198
127 3300026078 Ga0207702_10077377 Ga0207702_100773772 198
128 3300026078 Ga0207702_10627306 Ga0207702_106273062 198
129 3300027907 Ga0207428_10001374 Ga0207428_1000137420 198
130 3300028379 Ga0268266_11254420 Ga0268266_112544201 198
131 3300035116 Ga0373945_0086938 Ga0373945_0086938_401_1003 198
132 3300035170 Ga0373943_0550386 Ga0373943_0550386_63_665 198
133 3300035692 Ga0373935_0013280 Ga0373935_0013280_866_1468 198
134 3300037418 Ga0395900_0226084 Ga0395900_0226084_1015_1626 198
135 3300037853 Ga0436364_0025760 Ga0436364_0025760_1482_2081 198
136 3300037853 Ga0436364_0191556 Ga0436364_0191556_189_788 198
137 3300037853 Ga0436364_0446012 Ga0436364_0446012_159360_159962 198
138 3300037853 Ga0436364_0493035 Ga0436364_0493035_5494_6108 198
139 3300037853 Ga0436364_0548583 Ga0436364_0548583_110_712 198
140 3300037853 Ga0436364_0761948 Ga0436364_0761948_622_1224 198
141 3300037853 Ga0436364_0997237 Ga0436364_0997237_18617_19216 198
142 3300039437 Ga0436365_0287215 Ga0436365_0287215_979_1578 198
143 3300039437 Ga0436365_0746493 Ga0436365_0746493_158_760 198
144 3300039450 Ga0436363_0228721 Ga0436363_0228721_931_1533 198
145 3300048918 Ga0496115_0232502 Ga0496115_0232502_102_704 198
146 3300050507 nmdc:mga05p37_227427_c1 nmdc:mga05p37_227427_c1_1541_2137 198
147 3300050509 nmdc:mga0qj67_504257_c1 nmdc:mga0qj67_504257_c1_28_624 198
148 3300050510 nmdc:mga06r32_722554_c1 nmdc:mga06r32_722554_c1_284_880 198
149 3300050511 nmdc:mga08y16_32525_c1 nmdc:mga08y16_32525_c1_820_1416 198
150 3300059652 Ga0587107_052942 Ga0587107_052942_27_629 198
151 3300061734 Ga0530510_0806689 Ga0530510_0806689_32_685 198
152 3300021441 Ga0213871_10000665 Ga0213871_100006653 199
153 3300037853 Ga0436364_0301698 Ga0436364_0301698_976_1581 199
154 3300037853 Ga0436364_1332298 Ga0436364_1332298_56_658 199
155 3300039438 Ga0436360_0965759 Ga0436360_0965759_623_1225 199
156 3300039438 Ga0436360_1294485 Ga0436360_1294485_1208_1834 199
157 3300039447 Ga0436361_0683315 Ga0436361_0683315_34842_35477 199
158 3300037853 Ga0436364_1033893 Ga0436364_1033893_55_657 200
159 3300039438 Ga0436360_0325515 Ga0436360_0325515_848_1450 200
160 3300039447 Ga0436361_1207485 Ga0436361_1207485_464_1069 200
161 3300045976 Ga0466967_0497560 Ga0466967_0497560_551_1156 200
162 3300021384 Ga0213876_10013157 Ga0213876_100131573 201
163 3300037853 Ga0436364_1316794 Ga0436364_1316794_609_1214 201
164 3300039453 Ga0436362_0242795 Ga0436362_0242795_78_683 201
165 3300044694 Ga0466963_0503279 Ga0466963_0503279_98_712 201
166 3300005435 Ga0070714_100254496 Ga0070714_1002544962 212
167 3300025929 Ga0207664_10217720 Ga0207664_102177202 212
168 3300021384 Ga0213876_10219844 Ga0213876_102198442 213
169 3300021388 Ga0213875_10000005 Ga0213875_10000005140 213
170 3300021388 Ga0213875_10152161 Ga0213875_101521611 213
171 3300037853 Ga0436364_0317618 Ga0436364_0317618_87643_88287 213
172 3300037853 Ga0436364_0760276 Ga0436364_0760276_480_1124 213
173 3300037853 Ga0436364_0870811 Ga0436364_0870811_1395_2039 213
174 3300037853 Ga0436364_1058180 Ga0436364_1058180_1575_2219 213
175 3300037853 Ga0436364_1466037 Ga0436364_1466037_560_1204 213
176 3300039437 Ga0436365_0266715 Ga0436365_0266715_1991_2635 213
177 3300039437 Ga0436365_1377132 Ga0436365_1377132_1447_2091 213
178 3300039450 Ga0436363_1181567 Ga0436363_1181567_944_1588 213
179 3300039453 Ga0436362_1001625 Ga0436362_1001625_2952_3596 213
180 3300044684 Ga0466966_0025085 Ga0466966_0025085_2051_2692 213
181 3300044765 Ga0466970_0066915 Ga0466970_0066915_108_749 213
182 3300045049 Ga0466959_0128040 Ga0466959_0128040_933_1574 213
183 3300061719 Ga0466962_0382687 Ga0466962_0382687_33_674 213
184 3300003308 Ga0006777J48905_1095125 Ga0006777J48905_10951252 214
185 3300039450 Ga0436363_0941550 Ga0436363_0941550_992_1648 214
186 3300039453 Ga0436362_0645364 Ga0436362_0645364_1067_1801 214
187 3300048907 Ga0496104_0513262 Ga0496104_0513262_248_892 214
188 3300059504 Ga0587082_055310 Ga0587082_055310_72_716 214
189 3300059510 Ga0587090_022365 Ga0587090_022365_294_938 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01926

MMR_HSR1

50S ribosome-binding GTPase

52

170

0.85

PF02421

FeoB_N

Ferrous iron transport protein B

51

213

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1svw-assembly2.cif.gz_B crystal structure of ysxc complexed with gmppnp 0.9087 23 212
3pqc-assembly1.cif.gz_A crystal structure of thermotoga maritima ribosome biogenesis gtp-binding protein engb (ysxc/yiha) in complex with gdp 0.9005 24 211
1svw-assembly1.cif.gz_A crystal structure of ysxc complexed with gmppnp 0.8998 23 212
1svi-assembly1.cif.gz_A crystal structure of the gtp-binding protein ysxc complexed with gdp 0.899 20 212
1sul-assembly2.cif.gz_B crystal structure of the apo-ysxc 0.8975 21 212
ID Description Score Start End Superfamily
af_Q8IL49_94_294_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9139 24 210 3.40.50.300
af_Q550M3_249_450_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9089 20 210 3.40.50.300
af_I1LLV7_341_539_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9088 20 214 3.40.50.300
af_P0A6P7_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9012 22 214 3.40.50.300
3pqcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9005 24 211 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C0SC78-F1-model_v4 YihA family ribosome biogenesis GTP-binding protein 0.9564 56 210 GO:0000917
GO:0005525
GO:0005829
GO:0046872
AF-A0A367ZM10-F1-model_v4 Probable GTP-binding protein EngB 0.9551 24 212 GO:0000917
GO:0005525
GO:0005829
GO:0046872
AF-A0A6M2A7F3-F1-model_v4 Probable GTP-binding protein EngB 0.9542 24 210 GO:0000917
GO:0005525
GO:0005829
GO:0046872
AF-A0A523YTP6-F1-model_v4 YihA family ribosome biogenesis GTP-binding protein 0.9517 24 157 GO:0000917
GO:0005525
GO:0005829
GO:0046872
AF-A0A7Y5DTN7-F1-model_v4 Ribosome biogenesis GTP-binding protein YsxC 0.9511 24 126 GO:0000917
GO:0005525
GO:0005829
GO:0046872

Feature Viewer

pLDDT pTM Quality
84.91 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map