F290109

General Info

Members Datasets Scaffolds Average Seq Length
188 130 376 176

Family's Representative Sequence

Representative Sequence 3300053155|Ga0500620_037860|Ga0500620_037860_752_1291
Length 179
Sequence VSRFRSTPFTVNVRDLVGHPGEQREHELAFAAPEQYGEAVAVVPKDTPVKVKLRLESVHEGILTSGTIRTKASAECVRCLKPLALRVKVEFQELFAYSLADGFDYEVQDDHVDLEDTVRDAIVLSLPFQPVCADGCSEIELGDGITLVLADDESPSAIDPRWAALAGFAGSDDTDQQLS

Samples

Sample ID Description Type Environment
1 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
25 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
32 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
33 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
34 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
37 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
38 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
39 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
40 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
41 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
42 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
43 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
44 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
45 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
51 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
52 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
55 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
56 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
57 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
58 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
59 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
60 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
61 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
62 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
63 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
73 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
74 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
75 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
76 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
77 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
78 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
79 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
80 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
97 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
98 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
99 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
104 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
105 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
106 2643221546 Microbacterium sp. Root53 Isolate Unclassified
107 2643221553 Microbacterium sp. Root553 Isolate Unclassified
108 2643221566 Microbacterium sp. Root166 Isolate Unclassified
109 2643221597 Microbacterium sp. Root180 Isolate Unclassified
110 2643221630 Microbacterium sp. Root322 Isolate Unclassified
111 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
112 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
113 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
114 2773857759 Microbacterium sp. 1294 Isolate Unclassified
115 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
116 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
117 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
118 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
119 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
120 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
121 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
122 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
123 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
124 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
125 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
126 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
127 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
128 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
129 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
130 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.91
Metatranscriptomes 3.72
Isolates 14.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 11.17
Nodule 0
Rhizoplane 11.17
Rhizosphere 43.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500620_037860 3300053155 Bacteria 1567
2 JGI24740J21852_10002479 3300001979 Bacteria 8346
3 JGI25154J39366_1000920 3300002738 Bacteria 12361
4 Ga0006562J51391_1052304 3300003578 Bacteria 1170
5 Ga0006562J51391_1052305 3300003578 Bacteria 5980
6 Ga0068853_100162716 3300005539 Bacteria 2015
7 Ga0068852_100316321 3300005616 Bacteria 1515
8 Ga0075365_10007069 3300006038 Bacteria 6252
9 Ga0075365_10010882 3300006038 Bacteria 5325
10 Ga0075368_10034092 3300006042 Bacteria 1983
11 Ga0075363_100006266 3300006048 Bacteria 5386
12 Ga0075364_10019775 3300006051 Bacteria 4229
13 Ga0075364_10069112 3300006051 Bacteria 2324
14 Ga0075364_10152144 3300006051 Bacteria 1559
15 Ga0075367_10000349 3300006178 Bacteria 16510
16 Ga0075369_10216512 3300006186 Bacteria 886
17 Ga0075370_10018175 3300006353 Bacteria 3810
18 Ga0105243_10544135 3300009148 Bacteria 1108
19 Ga0105237_10080114 3300009545 Bacteria 3256
20 Ga0157371_10524006 3300013102 Bacteria 877
21 Ga0157370_10145796 3300013104 Bacteria 2205
22 Ga0157370_10310402 3300013104 Bacteria 1455
23 Ga0157369_10092763 3300013105 Bacteria 3223
24 Ga0157369_10413781 3300013105 Bacteria 1398
25 Ga0171462_1003 3300013250 Bacteria 853796
26 Ga0163162_10155911 3300013306 Bacteria 2403
27 Ga0157372_10062418 3300013307 Bacteria 4175
28 Ga0163161_10397374 3300017792 Bacteria 1105
29 Ga0206354_11266673 3300020081 Bacteria 1160
30 Ga0209646_1000168 3300025246 Bacteria 86352
31 Ga0209676_1094734 3300025292 Bacteria 648
32 Ga0207647_10029513 3300025904 Bacteria 3549
33 Ga0207671_10370458 3300025914 Bacteria 1137
34 Ga0207664_10606836 3300025929 Bacteria 983
35 Ga0207709_10748386 3300025935 Bacteria 785
36 Ga0207698_10199716 3300026142 Bacteria 1789
37 Ga0307408_100330620 3300031548 Bacteria 1287
38 Ga0307406_10000795 3300031901 Bacteria 17683
39 Ga0307406_10006145 3300031901 Bacteria 6604
40 Ga0307406_10351274 3300031901 Bacteria 1152
41 Ga0307406_10486370 3300031901 Bacteria 998
42 Ga0307412_10237115 3300031911 Bacteria 1409
43 Ga0307414_10560069 3300032004 Bacteria 1020
44 Ga0307414_10833662 3300032004 Bacteria 842
45 Ga0307415_100445399 3300032126 Bacteria 1118
46 Ga0395899_0637558 3300037312 Bacteria 675
47 Ga0395901_0082447 3300038443 Bacteria 3360
48 Ga0395901_0188962 3300038443 Bacteria 2160
49 Ga0439465_0151992 3300041413 Bacteria 827
50 Ga0451789_0095556 3300041443 Bacteria 574
51 Ga0451791_0576334 3300041451 Bacteria 678
52 Ga0451807_1193287 3300041486 Bacteria 580
53 Ga0451837_1093528 3300041494 Bacteria 761
54 Ga0451853_0944684 3300041512 Bacteria 740
55 Ga0451853_2100452 3300041512 Bacteria 823
56 Ga0451853_3101433 3300041512 Bacteria 699
57 Ga0466969_0251536 3300044656 Bacteria 801
58 Ga0466972_0161036 3300044658 Bacteria 1054
59 Ga0466965_0010616 3300044683 Bacteria 4303
60 Ga0466961_0104529 3300044693 Bacteria 1783
61 Ga0466970_0018869 3300044765 Bacteria 3572
62 Ga0466970_0059779 3300044765 Bacteria 2041
63 Ga0466970_0168695 3300044765 Bacteria 1212
64 Ga0466957_1254297 3300044842 Bacteria 537
65 Ga0466960_0035612 3300044901 Bacteria 2327
66 Ga0466960_0128974 3300044901 Bacteria 1333
67 Ga0466960_0248896 3300044901 Bacteria 986
68 Ga0466959_0078020 3300045049 Bacteria 2389
69 Ga0466958_0011269 3300045836 Bacteria 5033
70 Ga0466958_0166017 3300045836 Bacteria 1397
71 Ga0466967_0767218 3300045976 Bacteria 957
72 Ga0495627_000401 3300046453 Bacteria 38376
73 Ga0495638_0479831 3300046460 Bacteria 630
74 Ga0495662_0456900 3300046476 Bacteria 627
75 Ga0495645_0003043 3300046543 Bacteria 11348
76 Ga0495672_0145939 3300047320 Bacteria 1231
77 Ga0495686_0135647 3300047472 Bacteria 1456
78 Ga0496100_0006371 3300048903 Bacteria 6431
79 Ga0496101_0056693 3300048904 Bacteria 2832
80 Ga0496102_0052487 3300048905 Bacteria 3715
81 Ga0496103_0002306 3300048906 Bacteria 12060
82 Ga0496105_0043399 3300048908 Bacteria 3708
83 Ga0496106_0924200 3300048909 Bacteria 688
84 Ga0496107_0009205 3300048910 Bacteria 6844
85 Ga0496108_0020338 3300048911 Bacteria 5456
86 Ga0496108_0196999 3300048911 Bacteria 1747
87 Ga0496109_0178063 3300048912 Bacteria 1996
88 Ga0496109_0258710 3300048912 Bacteria 1639
89 Ga0496111_0052288 3300048914 Bacteria 2949
90 Ga0496112_0072876 3300048915 Bacteria 3395
91 Ga0496113_0019897 3300048916 Bacteria 4706
92 Ga0496114_0010032 3300048917 Bacteria 7529
93 Ga0496114_0152041 3300048917 Bacteria 2008
94 Ga0496114_0820085 3300048917 Bacteria 810
95 Ga0496115_0047191 3300048918 Bacteria 3443
96 Ga0496116_0034701 3300048919 Bacteria 3553
97 Ga0496117_0001098 3300048920 Bacteria 40887
98 Ga0496117_0002166 3300048920 Bacteria 25599
99 Ga0496117_0016994 3300048920 Bacteria 6095
100 Ga0496117_0057292 3300048920 Bacteria 2707
101 Ga0496117_0283934 3300048920 Bacteria 885
102 Ga0496118_0004656 3300048921 Bacteria 16093
103 Ga0496118_0013926 3300048921 Bacteria 7563
104 Ga0496118_0038167 3300048921 Bacteria 3854
105 Ga0496118_0053078 3300048921 Bacteria 3086
106 Ga0496119_0000744 3300048922 Bacteria 43819
107 Ga0496119_0001888 3300048922 Bacteria 24099
108 Ga0496119_0005508 3300048922 Bacteria 12085
109 Ga0496119_0052482 3300048922 Bacteria 2497
110 Ga0496119_0058104 3300048922 Bacteria 2333
111 Ga0496120_0006705 3300048923 Bacteria 8764
112 Ga0496120_0089368 3300048923 Bacteria 1649
113 Ga0496120_0114048 3300048923 Bacteria 1407
114 Ga0496122_0000031 3300048925 Bacteria 329726
115 Ga0496122_0000194 3300048925 Bacteria 139191
116 Ga0496122_0004113 3300048925 Bacteria 18414
117 Ga0496122_0015978 3300048925 Bacteria 7138
118 Ga0496122_0442592 3300048925 Bacteria 647
119 Ga0496123_0000013 3300048926 Bacteria 439694
120 Ga0496123_0000350 3300048926 Bacteria 86569
121 Ga0496123_0072038 3300048926 Bacteria 2152
122 Ga0496123_0100395 3300048926 Bacteria 1686
123 Ga0496124_0015338 3300048927 Bacteria 7353
124 Ga0496124_0018054 3300048927 Bacteria 6623
125 Ga0496124_0082129 3300048927 Bacteria 2646
126 Ga0496124_0232775 3300048927 Bacteria 1376
127 Ga0496124_0388587 3300048927 Bacteria 973
128 Ga0496125_0001794 3300048928 Bacteria 29677
129 Ga0496125_0002215 3300048928 Bacteria 25912
130 Ga0496125_0024072 3300048928 Bacteria 5607
131 Ga0496125_0025924 3300048928 Bacteria 5356
132 Ga0496126_0008014 3300048929 Bacteria 11463
133 Ga0496126_0023593 3300048929 Bacteria 5959
134 Ga0496126_0090543 3300048929 Bacteria 2691
135 Ga0496126_1018263 3300048929 Bacteria 620
136 Ga0501311_034753 3300049527 Bacteria 743
137 Ga0501034_0000465 3300049571 Bacteria 67251
138 Ga0501034_0010215 3300049571 Bacteria 9792
139 Ga0501037_0094350 3300049573 Bacteria 2164
140 Ga0501038_0033654 3300049574 Bacteria 4513
141 Ga0501038_0452258 3300049574 Bacteria 987
142 Ga0501039_0537004 3300049575 Bacteria 918
143 Ga0501041_0332593 3300049577 Bacteria 959
144 Ga0501070_0009644 3300049586 Bacteria 8161
145 Ga0501076_0367891 3300049592 Bacteria 1181
146 nmdc:mga03n38_57786_c1 3300050490 Bacteria 1755
147 nmdc:mga00v17_35172_c1 3300050491 Bacteria 2979
148 nmdc:mga00v17_65570_c1 3300050491 Bacteria 2241
149 nmdc:mga0yw44_145136_c1 3300050492 Bacteria 1545
150 nmdc:mga0yw44_15226_c1 3300050492 Bacteria 4112
151 nmdc:mga06z11_67030_c1 3300050494 Bacteria 1889
152 nmdc:mga04h51_14521_c1 3300050495 Bacteria 2252
153 nmdc:mga0sz30_17283_c1 3300050516 Bacteria 1767
154 Ga0500562_088452 3300053108 Bacteria 840
155 Ga0587084_001306 3300059477 Bacteria 2332
156 Ga0587091_011134 3300059511 Bacteria 1396
157 Ga0587111_0003134 3300060346 Bacteria 2313
158 Ga0501082_0598629 3300060353 Bacteria 965
159 Ga0466962_0133295 3300061719 Bacteria 1202
160 Ga0466962_0385863 3300061719 Bacteria 700
161 Ga0466962_0437783 3300061719 Bacteria 657
162 2588108943 2585428157 Bacteria 3018951
163 2643733883 2643221542 Bacteria 3563959
164 2643753292 2643221546 Bacteria 2910897
165 2643785525 2643221553 Bacteria 3544260
166 2643848605 2643221566 Bacteria 3460379
167 2643996103 2643221597 Bacteria 3347721
168 2644170464 2643221630 Bacteria 3601215
169 2644679939 2643221724 Bacteria 3593515
170 2730229413 2728369380 Bacteria 3620317
171 2747952429 2747842429 Bacteria 3914386
172 2774384274 2773857759 Bacteria 2963774
173 2774399287 2773857763 Bacteria 4180068
174 2812323418 2811994872 Bacteria 4121241
175 2852647131 2852646457 Bacteria 3408613
176 2852665055 2852663356 Bacteria 4090475
177 2857720121 2857720070 Bacteria 3189373
178 2857723577 2857723135 Bacteria 4217853
179 2870630556 2870628048 Bacteria 3696012
180 2928092048 2928090899 Bacteria 3158267
181 2945971584 2945968032 Bacteria 4111363
182 2946033997 2946033335 Bacteria 3835514
183 2946043962 2946041624 Bacteria 4191385
184 2946081165 2946080515 Bacteria 4310960
185 2977254139 2977251589 Bacteria 2952848
186 2984581186 2984580707 Bacteria 3351387
187 8004213909 8004212874 Bacteria 2861420
188 8045831789 8045830549 Bacteria 4444727
189 Ga0500620_037860
190 JGI24740J21852_10002479
191 JGI25154J39366_1000920
192 Ga0006562J51391_1052304
193 Ga0006562J51391_1052305
194 Ga0068853_100162716
195 Ga0068852_100316321
196 Ga0075365_10007069
197 Ga0075365_10010882
198 Ga0075368_10034092
199 Ga0075363_100006266
200 Ga0075364_10019775
201 Ga0075364_10069112
202 Ga0075364_10152144
203 Ga0075367_10000349
204 Ga0075369_10216512
205 Ga0075370_10018175
206 Ga0105243_10544135
207 Ga0105237_10080114
208 Ga0157371_10524006
209 Ga0157370_10145796
210 Ga0157370_10310402
211 Ga0157369_10092763
212 Ga0157369_10413781
213 Ga0171462_1003
214 Ga0163162_10155911
215 Ga0157372_10062418
216 Ga0163161_10397374
217 Ga0206354_11266673
218 Ga0209646_1000168
219 Ga0209676_1094734
220 Ga0207647_10029513
221 Ga0207671_10370458
222 Ga0207664_10606836
223 Ga0207709_10748386
224 Ga0207698_10199716
225 Ga0307408_100330620
226 Ga0307406_10000795
227 Ga0307406_10006145
228 Ga0307406_10351274
229 Ga0307406_10486370
230 Ga0307412_10237115
231 Ga0307414_10560069
232 Ga0307414_10833662
233 Ga0307415_100445399
234 Ga0395899_0637558
235 Ga0395901_0082447
236 Ga0395901_0188962
237 Ga0439465_0151992
238 Ga0451789_0095556
239 Ga0451791_0576334
240 Ga0451807_1193287
241 Ga0451837_1093528
242 Ga0451853_0944684
243 Ga0451853_2100452
244 Ga0451853_3101433
245 Ga0466969_0251536
246 Ga0466972_0161036
247 Ga0466965_0010616
248 Ga0466961_0104529
249 Ga0466970_0018869
250 Ga0466970_0059779
251 Ga0466970_0168695
252 Ga0466957_1254297
253 Ga0466960_0035612
254 Ga0466960_0128974
255 Ga0466960_0248896
256 Ga0466959_0078020
257 Ga0466958_0011269
258 Ga0466958_0166017
259 Ga0466967_0767218
260 Ga0495627_000401
261 Ga0495638_0479831
262 Ga0495662_0456900
263 Ga0495645_0003043
264 Ga0495672_0145939
265 Ga0495686_0135647
266 Ga0496100_0006371
267 Ga0496101_0056693
268 Ga0496102_0052487
269 Ga0496103_0002306
270 Ga0496105_0043399
271 Ga0496106_0924200
272 Ga0496107_0009205
273 Ga0496108_0020338
274 Ga0496108_0196999
275 Ga0496109_0178063
276 Ga0496109_0258710
277 Ga0496111_0052288
278 Ga0496112_0072876
279 Ga0496113_0019897
280 Ga0496114_0010032
281 Ga0496114_0152041
282 Ga0496114_0820085
283 Ga0496115_0047191
284 Ga0496116_0034701
285 Ga0496117_0001098
286 Ga0496117_0002166
287 Ga0496117_0016994
288 Ga0496117_0057292
289 Ga0496117_0283934
290 Ga0496118_0004656
291 Ga0496118_0013926
292 Ga0496118_0038167
293 Ga0496118_0053078
294 Ga0496119_0000744
295 Ga0496119_0001888
296 Ga0496119_0005508
297 Ga0496119_0052482
298 Ga0496119_0058104
299 Ga0496120_0006705
300 Ga0496120_0089368
301 Ga0496120_0114048
302 Ga0496122_0000031
303 Ga0496122_0000194
304 Ga0496122_0004113
305 Ga0496122_0015978
306 Ga0496122_0442592
307 Ga0496123_0000013
308 Ga0496123_0000350
309 Ga0496123_0072038
310 Ga0496123_0100395
311 Ga0496124_0015338
312 Ga0496124_0018054
313 Ga0496124_0082129
314 Ga0496124_0232775
315 Ga0496124_0388587
316 Ga0496125_0001794
317 Ga0496125_0002215
318 Ga0496125_0024072
319 Ga0496125_0025924
320 Ga0496126_0008014
321 Ga0496126_0023593
322 Ga0496126_0090543
323 Ga0496126_1018263
324 Ga0501311_034753
325 Ga0501034_0000465
326 Ga0501034_0010215
327 Ga0501037_0094350
328 Ga0501038_0033654
329 Ga0501038_0452258
330 Ga0501039_0537004
331 Ga0501041_0332593
332 Ga0501070_0009644
333 Ga0501076_0367891
334 nmdc:mga03n38_57786_c1
335 nmdc:mga00v17_35172_c1
336 nmdc:mga00v17_65570_c1
337 nmdc:mga0yw44_145136_c1
338 nmdc:mga0yw44_15226_c1
339 nmdc:mga06z11_67030_c1
340 nmdc:mga04h51_14521_c1
341 nmdc:mga0sz30_17283_c1
342 Ga0500562_088452
343 Ga0587084_001306
344 Ga0587091_011134
345 Ga0587111_0003134
346 Ga0501082_0598629
347 Ga0466962_0133295
348 Ga0466962_0385863
349 Ga0466962_0437783
350 2588108943
351 2643733883
352 2643753292
353 2643785525
354 2643848605
355 2643996103
356 2644170464
357 2644679939
358 2730229413
359 2747952429
360 2774384274
361 2774399287
362 2812323418
363 2852647131
364 2852665055
365 2857720121
366 2857723577
367 2870630556
368 2928092048
369 2945971584
370 2946033997
371 2946043962
372 2946081165
373 2977254139
374 2984581186
375 8004213909
376 8045831789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

64

169

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h4l-assembly2.cif.gz_H crystal structure of ternary complex of hutp(hutp-l-his-zn) 0.5939 18 73
4h4l-assembly2.cif.gz_I crystal structure of ternary complex of hutp(hutp-l-his-zn) 0.5898 18 73
4h4l-assembly1.cif.gz_C crystal structure of ternary complex of hutp(hutp-l-his-zn) 0.5816 18 73
1wrn-assembly1.cif.gz_A metal ion dependency of the antiterminator protein, hutp, for binding to the terminator region of hut mrna- a structural basis 0.5796 18 73
4h4l-assembly1.cif.gz_J crystal structure of ternary complex of hutp(hutp-l-his-zn) 0.5778 18 73
ID Description Score Start End Superfamily
af_Q2QXF6_78_192_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.694 40 70 2.60.40.1180
af_Q55E38_14_163_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.6558 19 70 3.30.390.80
3hzpA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.624 16 74 3.10.450.50
af_O59736_397_578_3.30.160.270 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain 0.6069 17 68 3.30.160.270
af_Q9LM50_154_265_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5962 26 70 3.10.450.10
ID Description Score Start End GO Terms
AF-A0A7X6EI01-F1-model_v4 deleted 0.9593 1 76
AF-A0A3B9JYJ9-F1-model_v4 DUF177 domain-containing protein 0.953 2 79
AF-A0A7Y5N6W7-F1-model_v4 DUF177 domain-containing protein 0.9474 2 75
AF-A0A7X6EI01-F1-model_v4 deleted 0.9473 1 76
AF-A0A7K1ERL2-F1-model_v4 DUF177 domain-containing protein 0.9465 2 124

Map