F290309
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 189 | 129 | 184 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300004801|Ga0058860_11785091|Ga0058860_117850912 |
| Length | 221 |
| Sequence | LFARAAGCLEQAFHPAGDLLTENSDVMPTEVDAEHVTSAARPDQFPAESLPEIAFLGRSNVGKSSLLNCLTGKKGLAFTSSKPGCTQLINFFRINGEMFFVDLPGYGFARVPLEVKARWKSLIESYLLKRNTLTTAVVLIDSRRGWMEPDLELKSWLEFQRIPYLVVATKIDKLNQKEQHRNLNSIAKELSGSELFPFSAVTGRGAREIWQAISKTKKLRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 2 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 3 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 4 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 31 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 52 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 53 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 54 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 77 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 78 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 79 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 80 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 81 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 82 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 83 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 84 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 85 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 86 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 87 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 88 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 89 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 90 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 91 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 92 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 93 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 94 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 95 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 96 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 97 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 98 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 99 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 100 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 101 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 102 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 103 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 104 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 105 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 107 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 108 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 114 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 115 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 120 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 121 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 122 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 127 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 128 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 129 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.42 |
| Metatranscriptomes | 7.94 |
| Isolates | 2.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.53 |
| Bulb | 0 |
| Endosphere | 1.59 |
| Nodule | 0.53 |
| Rhizoplane | 2.12 |
| Rhizosphere | 72.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006777J48905_1095125 | 3300003308 | Unclassified | 973 |
| 2 | JGI25405J52794_10023715 | 3300003911 | Bacteria | 1250 |
| 3 | Ga0058861_11576545 | 3300004800 | Bacteria | 1397 |
| 4 | Ga0058860_11785091 | 3300004801 | Bacteria | 1136 |
| 5 | Ga0058862_12741148 | 3300004803 | Unclassified | 1048 |
| 6 | Ga0070683_100096141 | 3300005329 | Bacteria | 2786 |
| 7 | Ga0068869_100448580 | 3300005334 | Unclassified | 1069 |
| 8 | Ga0070680_100102690 | 3300005336 | Bacteria | 2375 |
| 9 | Ga0070661_100040640 | 3300005344 | Bacteria | 3394 |
| 10 | Ga0070661_100343942 | 3300005344 | Bacteria | 1169 |
| 11 | Ga0070659_100094493 | 3300005366 | Bacteria | 2401 |
| 12 | Ga0070714_100254496 | 3300005435 | Bacteria | 1625 |
| 13 | Ga0070711_100445921 | 3300005439 | Bacteria | 1059 |
| 14 | Ga0070681_10018233 | 3300005458 | Bacteria | 7015 |
| 15 | Ga0070684_100231533 | 3300005535 | Bacteria | 1687 |
| 16 | Ga0070697_100327481 | 3300005536 | Bacteria | 1320 |
| 17 | Ga0070697_100847709 | 3300005536 | Unclassified | 809 |
| 18 | Ga0068853_100037586 | 3300005539 | Bacteria | 4119 |
| 19 | Ga0068855_100031831 | 3300005563 | Bacteria | 6297 |
| 20 | Ga0068856_100002503 | 3300005614 | Bacteria | 18908 |
| 21 | Ga0068856_100058716 | 3300005614 | Bacteria | 3800 |
| 22 | Ga0068856_100096999 | 3300005614 | Bacteria | 2937 |
| 23 | Ga0068856_100610277 | 3300005614 | Bacteria | 1112 |
| 24 | Ga0068852_100649857 | 3300005616 | Bacteria | 1062 |
| 25 | Ga0068863_100329788 | 3300005841 | Bacteria | 1484 |
| 26 | Ga0068858_100446643 | 3300005842 | Bacteria | 1246 |
| 27 | Ga0081455_10006093 | 3300005937 | Bacteria | 13042 |
| 28 | Ga0081455_10125467 | 3300005937 | Bacteria | 2015 |
| 29 | Ga0081539_10060896 | 3300005985 | Bacteria | 2070 |
| 30 | Ga0070717_10199489 | 3300006028 | Bacteria | 1752 |
| 31 | Ga0068871_100700151 | 3300006358 | Bacteria | 928 |
| 32 | Ga0068871_100750058 | 3300006358 | Unclassified | 897 |
| 33 | Ga0075430_100115244 | 3300006846 | Bacteria | 2239 |
| 34 | Ga0075430_100149291 | 3300006846 | Bacteria | 1946 |
| 35 | Ga0075433_10162377 | 3300006852 | Bacteria | 1988 |
| 36 | Ga0075429_100068694 | 3300006880 | Bacteria | 3084 |
| 37 | Ga0105240_10026134 | 3300009093 | Bacteria | 7661 |
| 38 | Ga0105241_10067150 | 3300009174 | Bacteria | 2775 |
| 39 | Ga0105237_10721557 | 3300009545 | Bacteria | 1003 |
| 40 | Ga0105238_10011617 | 3300009551 | Bacteria | 8870 |
| 41 | Ga0105239_10954136 | 3300010375 | Bacteria | 985 |
| 42 | Ga0157373_10511175 | 3300013100 | Bacteria | 868 |
| 43 | Ga0157371_10023466 | 3300013102 | Bacteria | 4511 |
| 44 | Ga0157370_10044809 | 3300013104 | Bacteria | 4248 |
| 45 | Ga0157370_10570844 | 3300013104 | Bacteria | 1036 |
| 46 | Ga0157369_10027527 | 3300013105 | Bacteria | 6300 |
| 47 | Ga0157369_10035507 | 3300013105 | Bacteria | 5465 |
| 48 | Ga0157369_10115647 | 3300013105 | Bacteria | 2849 |
| 49 | Ga0157369_10194290 | 3300013105 | Bacteria | 2132 |
| 50 | Ga0157369_10247172 | 3300013105 | Bacteria | 1862 |
| 51 | Ga0157374_10001249 | 3300013296 | Bacteria | 21701 |
| 52 | Ga0157374_10034693 | 3300013296 | Bacteria | 4611 |
| 53 | Ga0157378_10595065 | 3300013297 | Bacteria | 1116 |
| 54 | Ga0157372_10231836 | 3300013307 | Bacteria | 2141 |
| 55 | Ga0157372_10657194 | 3300013307 | Bacteria | 1221 |
| 56 | Ga0157372_11034365 | 3300013307 | Unclassified | 951 |
| 57 | Ga0163163_11462312 | 3300014325 | Bacteria | 745 |
| 58 | Ga0157380_11289880 | 3300014326 | Bacteria | 777 |
| 59 | Ga0157379_10263027 | 3300014968 | Bacteria | 1568 |
| 60 | Ga0157376_10029690 | 3300014969 | Bacteria | 4357 |
| 61 | Ga0206349_1188575 | 3300020075 | Bacteria | 3851 |
| 62 | Ga0206350_10825619 | 3300020080 | Bacteria | 1018 |
| 63 | Ga0206353_11281317 | 3300020082 | Unclassified | 1314 |
| 64 | Ga0213876_10013157 | 3300021384 | Bacteria | 4397 |
| 65 | Ga0213876_10219844 | 3300021384 | Bacteria | 1010 |
| 66 | Ga0213876_10335254 | 3300021384 | Unclassified | 804 |
| 67 | Ga0213875_10000005 | 3300021388 | Bacteria | 595146 |
| 68 | Ga0213875_10000027 | 3300021388 | Bacteria | 190420 |
| 69 | Ga0213875_10000796 | 3300021388 | Bacteria | 23564 |
| 70 | Ga0213875_10001193 | 3300021388 | Bacteria | 17776 |
| 71 | Ga0213875_10026387 | 3300021388 | Bacteria | 2763 |
| 72 | Ga0213875_10152161 | 3300021388 | Unclassified | 1084 |
| 73 | Ga0213871_10000665 | 3300021441 | Bacteria | 4953 |
| 74 | Ga0207699_10172095 | 3300025906 | Bacteria | 1449 |
| 75 | Ga0207707_10063118 | 3300025912 | Bacteria | 3224 |
| 76 | Ga0207695_10677971 | 3300025913 | Bacteria | 912 |
| 77 | Ga0207671_10771337 | 3300025914 | Bacteria | 763 |
| 78 | Ga0207663_10452815 | 3300025916 | Bacteria | 990 |
| 79 | Ga0207660_10130017 | 3300025917 | Unclassified | 1916 |
| 80 | Ga0207657_10124933 | 3300025919 | Bacteria | 2114 |
| 81 | Ga0207649_10497413 | 3300025920 | Bacteria | 927 |
| 82 | Ga0207652_10156929 | 3300025921 | Bacteria | 2039 |
| 83 | Ga0207694_10113812 | 3300025924 | Bacteria | 2154 |
| 84 | Ga0207700_10203896 | 3300025928 | Bacteria | 1668 |
| 85 | Ga0207664_10217720 | 3300025929 | Bacteria | 1655 |
| 86 | Ga0207706_10202161 | 3300025933 | Bacteria | 1743 |
| 87 | Ga0207661_10371862 | 3300025944 | Unclassified | 1292 |
| 88 | Ga0207667_10022557 | 3300025949 | Bacteria | 6950 |
| 89 | Ga0207667_10700194 | 3300025949 | Bacteria | 1015 |
| 90 | Ga0207639_10023876 | 3300026041 | Bacteria | 4419 |
| 91 | Ga0207678_10449773 | 3300026067 | Bacteria | 1119 |
| 92 | Ga0207702_10009586 | 3300026078 | Bacteria | 8129 |
| 93 | Ga0207702_10071744 | 3300026078 | Bacteria | 2983 |
| 94 | Ga0207702_10077377 | 3300026078 | Bacteria | 2877 |
| 95 | Ga0207702_10627306 | 3300026078 | Bacteria | 1056 |
| 96 | Ga0207641_10176303 | 3300026088 | Bacteria | 1955 |
| 97 | Ga0207676_10349037 | 3300026095 | Bacteria | 1368 |
| 98 | Ga0207428_10001374 | 3300027907 | Bacteria | 25780 |
| 99 | Ga0268266_10482197 | 3300028379 | Bacteria | 1182 |
| 100 | Ga0268266_11254420 | 3300028379 | Unclassified | 716 |
| 101 | Ga0316577_10000181 | 3300031733 | Bacteria | 20471 |
| 102 | Ga0307414_11115619 | 3300032004 | Unclassified | 729 |
| 103 | Ga0373945_0086938 | 3300035116 | Bacteria | 1205 |
| 104 | Ga0373953_0248988 | 3300035117 | Unclassified | 772 |
| 105 | Ga0373943_0550386 | 3300035170 | Unclassified | 677 |
| 106 | Ga0373935_0013280 | 3300035692 | Bacteria | 4969 |
| 107 | Ga0373935_0034257 | 3300035692 | Bacteria | 3165 |
| 108 | Ga0373947_0196957 | 3300035725 | Bacteria | 1317 |
| 109 | Ga0373937_0012682 | 3300036401 | Bacteria | 7416 |
| 110 | Ga0316584_0094249 | 3300036712 | Bacteria | 2242 |
| 111 | Ga0373925_0110620 | 3300037068 | Bacteria | 2122 |
| 112 | Ga0395900_0226084 | 3300037418 | Bacteria | 1884 |
| 113 | Ga0395905_0934546 | 3300037471 | Bacteria | 770 |
| 114 | Ga0436364_0025760 | 3300037853 | Bacteria | 3320 |
| 115 | Ga0436364_0191556 | 3300037853 | Bacteria | 908 |
| 116 | Ga0436364_0301698 | 3300037853 | Bacteria | 10821 |
| 117 | Ga0436364_0317618 | 3300037853 | Bacteria | 89116 |
| 118 | Ga0436364_0446012 | 3300037853 | Bacteria | 193523 |
| 119 | Ga0436364_0493035 | 3300037853 | Bacteria | 35512 |
| 120 | Ga0436364_0548583 | 3300037853 | Unclassified | 895 |
| 121 | Ga0436364_0760276 | 3300037853 | Bacteria | 1321 |
| 122 | Ga0436364_0761948 | 3300037853 | Bacteria | 2031 |
| 123 | Ga0436364_0794010 | 3300037853 | Bacteria | 1733 |
| 124 | Ga0436364_0870811 | 3300037853 | Bacteria | 2967 |
| 125 | Ga0436364_0997237 | 3300037853 | Bacteria | 21177 |
| 126 | Ga0436364_1033893 | 3300037853 | Bacteria | 1332 |
| 127 | Ga0436364_1058180 | 3300037853 | Bacteria | 3478 |
| 128 | Ga0436364_1316794 | 3300037853 | Bacteria | 2006 |
| 129 | Ga0436364_1332298 | 3300037853 | Unclassified | 672 |
| 130 | Ga0436364_1466037 | 3300037853 | Unclassified | 1499 |
| 131 | Ga0400490_02052 | 3300038726 | Bacteria | 29647 |
| 132 | Ga0400491_18892 | 3300038727 | Bacteria | 3987 |
| 133 | Ga0400483_218310 | 3300039062 | Bacteria | 4159 |
| 134 | Ga0400489_65890 | 3300039093 | Bacteria | 27169 |
| 135 | Ga0436365_0266715 | 3300039437 | Bacteria | 2899 |
| 136 | Ga0436365_0287215 | 3300039437 | Bacteria | 1801 |
| 137 | Ga0436365_0746493 | 3300039437 | Bacteria | 2242 |
| 138 | Ga0436365_1377132 | 3300039437 | Bacteria | 3149 |
| 139 | Ga0436365_1827853 | 3300039437 | Bacteria | 4632 |
| 140 | Ga0436360_0325515 | 3300039438 | Bacteria | 1606 |
| 141 | Ga0436360_0965759 | 3300039438 | Bacteria | 1420 |
| 142 | Ga0436360_1294485 | 3300039438 | Bacteria | 10623 |
| 143 | Ga0436361_0683315 | 3300039447 | Bacteria | 65588 |
| 144 | Ga0436361_1207485 | 3300039447 | Bacteria | 1147 |
| 145 | Ga0436363_0228721 | 3300039450 | Bacteria | 3456 |
| 146 | Ga0436363_0719316 | 3300039450 | Unclassified | 711 |
| 147 | Ga0436363_0941550 | 3300039450 | Bacteria | 1843 |
| 148 | Ga0436363_1181567 | 3300039450 | Bacteria | 1899 |
| 149 | Ga0436362_0242795 | 3300039453 | Bacteria | 816 |
| 150 | Ga0436362_0384939 | 3300039453 | Bacteria | 2513 |
| 151 | Ga0436362_0645364 | 3300039453 | Bacteria | 2216 |
| 152 | Ga0436362_1001625 | 3300039453 | Bacteria | 6176 |
| 153 | Ga0436362_1049167 | 3300039453 | Bacteria | 2565 |
| 154 | Ga0453683_1024238 | 3300044673 | Bacteria | 549 |
| 155 | Ga0466966_0025085 | 3300044684 | Bacteria | 3897 |
| 156 | Ga0466963_0503279 | 3300044694 | Unclassified | 855 |
| 157 | Ga0466970_0066915 | 3300044765 | Bacteria | 1929 |
| 158 | Ga0466959_0128040 | 3300045049 | Bacteria | 1801 |
| 159 | Ga0466967_0497560 | 3300045976 | Bacteria | 1196 |
| 160 | Ga0496104_0513262 | 3300048907 | Unclassified | 1110 |
| 161 | Ga0496109_0000015 | 3300048912 | Bacteria | 214913 |
| 162 | Ga0496112_0007839 | 3300048915 | Bacteria | 9506 |
| 163 | Ga0496115_0232502 | 3300048918 | Bacteria | 1520 |
| 164 | Ga0501312_000241 | 3300049528 | Bacteria | 3929 |
| 165 | Ga0501315_018115 | 3300049531 | Bacteria | 927 |
| 166 | Ga0501317_003866 | 3300049533 | Bacteria | 1523 |
| 167 | Ga0501324_006181 | 3300049540 | Bacteria | 1002 |
| 168 | Ga0501332_07879 | 3300049548 | Bacteria | 685 |
| 169 | nmdc:mga05p37_227427_c1 | 3300050507 | Bacteria | 2249 |
| 170 | nmdc:mga0qj67_100553_c1 | 3300050509 | Bacteria | 2331 |
| 171 | nmdc:mga0qj67_504257_c1 | 3300050509 | Bacteria | 973 |
| 172 | nmdc:mga06r32_722554_c1 | 3300050510 | Unclassified | 961 |
| 173 | nmdc:mga08y16_32525_c1 | 3300050511 | Bacteria | 5482 |
| 174 | nmdc:mga0n895_442012_c1 | 3300050512 | Bacteria | 1314 |
| 175 | nmdc:mga0rr50_176381_c1 | 3300050513 | Bacteria | 1744 |
| 176 | Ga0500641_0037809 | 3300053096 | Bacteria | 1937 |
| 177 | Ga0500555_002078 | 3300053103 | Bacteria | 5889 |
| 178 | Ga0500617_094414 | 3300053124 | Bacteria | 1274 |
| 179 | Ga0587082_055310 | 3300059504 | Unclassified | 768 |
| 180 | Ga0587090_022365 | 3300059510 | Bacteria | 998 |
| 181 | Ga0587107_052942 | 3300059652 | Bacteria | 694 |
| 182 | Ga0501082_1032173 | 3300060353 | Bacteria | 719 |
| 183 | Ga0466962_0382687 | 3300061719 | Unclassified | 703 |
| 184 | Ga0530510_0806689 | 3300061734 | Bacteria | 716 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_1024238 | Ga0453683_1024238_35_532 | 165 |
| 2 | 3300050513 | nmdc:mga0rr50_176381_c1 | nmdc:mga0rr50_176381_c1_53_550 | 165 |
| 3 | 3300005841 | Ga0068863_100329788 | Ga0068863_1003297882 | 179 |
| 4 | 3300025914 | Ga0207671_10771337 | Ga0207671_107713372 | 179 |
| 5 | 3300026088 | Ga0207641_10176303 | Ga0207641_101763032 | 179 |
| 6 | 3300049528 | Ga0501312_000241 | Ga0501312_000241_2208_2792 | 183 |
| 7 | 3300049531 | Ga0501315_018115 | Ga0501315_018115_211_795 | 183 |
| 8 | iso_pu_bacteria | 2984527788 | 2984530744 | 186 |
| 9 | iso_pu_bacteria | 2738543010 | 2739229969 | 187 |
| 10 | 3300006358 | Ga0068871_100750058 | Ga0068871_1007500582 | 189 |
| 11 | 3300037471 | Ga0395905_0934546 | Ga0395905_0934546_170_751 | 189 |
| 12 | 3300039453 | Ga0436362_0384939 | Ga0436362_0384939_1782_2381 | 189 |
| 13 | iso_pu_bacteria | 2925326138 | 2925326529 | 189 |
| 14 | iso_pu_bacteria | 8054795415 | 8054800330 | 189 |
| 15 | 3300005536 | Ga0070697_100327481 | Ga0070697_1003274812 | 190 |
| 16 | 3300006846 | Ga0075430_100115244 | Ga0075430_1001152442 | 190 |
| 17 | 3300009545 | Ga0105237_10721557 | Ga0105237_107215572 | 190 |
| 18 | 3300010375 | Ga0105239_10954136 | Ga0105239_109541362 | 190 |
| 19 | 3300013297 | Ga0157378_10595065 | Ga0157378_105950652 | 190 |
| 20 | 3300013307 | Ga0157372_11034365 | Ga0157372_110343651 | 190 |
| 21 | 3300014325 | Ga0163163_11462312 | Ga0163163_114623121 | 190 |
| 22 | 3300014968 | Ga0157379_10263027 | Ga0157379_102630272 | 190 |
| 23 | 3300035117 | Ga0373953_0248988 | Ga0373953_0248988_55_630 | 190 |
| 24 | 3300035692 | Ga0373935_0034257 | Ga0373935_0034257_2362_2937 | 190 |
| 25 | 3300035725 | Ga0373947_0196957 | Ga0373947_0196957_202_777 | 190 |
| 26 | 3300036401 | Ga0373937_0012682 | Ga0373937_0012682_4823_5398 | 190 |
| 27 | 3300037068 | Ga0373925_0110620 | Ga0373925_0110620_736_1311 | 190 |
| 28 | 3300050509 | nmdc:mga0qj67_100553_c1 | nmdc:mga0qj67_100553_c1_1460_2038 | 190 |
| 29 | iso_pu_bacteria | 8057473075 | 8057475872 | 190 |
| 30 | 3300005536 | Ga0070697_100847709 | Ga0070697_1008477091 | 191 |
| 31 | 3300005937 | Ga0081455_10125467 | Ga0081455_101254673 | 191 |
| 32 | 3300009093 | Ga0105240_10026134 | Ga0105240_100261343 | 191 |
| 33 | 3300009551 | Ga0105238_10011617 | Ga0105238_100116173 | 191 |
| 34 | 3300025906 | Ga0207699_10172095 | Ga0207699_101720952 | 191 |
| 35 | 3300025913 | Ga0207695_10677971 | Ga0207695_106779712 | 191 |
| 36 | 3300025924 | Ga0207694_10113812 | Ga0207694_101138122 | 191 |
| 37 | 3300049533 | Ga0501317_003866 | Ga0501317_003866_610_1194 | 191 |
| 38 | 3300049540 | Ga0501324_006181 | Ga0501324_006181_283_867 | 191 |
| 39 | 3300049548 | Ga0501332_07879 | Ga0501332_07879_60_644 | 191 |
| 40 | 3300036712 | Ga0316584_0094249 | Ga0316584_0094249_502_1086 | 192 |
| 41 | 3300038726 | Ga0400490_02052 | Ga0400490_02052_26086_26670 | 192 |
| 42 | 3300038727 | Ga0400491_18892 | Ga0400491_18892_2109_2693 | 192 |
| 43 | 3300048912 | Ga0496109_0000015 | Ga0496109_0000015_152047_152625 | 192 |
| 44 | 3300006852 | Ga0075433_10162377 | Ga0075433_101623772 | 193 |
| 45 | 3300014326 | Ga0157380_11289880 | Ga0157380_112898802 | 193 |
| 46 | 3300031733 | Ga0316577_10000181 | Ga0316577_1000018116 | 193 |
| 47 | 3300039062 | Ga0400483_218310 | Ga0400483_218310_1322_1909 | 193 |
| 48 | 3300050512 | nmdc:mga0n895_442012_c1 | nmdc:mga0n895_442012_c1_84_677 | 193 |
| 49 | 3300060353 | Ga0501082_1032173 | Ga0501082_1032173_30_623 | 193 |
| 50 | 3300004801 | Ga0058860_11785091 | Ga0058860_117850912 | 194 |
| 51 | 3300005334 | Ga0068869_100448580 | Ga0068869_1004485802 | 194 |
| 52 | 3300005842 | Ga0068858_100446643 | Ga0068858_1004466432 | 194 |
| 53 | 3300005985 | Ga0081539_10060896 | Ga0081539_100608962 | 194 |
| 54 | 3300026095 | Ga0207676_10349037 | Ga0207676_103490372 | 194 |
| 55 | 3300032004 | Ga0307414_11115619 | Ga0307414_111156192 | 194 |
| 56 | 3300025919 | Ga0207657_10124933 | Ga0207657_101249332 | 196 |
| 57 | 3300037853 | Ga0436364_0794010 | Ga0436364_0794010_812_1405 | 196 |
| 58 | 3300039093 | Ga0400489_65890 | Ga0400489_65890_10525_11121 | 196 |
| 59 | 3300005344 | Ga0070661_100040640 | Ga0070661_1000406402 | 197 |
| 60 | 3300005344 | Ga0070661_100343942 | Ga0070661_1003439422 | 197 |
| 61 | 3300005366 | Ga0070659_100094493 | Ga0070659_1000944932 | 197 |
| 62 | 3300005439 | Ga0070711_100445921 | Ga0070711_1004459212 | 197 |
| 63 | 3300005539 | Ga0068853_100037586 | Ga0068853_1000375862 | 197 |
| 64 | 3300005563 | Ga0068855_100031831 | Ga0068855_1000318312 | 197 |
| 65 | 3300005614 | Ga0068856_100002503 | Ga0068856_1000025036 | 197 |
| 66 | 3300005614 | Ga0068856_100096999 | Ga0068856_1000969992 | 197 |
| 67 | 3300006028 | Ga0070717_10199489 | Ga0070717_101994892 | 197 |
| 68 | 3300006358 | Ga0068871_100700151 | Ga0068871_1007001511 | 197 |
| 69 | 3300009174 | Ga0105241_10067150 | Ga0105241_100671502 | 197 |
| 70 | 3300013102 | Ga0157371_10023466 | Ga0157371_100234664 | 197 |
| 71 | 3300013104 | Ga0157370_10570844 | Ga0157370_105708442 | 197 |
| 72 | 3300013105 | Ga0157369_10027527 | Ga0157369_100275272 | 197 |
| 73 | 3300013105 | Ga0157369_10035507 | Ga0157369_100355073 | 197 |
| 74 | 3300013105 | Ga0157369_10194290 | Ga0157369_101942902 | 197 |
| 75 | 3300013296 | Ga0157374_10001249 | Ga0157374_1000124911 | 197 |
| 76 | 3300013296 | Ga0157374_10034693 | Ga0157374_100346933 | 197 |
| 77 | 3300013307 | Ga0157372_10231836 | Ga0157372_102318362 | 197 |
| 78 | 3300014969 | Ga0157376_10029690 | Ga0157376_100296902 | 197 |
| 79 | 3300021384 | Ga0213876_10335254 | Ga0213876_103352541 | 197 |
| 80 | 3300025916 | Ga0207663_10452815 | Ga0207663_104528152 | 197 |
| 81 | 3300025920 | Ga0207649_10497413 | Ga0207649_104974132 | 197 |
| 82 | 3300025921 | Ga0207652_10156929 | Ga0207652_101569292 | 197 |
| 83 | 3300025928 | Ga0207700_10203896 | Ga0207700_102038962 | 197 |
| 84 | 3300025933 | Ga0207706_10202161 | Ga0207706_102021612 | 197 |
| 85 | 3300025949 | Ga0207667_10022557 | Ga0207667_100225573 | 197 |
| 86 | 3300025949 | Ga0207667_10700194 | Ga0207667_107001941 | 197 |
| 87 | 3300026041 | Ga0207639_10023876 | Ga0207639_100238762 | 197 |
| 88 | 3300026078 | Ga0207702_10009586 | Ga0207702_100095862 | 197 |
| 89 | 3300026078 | Ga0207702_10071744 | Ga0207702_100717442 | 197 |
| 90 | 3300028379 | Ga0268266_10482197 | Ga0268266_104821972 | 197 |
| 91 | 3300039437 | Ga0436365_1827853 | Ga0436365_1827853_2648_3262 | 197 |
| 92 | 3300039450 | Ga0436363_0719316 | Ga0436363_0719316_83_682 | 197 |
| 93 | 3300039453 | Ga0436362_1049167 | Ga0436362_1049167_1926_2540 | 197 |
| 94 | 3300048915 | Ga0496112_0007839 | Ga0496112_0007839_879_1475 | 197 |
| 95 | 3300053096 | Ga0500641_0037809 | Ga0500641_0037809_1121_1714 | 197 |
| 96 | 3300053103 | Ga0500555_002078 | Ga0500555_002078_2379_2972 | 197 |
| 97 | 3300053124 | Ga0500617_094414 | Ga0500617_094414_284_877 | 197 |
| 98 | 3300003911 | JGI25405J52794_10023715 | JGI25405J52794_100237152 | 198 |
| 99 | 3300004800 | Ga0058861_11576545 | Ga0058861_115765453 | 198 |
| 100 | 3300004803 | Ga0058862_12741148 | Ga0058862_127411482 | 198 |
| 101 | 3300005329 | Ga0070683_100096141 | Ga0070683_1000961412 | 198 |
| 102 | 3300005336 | Ga0070680_100102690 | Ga0070680_1001026902 | 198 |
| 103 | 3300005458 | Ga0070681_10018233 | Ga0070681_100182334 | 198 |
| 104 | 3300005535 | Ga0070684_100231533 | Ga0070684_1002315332 | 198 |
| 105 | 3300005614 | Ga0068856_100058716 | Ga0068856_1000587163 | 198 |
| 106 | 3300005614 | Ga0068856_100610277 | Ga0068856_1006102772 | 198 |
| 107 | 3300005616 | Ga0068852_100649857 | Ga0068852_1006498572 | 198 |
| 108 | 3300005937 | Ga0081455_10006093 | Ga0081455_100060935 | 198 |
| 109 | 3300006846 | Ga0075430_100149291 | Ga0075430_1001492912 | 198 |
| 110 | 3300006880 | Ga0075429_100068694 | Ga0075429_1000686942 | 198 |
| 111 | 3300013100 | Ga0157373_10511175 | Ga0157373_105111752 | 198 |
| 112 | 3300013104 | Ga0157370_10044809 | Ga0157370_100448092 | 198 |
| 113 | 3300013105 | Ga0157369_10115647 | Ga0157369_101156473 | 198 |
| 114 | 3300013105 | Ga0157369_10247172 | Ga0157369_102471722 | 198 |
| 115 | 3300013307 | Ga0157372_10657194 | Ga0157372_106571942 | 198 |
| 116 | 3300020075 | Ga0206349_1188575 | Ga0206349_11885753 | 198 |
| 117 | 3300020080 | Ga0206350_10825619 | Ga0206350_108256192 | 198 |
| 118 | 3300020082 | Ga0206353_11281317 | Ga0206353_112813173 | 198 |
| 119 | 3300021388 | Ga0213875_10000027 | Ga0213875_1000002768 | 198 |
| 120 | 3300021388 | Ga0213875_10000796 | Ga0213875_100007964 | 198 |
| 121 | 3300021388 | Ga0213875_10001193 | Ga0213875_1000119312 | 198 |
| 122 | 3300021388 | Ga0213875_10026387 | Ga0213875_100263872 | 198 |
| 123 | 3300025912 | Ga0207707_10063118 | Ga0207707_100631182 | 198 |
| 124 | 3300025917 | Ga0207660_10130017 | Ga0207660_101300172 | 198 |
| 125 | 3300025944 | Ga0207661_10371862 | Ga0207661_103718622 | 198 |
| 126 | 3300026067 | Ga0207678_10449773 | Ga0207678_104497732 | 198 |
| 127 | 3300026078 | Ga0207702_10077377 | Ga0207702_100773772 | 198 |
| 128 | 3300026078 | Ga0207702_10627306 | Ga0207702_106273062 | 198 |
| 129 | 3300027907 | Ga0207428_10001374 | Ga0207428_1000137420 | 198 |
| 130 | 3300028379 | Ga0268266_11254420 | Ga0268266_112544201 | 198 |
| 131 | 3300035116 | Ga0373945_0086938 | Ga0373945_0086938_401_1003 | 198 |
| 132 | 3300035170 | Ga0373943_0550386 | Ga0373943_0550386_63_665 | 198 |
| 133 | 3300035692 | Ga0373935_0013280 | Ga0373935_0013280_866_1468 | 198 |
| 134 | 3300037418 | Ga0395900_0226084 | Ga0395900_0226084_1015_1626 | 198 |
| 135 | 3300037853 | Ga0436364_0025760 | Ga0436364_0025760_1482_2081 | 198 |
| 136 | 3300037853 | Ga0436364_0191556 | Ga0436364_0191556_189_788 | 198 |
| 137 | 3300037853 | Ga0436364_0446012 | Ga0436364_0446012_159360_159962 | 198 |
| 138 | 3300037853 | Ga0436364_0493035 | Ga0436364_0493035_5494_6108 | 198 |
| 139 | 3300037853 | Ga0436364_0548583 | Ga0436364_0548583_110_712 | 198 |
| 140 | 3300037853 | Ga0436364_0761948 | Ga0436364_0761948_622_1224 | 198 |
| 141 | 3300037853 | Ga0436364_0997237 | Ga0436364_0997237_18617_19216 | 198 |
| 142 | 3300039437 | Ga0436365_0287215 | Ga0436365_0287215_979_1578 | 198 |
| 143 | 3300039437 | Ga0436365_0746493 | Ga0436365_0746493_158_760 | 198 |
| 144 | 3300039450 | Ga0436363_0228721 | Ga0436363_0228721_931_1533 | 198 |
| 145 | 3300048918 | Ga0496115_0232502 | Ga0496115_0232502_102_704 | 198 |
| 146 | 3300050507 | nmdc:mga05p37_227427_c1 | nmdc:mga05p37_227427_c1_1541_2137 | 198 |
| 147 | 3300050509 | nmdc:mga0qj67_504257_c1 | nmdc:mga0qj67_504257_c1_28_624 | 198 |
| 148 | 3300050510 | nmdc:mga06r32_722554_c1 | nmdc:mga06r32_722554_c1_284_880 | 198 |
| 149 | 3300050511 | nmdc:mga08y16_32525_c1 | nmdc:mga08y16_32525_c1_820_1416 | 198 |
| 150 | 3300059652 | Ga0587107_052942 | Ga0587107_052942_27_629 | 198 |
| 151 | 3300061734 | Ga0530510_0806689 | Ga0530510_0806689_32_685 | 198 |
| 152 | 3300021441 | Ga0213871_10000665 | Ga0213871_100006653 | 199 |
| 153 | 3300037853 | Ga0436364_0301698 | Ga0436364_0301698_976_1581 | 199 |
| 154 | 3300037853 | Ga0436364_1332298 | Ga0436364_1332298_56_658 | 199 |
| 155 | 3300039438 | Ga0436360_0965759 | Ga0436360_0965759_623_1225 | 199 |
| 156 | 3300039438 | Ga0436360_1294485 | Ga0436360_1294485_1208_1834 | 199 |
| 157 | 3300039447 | Ga0436361_0683315 | Ga0436361_0683315_34842_35477 | 199 |
| 158 | 3300037853 | Ga0436364_1033893 | Ga0436364_1033893_55_657 | 200 |
| 159 | 3300039438 | Ga0436360_0325515 | Ga0436360_0325515_848_1450 | 200 |
| 160 | 3300039447 | Ga0436361_1207485 | Ga0436361_1207485_464_1069 | 200 |
| 161 | 3300045976 | Ga0466967_0497560 | Ga0466967_0497560_551_1156 | 200 |
| 162 | 3300021384 | Ga0213876_10013157 | Ga0213876_100131573 | 201 |
| 163 | 3300037853 | Ga0436364_1316794 | Ga0436364_1316794_609_1214 | 201 |
| 164 | 3300039453 | Ga0436362_0242795 | Ga0436362_0242795_78_683 | 201 |
| 165 | 3300044694 | Ga0466963_0503279 | Ga0466963_0503279_98_712 | 201 |
| 166 | 3300005435 | Ga0070714_100254496 | Ga0070714_1002544962 | 212 |
| 167 | 3300025929 | Ga0207664_10217720 | Ga0207664_102177202 | 212 |
| 168 | 3300021384 | Ga0213876_10219844 | Ga0213876_102198442 | 213 |
| 169 | 3300021388 | Ga0213875_10000005 | Ga0213875_10000005140 | 213 |
| 170 | 3300021388 | Ga0213875_10152161 | Ga0213875_101521611 | 213 |
| 171 | 3300037853 | Ga0436364_0317618 | Ga0436364_0317618_87643_88287 | 213 |
| 172 | 3300037853 | Ga0436364_0760276 | Ga0436364_0760276_480_1124 | 213 |
| 173 | 3300037853 | Ga0436364_0870811 | Ga0436364_0870811_1395_2039 | 213 |
| 174 | 3300037853 | Ga0436364_1058180 | Ga0436364_1058180_1575_2219 | 213 |
| 175 | 3300037853 | Ga0436364_1466037 | Ga0436364_1466037_560_1204 | 213 |
| 176 | 3300039437 | Ga0436365_0266715 | Ga0436365_0266715_1991_2635 | 213 |
| 177 | 3300039437 | Ga0436365_1377132 | Ga0436365_1377132_1447_2091 | 213 |
| 178 | 3300039450 | Ga0436363_1181567 | Ga0436363_1181567_944_1588 | 213 |
| 179 | 3300039453 | Ga0436362_1001625 | Ga0436362_1001625_2952_3596 | 213 |
| 180 | 3300044684 | Ga0466966_0025085 | Ga0466966_0025085_2051_2692 | 213 |
| 181 | 3300044765 | Ga0466970_0066915 | Ga0466970_0066915_108_749 | 213 |
| 182 | 3300045049 | Ga0466959_0128040 | Ga0466959_0128040_933_1574 | 213 |
| 183 | 3300061719 | Ga0466962_0382687 | Ga0466962_0382687_33_674 | 213 |
| 184 | 3300003308 | Ga0006777J48905_1095125 | Ga0006777J48905_10951252 | 214 |
| 185 | 3300039450 | Ga0436363_0941550 | Ga0436363_0941550_992_1648 | 214 |
| 186 | 3300039453 | Ga0436362_0645364 | Ga0436362_0645364_1067_1801 | 214 |
| 187 | 3300048907 | Ga0496104_0513262 | Ga0496104_0513262_248_892 | 214 |
| 188 | 3300059504 | Ga0587082_055310 | Ga0587082_055310_72_716 | 214 |
| 189 | 3300059510 | Ga0587090_022365 | Ga0587090_022365_294_938 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1svw-assembly2.cif.gz_B | crystal structure of ysxc complexed with gmppnp | 0.9087 | 23 | 212 |
| 3pqc-assembly1.cif.gz_A | crystal structure of thermotoga maritima ribosome biogenesis gtp-binding protein engb (ysxc/yiha) in complex with gdp | 0.9005 | 24 | 211 |
| 1svw-assembly1.cif.gz_A | crystal structure of ysxc complexed with gmppnp | 0.8998 | 23 | 212 |
| 1svi-assembly1.cif.gz_A | crystal structure of the gtp-binding protein ysxc complexed with gdp | 0.899 | 20 | 212 |
| 1sul-assembly2.cif.gz_B | crystal structure of the apo-ysxc | 0.8975 | 21 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IL49_94_294_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9139 | 24 | 210 | 3.40.50.300 |
| af_Q550M3_249_450_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9089 | 20 | 210 | 3.40.50.300 |
| af_I1LLV7_341_539_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9088 | 20 | 214 | 3.40.50.300 |
| af_P0A6P7_1_210_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9012 | 22 | 214 | 3.40.50.300 |
| 3pqcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9005 | 24 | 211 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0SC78-F1-model_v4 | YihA family ribosome biogenesis GTP-binding protein | 0.9564 | 56 | 210 |
GO:0000917
GO:0005525 GO:0005829 GO:0046872 |
| AF-A0A367ZM10-F1-model_v4 | Probable GTP-binding protein EngB | 0.9551 | 24 | 212 |
GO:0000917
GO:0005525 GO:0005829 GO:0046872 |
| AF-A0A6M2A7F3-F1-model_v4 | Probable GTP-binding protein EngB | 0.9542 | 24 | 210 |
GO:0000917
GO:0005525 GO:0005829 GO:0046872 |
| AF-A0A523YTP6-F1-model_v4 | YihA family ribosome biogenesis GTP-binding protein | 0.9517 | 24 | 157 |
GO:0000917
GO:0005525 GO:0005829 GO:0046872 |
| AF-A0A7Y5DTN7-F1-model_v4 | Ribosome biogenesis GTP-binding protein YsxC | 0.9511 | 24 | 126 |
GO:0000917
GO:0005525 GO:0005829 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar