F290038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 188 | 123 | 183 | 435 |
Family's Representative Sequence
| Representative Sequence | 3300049679|Ga0501249_000559|Ga0501249_000559_1565_2908 |
| Length | 447 |
| Sequence | MPDFATSTDAAVQAQLDRLWRLSPGADILGLDRIAKLCDRLGNPERALPPVLHVAGTNGKGSTCAYLRAAIEAAGLKAHVFTSPHLVRFNERIRLAGSLIDDEALASLLSEVLDASEGMGADGIGASFFEVTTAAAFLAFSRTPADACIIEVGLGGRLDATNILPAPAICGIAQLGLDHQGFLGDSLEGIGAEKAGIAKPEVPIVTLAYPPGVAARVSETIEAAGGVQLVKGGSWDAAAYQGRLHYRDSQGKLELPLPGLAGEHQALNAALAVAMLRHQSAIAIPTSALRAAMGWADWPARLQPLRGGALVDLLPPGAELWIDGGHNPSAGRVVGDFLRAHVAEGQPVHIVLGLLSNKDAAGFLAAMGRLPARFHMVPVPGHEHHAPATLAETARLAGFDAAPAAGFEEALRTIGAGTPGDMPPMVLVGGSLYLAGRALEANGTVVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 2 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 3 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 4 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 5 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 50 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 81 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 86 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 87 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 88 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 89 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 90 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 91 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 92 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 93 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 94 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 95 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 96 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 97 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 100 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 101 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 102 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 103 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 104 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 105 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 106 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 107 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 108 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 109 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 110 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 115 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 116 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 120 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.34 |
| Metatranscriptomes | 0 |
| Isolates | 2.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.11 |
| Nodule | 0 |
| Rhizoplane | 1.6 |
| Rhizosphere | 85.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008530 | 3300001979 | Bacteria | 4077 |
| 2 | JGI24737J22298_10000759 | 3300001990 | Bacteria | 11386 |
| 3 | JGI25150J39212_1002146 | 3300002774 | Bacteria | 5087 |
| 4 | JGI25153J46596_10000044 | 3300003215 | Bacteria | 154263 |
| 5 | Ga0055526_1001015 | 3300003771 | Bacteria | 20581 |
| 6 | Ga0055537_1001082 | 3300003773 | Bacteria | 11973 |
| 7 | Ga0055536_1015446 | 3300003781 | Bacteria | 2612 |
| 8 | Ga0055540_1001031 | 3300003792 | Bacteria | 17839 |
| 9 | Ga0065715_10002687 | 3300005293 | Bacteria | 5566 |
| 10 | Ga0070658_10035966 | 3300005327 | Bacteria | 3990 |
| 11 | Ga0070670_100004106 | 3300005331 | Bacteria | 12167 |
| 12 | Ga0070670_100010512 | 3300005331 | Bacteria | 7902 |
| 13 | Ga0070670_100107426 | 3300005331 | Bacteria | 2405 |
| 14 | Ga0070670_100135237 | 3300005331 | Bacteria | 2130 |
| 15 | Ga0070677_10045930 | 3300005333 | Bacteria | 1744 |
| 16 | Ga0070666_10067924 | 3300005335 | Bacteria | 2421 |
| 17 | Ga0070668_100000027 | 3300005347 | Bacteria | 89913 |
| 18 | Ga0070668_100007160 | 3300005347 | Bacteria | 8268 |
| 19 | Ga0070668_100064415 | 3300005347 | Bacteria | 2842 |
| 20 | Ga0070669_100005253 | 3300005353 | Bacteria | 9348 |
| 21 | Ga0070675_100001950 | 3300005354 | Bacteria | 15280 |
| 22 | Ga0070671_100000517 | 3300005355 | Bacteria | 27085 |
| 23 | Ga0070674_100013191 | 3300005356 | Bacteria | 5100 |
| 24 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 25 | Ga0070667_100010670 | 3300005367 | Bacteria | 7589 |
| 26 | Ga0070714_100016112 | 3300005435 | Bacteria | 6027 |
| 27 | Ga0070701_10028919 | 3300005438 | Bacteria | 2727 |
| 28 | Ga0070662_100004739 | 3300005457 | Bacteria | 8618 |
| 29 | Ga0068853_100014481 | 3300005539 | Bacteria | 6460 |
| 30 | Ga0070672_100009625 | 3300005543 | Bacteria | 6669 |
| 31 | Ga0070665_100000495 | 3300005548 | Bacteria | 56309 |
| 32 | Ga0070664_100140697 | 3300005564 | Bacteria | 2125 |
| 33 | Ga0068854_100007103 | 3300005578 | Bacteria | 7149 |
| 34 | Ga0068854_100015048 | 3300005578 | Bacteria | 5115 |
| 35 | Ga0068859_100015868 | 3300005617 | Bacteria | 7569 |
| 36 | Ga0068864_100072697 | 3300005618 | Bacteria | 2998 |
| 37 | Ga0068861_100007076 | 3300005719 | Bacteria | 7676 |
| 38 | Ga0068870_10075650 | 3300005840 | Bacteria | 1847 |
| 39 | Ga0068858_100000103 | 3300005842 | Bacteria | 88754 |
| 40 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 41 | Ga0068860_100112286 | 3300005843 | Bacteria | 2606 |
| 42 | Ga0068862_100003209 | 3300005844 | Bacteria | 14172 |
| 43 | Ga0068862_100007954 | 3300005844 | Bacteria | 8771 |
| 44 | Ga0068862_100008298 | 3300005844 | Bacteria | 8596 |
| 45 | Ga0081539_10034464 | 3300005985 | Bacteria | 3061 |
| 46 | Ga0075431_100002929 | 3300006847 | Bacteria | 16528 |
| 47 | Ga0097620_100015868 | 3300006931 | Bacteria | 7569 |
| 48 | Ga0111539_10063371 | 3300009094 | Bacteria | 4375 |
| 49 | Ga0105245_10012868 | 3300009098 | Bacteria | 7292 |
| 50 | Ga0105249_10044324 | 3300009553 | Bacteria | 4045 |
| 51 | Ga0105249_10100350 | 3300009553 | Bacteria | 2722 |
| 52 | Ga0163163_10205862 | 3300014325 | Bacteria | 2016 |
| 53 | Ga0157380_10001003 | 3300014326 | Bacteria | 17954 |
| 54 | Ga0157380_10014580 | 3300014326 | Bacteria | 5755 |
| 55 | Ga0163161_10014074 | 3300017792 | Bacteria | 5569 |
| 56 | Ga0207425_1000026 | 3300025245 | Bacteria | 301303 |
| 57 | Ga0209129_1003119 | 3300025258 | Bacteria | 7453 |
| 58 | Ga0209565_1000064 | 3300025263 | Bacteria | 180732 |
| 59 | Ga0209676_1017321 | 3300025292 | Bacteria | 2556 |
| 60 | Ga0209025_1000551 | 3300025294 | Bacteria | 69956 |
| 61 | Ga0209564_1003266 | 3300025295 | Bacteria | 11313 |
| 62 | Ga0209564_1007685 | 3300025295 | Bacteria | 5497 |
| 63 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 64 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 65 | Ga0207426_1034028 | 3300025302 | Bacteria | 1638 |
| 66 | Ga0209051_1000977 | 3300025303 | Bacteria | 27827 |
| 67 | Ga0209257_1001394 | 3300025304 | Bacteria | 28964 |
| 68 | Ga0209257_1001457 | 3300025304 | Bacteria | 27957 |
| 69 | Ga0207697_10001097 | 3300025315 | Bacteria | 14929 |
| 70 | Ga0207682_10000194 | 3300025893 | Bacteria | 27727 |
| 71 | Ga0207681_10010533 | 3300025923 | Bacteria | 5664 |
| 72 | Ga0207681_10115960 | 3300025923 | Bacteria | 1956 |
| 73 | Ga0207650_10002162 | 3300025925 | Bacteria | 13739 |
| 74 | Ga0207650_10004509 | 3300025925 | Bacteria | 9523 |
| 75 | Ga0207650_10039837 | 3300025925 | Bacteria | 3435 |
| 76 | Ga0207687_10009601 | 3300025927 | Bacteria | 6325 |
| 77 | Ga0207664_10106987 | 3300025929 | Bacteria | 2320 |
| 78 | Ga0207644_10000066 | 3300025931 | Bacteria | 76450 |
| 79 | Ga0207644_10023854 | 3300025931 | Bacteria | 4195 |
| 80 | Ga0207644_10090441 | 3300025931 | Bacteria | 2281 |
| 81 | Ga0207690_10007474 | 3300025932 | Bacteria | 6485 |
| 82 | Ga0207706_10000842 | 3300025933 | Bacteria | 31703 |
| 83 | Ga0207669_10008651 | 3300025937 | Bacteria | 4792 |
| 84 | Ga0207691_10001329 | 3300025940 | Bacteria | 24679 |
| 85 | Ga0207712_10042085 | 3300025961 | Bacteria | 3144 |
| 86 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 87 | Ga0207668_10002501 | 3300025972 | Bacteria | 10730 |
| 88 | Ga0207668_10061429 | 3300025972 | Bacteria | 2643 |
| 89 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 90 | Ga0207658_10018905 | 3300025986 | Bacteria | 4765 |
| 91 | Ga0207703_10000538 | 3300026035 | Bacteria | 38989 |
| 92 | Ga0207678_10043047 | 3300026067 | Bacteria | 3909 |
| 93 | Ga0207641_10000228 | 3300026088 | Bacteria | 72357 |
| 94 | Ga0207641_10008110 | 3300026088 | Bacteria | 8698 |
| 95 | Ga0207676_10034351 | 3300026095 | Bacteria | 3839 |
| 96 | Ga0207675_100004634 | 3300026118 | Bacteria | 13247 |
| 97 | Ga0207675_100045944 | 3300026118 | Bacteria | 4079 |
| 98 | Ga0209974_10013014 | 3300027876 | Bacteria | 2775 |
| 99 | Ga0207428_10068306 | 3300027907 | Bacteria | 2796 |
| 100 | Ga0268266_10000187 | 3300028379 | Bacteria | 110229 |
| 101 | Ga0268265_10005447 | 3300028380 | Bacteria | 8696 |
| 102 | Ga0268265_10021329 | 3300028380 | Bacteria | 4536 |
| 103 | Ga0268265_10070941 | 3300028380 | Bacteria | 2711 |
| 104 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 105 | Ga0265320_10002553 | 3300031240 | Bacteria | 12651 |
| 106 | Ga0307408_100005357 | 3300031548 | Bacteria | 8594 |
| 107 | Ga0307408_100010187 | 3300031548 | Bacteria | 6203 |
| 108 | Ga0307408_100274968 | 3300031548 | Bacteria | 1400 |
| 109 | Ga0307405_10009232 | 3300031731 | Bacteria | 5046 |
| 110 | Ga0307405_10112303 | 3300031731 | Bacteria | 1849 |
| 111 | Ga0307413_10007915 | 3300031824 | Bacteria | 4974 |
| 112 | Ga0307413_10032055 | 3300031824 | Bacteria | 2973 |
| 113 | Ga0307413_10095901 | 3300031824 | Bacteria | 1946 |
| 114 | Ga0307413_10136598 | 3300031824 | Bacteria | 1687 |
| 115 | Ga0307410_10000950 | 3300031852 | Bacteria | 12438 |
| 116 | Ga0307410_10001231 | 3300031852 | Bacteria | 11376 |
| 117 | Ga0307410_10041979 | 3300031852 | Bacteria | 3020 |
| 118 | Ga0307410_10117778 | 3300031852 | Bacteria | 1932 |
| 119 | Ga0307406_10009924 | 3300031901 | Bacteria | 5359 |
| 120 | Ga0307406_10071595 | 3300031901 | Bacteria | 2272 |
| 121 | Ga0307406_10109785 | 3300031901 | Bacteria | 1897 |
| 122 | Ga0307406_10122834 | 3300031901 | Bacteria | 1808 |
| 123 | Ga0307407_10002684 | 3300031903 | Bacteria | 7053 |
| 124 | Ga0307412_10003973 | 3300031911 | Bacteria | 8241 |
| 125 | Ga0307412_10005581 | 3300031911 | Bacteria | 7063 |
| 126 | Ga0307412_10007706 | 3300031911 | Bacteria | 6120 |
| 127 | Ga0307412_10009356 | 3300031911 | Bacteria | 5619 |
| 128 | Ga0307409_100010106 | 3300031995 | Bacteria | 5841 |
| 129 | Ga0307409_100044492 | 3300031995 | Bacteria | 3344 |
| 130 | Ga0307409_100068718 | 3300031995 | Bacteria | 2803 |
| 131 | Ga0307409_100144560 | 3300031995 | Bacteria | 2054 |
| 132 | Ga0307416_100004113 | 3300032002 | Bacteria | 8710 |
| 133 | Ga0307416_100005918 | 3300032002 | Bacteria | 7593 |
| 134 | Ga0307416_100006047 | 3300032002 | Bacteria | 7534 |
| 135 | Ga0307416_100006547 | 3300032002 | Bacteria | 7302 |
| 136 | Ga0307416_100037515 | 3300032002 | Bacteria | 3729 |
| 137 | Ga0307414_10002312 | 3300032004 | Bacteria | 9958 |
| 138 | Ga0307414_10020178 | 3300032004 | Bacteria | 4148 |
| 139 | Ga0307414_10024322 | 3300032004 | Bacteria | 3861 |
| 140 | Ga0307414_10056012 | 3300032004 | Bacteria | 2763 |
| 141 | Ga0307414_10074199 | 3300032004 | Bacteria | 2463 |
| 142 | Ga0307414_10078149 | 3300032004 | Bacteria | 2411 |
| 143 | Ga0307414_10091551 | 3300032004 | Bacteria | 2260 |
| 144 | Ga0307414_10130448 | 3300032004 | Bacteria | 1950 |
| 145 | Ga0307414_10274989 | 3300032004 | Bacteria | 1412 |
| 146 | Ga0307411_10002021 | 3300032005 | Bacteria | 8698 |
| 147 | Ga0307411_10027530 | 3300032005 | Bacteria | 3441 |
| 148 | Ga0307411_10039694 | 3300032005 | Bacteria | 2979 |
| 149 | Ga0307411_10043277 | 3300032005 | Bacteria | 2880 |
| 150 | Ga0307411_10067679 | 3300032005 | Bacteria | 2404 |
| 151 | Ga0307411_10075244 | 3300032005 | Bacteria | 2304 |
| 152 | Ga0307411_10097372 | 3300032005 | Bacteria | 2070 |
| 153 | Ga0307415_100007815 | 3300032126 | Bacteria | 5876 |
| 154 | Ga0307415_100179771 | 3300032126 | Bacteria | 1659 |
| 155 | Ga0395905_0000916 | 3300037471 | Bacteria | 38099 |
| 156 | Ga0395901_0000232 | 3300038443 | Bacteria | 69963 |
| 157 | Ga0395901_0272751 | 3300038443 | Bacteria | 1759 |
| 158 | Ga0436365_1651232 | 3300039437 | Bacteria | 4808 |
| 159 | Ga0439465_0011637 | 3300041413 | Bacteria | 2761 |
| 160 | Ga0450914_000025 | 3300042118 | Bacteria | 3351 |
| 161 | Ga0450905_000175 | 3300042142 | Bacteria | 7050 |
| 162 | Ga0450889_000241 | 3300042144 | Bacteria | 6040 |
| 163 | Ga0466966_0017375 | 3300044684 | Bacteria | 4754 |
| 164 | Ga0466963_0004364 | 3300044694 | Bacteria | 8215 |
| 165 | Ga0453684_0048407 | 3300044712 | Bacteria | 5623 |
| 166 | Ga0466957_0012107 | 3300044842 | Bacteria | 4989 |
| 167 | Ga0466959_0040639 | 3300045049 | Bacteria | 3435 |
| 168 | Ga0466967_0009738 | 3300045976 | Bacteria | 7158 |
| 169 | Ga0495663_0001533 | 3300046525 | Bacteria | 7262 |
| 170 | Ga0495659_0032502 | 3300046664 | Bacteria | 1827 |
| 171 | Ga0495669_0003083 | 3300046684 | Bacteria | 6851 |
| 172 | Ga0495669_0032147 | 3300046684 | Bacteria | 2306 |
| 173 | Ga0495677_0010900 | 3300047445 | Bacteria | 3330 |
| 174 | Ga0496110_0150010 | 3300048913 | Bacteria | 2110 |
| 175 | Ga0496115_0030760 | 3300048918 | Bacteria | 4226 |
| 176 | Ga0501032_0150877 | 3300049569 | Bacteria | 1528 |
| 177 | Ga0501043_0022431 | 3300049579 | Bacteria | 4952 |
| 178 | Ga0501047_0027918 | 3300049581 | Bacteria | 5439 |
| 179 | Ga0501249_000559 | 3300049679 | Bacteria | 8859 |
| 180 | Ga0501035_0043704 | 3300049822 | Bacteria | 4037 |
| 181 | Ga0501044_0099704 | 3300049823 | Bacteria | 2923 |
| 182 | nmdc:mga06r32_6152_c1 | 3300050510 | Bacteria | 10773 |
| 183 | nmdc:mga08y16_72146_c1 | 3300050511 | Bacteria | 3598 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031911 | Ga0307412_10007706 | Ga0307412_100077064 | 387 |
| 2 | 3300048913 | Ga0496110_0150010 | Ga0496110_0150010_874_2094 | 406 |
| 3 | 3300032004 | Ga0307414_10056012 | Ga0307414_100560122 | 417 |
| 4 | 3300038443 | Ga0395901_0272751 | Ga0395901_0272751_36_1334 | 418 |
| 5 | 3300027876 | Ga0209974_10013014 | Ga0209974_100130143 | 420 |
| 6 | 3300028380 | Ga0268265_10070941 | Ga0268265_100709412 | 420 |
| 7 | 3300026088 | Ga0207641_10000228 | Ga0207641_1000022822 | 421 |
| 8 | 3300031240 | Ga0265320_10002553 | Ga0265320_100025539 | 424 |
| 9 | 3300044712 | Ga0453684_0048407 | Ga0453684_0048407_3420_4724 | 424 |
| 10 | 3300025931 | Ga0207644_10090441 | Ga0207644_100904412 | 426 |
| 11 | 3300005985 | Ga0081539_10034464 | Ga0081539_100344642 | 430 |
| 12 | 3300005327 | Ga0070658_10035966 | Ga0070658_100359664 | 432 |
| 13 | 3300005435 | Ga0070714_100016112 | Ga0070714_1000161127 | 432 |
| 14 | 3300005548 | Ga0070665_100000495 | Ga0070665_1000004959 | 432 |
| 15 | 3300025929 | Ga0207664_10106987 | Ga0207664_101069872 | 432 |
| 16 | 3300028379 | Ga0268266_10000187 | Ga0268266_1000018767 | 432 |
| 17 | 3300044684 | Ga0466966_0017375 | Ga0466966_0017375_3336_4643 | 432 |
| 18 | 3300044694 | Ga0466963_0004364 | Ga0466963_0004364_5710_7017 | 432 |
| 19 | 3300044842 | Ga0466957_0012107 | Ga0466957_0012107_1911_3218 | 432 |
| 20 | 3300045049 | Ga0466959_0040639 | Ga0466959_0040639_1993_3300 | 432 |
| 21 | 3300045976 | Ga0466967_0009738 | Ga0466967_0009738_3275_4582 | 432 |
| 22 | 3300049569 | Ga0501032_0150877 | Ga0501032_0150877_158_1483 | 432 |
| 23 | 3300049579 | Ga0501043_0022431 | Ga0501043_0022431_2624_3949 | 432 |
| 24 | 3300049581 | Ga0501047_0027918 | Ga0501047_0027918_2723_4048 | 432 |
| 25 | 3300049822 | Ga0501035_0043704 | Ga0501035_0043704_1588_2913 | 432 |
| 26 | 3300049823 | Ga0501044_0099704 | Ga0501044_0099704_865_2190 | 432 |
| 27 | 3300002774 | JGI25150J39212_1002146 | JGI25150J39212_10021461 | 434 |
| 28 | 3300003215 | JGI25153J46596_10000044 | JGI25153J46596_10000044126 | 434 |
| 29 | 3300003771 | Ga0055526_1001015 | Ga0055526_100101523 | 434 |
| 30 | 3300003773 | Ga0055537_1001082 | Ga0055537_10010829 | 434 |
| 31 | 3300003781 | Ga0055536_1015446 | Ga0055536_10154462 | 434 |
| 32 | 3300003792 | Ga0055540_1001031 | Ga0055540_100103121 | 434 |
| 33 | 3300025245 | Ga0207425_1000026 | Ga0207425_1000026221 | 434 |
| 34 | 3300025258 | Ga0209129_1003119 | Ga0209129_10031191 | 434 |
| 35 | 3300025263 | Ga0209565_1000064 | Ga0209565_100006445 | 434 |
| 36 | 3300025292 | Ga0209676_1017321 | Ga0209676_10173211 | 434 |
| 37 | 3300025294 | Ga0209025_1000551 | Ga0209025_100055111 | 434 |
| 38 | 3300025295 | Ga0209564_1003266 | Ga0209564_10032668 | 434 |
| 39 | 3300025295 | Ga0209564_1007685 | Ga0209564_10076851 | 434 |
| 40 | 3300025297 | Ga0209758_1000004 | Ga0209758_10000041163 | 434 |
| 41 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000013160 | 434 |
| 42 | 3300025302 | Ga0207426_1034028 | Ga0207426_10340281 | 434 |
| 43 | 3300025303 | Ga0209051_1000977 | Ga0209051_100097729 | 434 |
| 44 | 3300025304 | Ga0209257_1001394 | Ga0209257_100139423 | 434 |
| 45 | 3300025304 | Ga0209257_1001457 | Ga0209257_100145722 | 434 |
| 46 | 3300041413 | Ga0439465_0011637 | Ga0439465_0011637_323_1627 | 434 |
| 47 | 3300001990 | JGI24737J22298_10000759 | JGI24737J22298_100007598 | 436 |
| 48 | 3300005293 | Ga0065715_10002687 | Ga0065715_100026872 | 436 |
| 49 | 3300005331 | Ga0070670_100004106 | Ga0070670_1000041068 | 436 |
| 50 | 3300005331 | Ga0070670_100010512 | Ga0070670_1000105128 | 436 |
| 51 | 3300005331 | Ga0070670_100107426 | Ga0070670_1001074262 | 436 |
| 52 | 3300005331 | Ga0070670_100135237 | Ga0070670_1001352372 | 436 |
| 53 | 3300005333 | Ga0070677_10045930 | Ga0070677_100459302 | 436 |
| 54 | 3300005335 | Ga0070666_10067924 | Ga0070666_100679241 | 436 |
| 55 | 3300005347 | Ga0070668_100000027 | Ga0070668_10000002785 | 436 |
| 56 | 3300005347 | Ga0070668_100007160 | Ga0070668_1000071602 | 436 |
| 57 | 3300005347 | Ga0070668_100064415 | Ga0070668_1000644152 | 436 |
| 58 | 3300005353 | Ga0070669_100005253 | Ga0070669_1000052538 | 436 |
| 59 | 3300005354 | Ga0070675_100001950 | Ga0070675_1000019509 | 436 |
| 60 | 3300005355 | Ga0070671_100000517 | Ga0070671_10000051710 | 436 |
| 61 | 3300005356 | Ga0070674_100013191 | Ga0070674_1000131914 | 436 |
| 62 | 3300005367 | Ga0070667_100000017 | Ga0070667_100000017158 | 436 |
| 63 | 3300005367 | Ga0070667_100010670 | Ga0070667_1000106705 | 436 |
| 64 | 3300005438 | Ga0070701_10028919 | Ga0070701_100289193 | 436 |
| 65 | 3300005457 | Ga0070662_100004739 | Ga0070662_1000047399 | 436 |
| 66 | 3300005539 | Ga0068853_100014481 | Ga0068853_1000144815 | 436 |
| 67 | 3300005543 | Ga0070672_100009625 | Ga0070672_1000096255 | 436 |
| 68 | 3300005564 | Ga0070664_100140697 | Ga0070664_1001406972 | 436 |
| 69 | 3300005578 | Ga0068854_100007103 | Ga0068854_1000071032 | 436 |
| 70 | 3300005617 | Ga0068859_100015868 | Ga0068859_1000158682 | 436 |
| 71 | 3300005618 | Ga0068864_100072697 | Ga0068864_1000726972 | 436 |
| 72 | 3300005719 | Ga0068861_100007076 | Ga0068861_10000707611 | 436 |
| 73 | 3300005840 | Ga0068870_10075650 | Ga0068870_100756502 | 436 |
| 74 | 3300005842 | Ga0068858_100000103 | Ga0068858_1000001035 | 436 |
| 75 | 3300005843 | Ga0068860_100000056 | Ga0068860_10000005686 | 436 |
| 76 | 3300005843 | Ga0068860_100112286 | Ga0068860_1001122863 | 436 |
| 77 | 3300005844 | Ga0068862_100003209 | Ga0068862_10000320911 | 436 |
| 78 | 3300005844 | Ga0068862_100007954 | Ga0068862_10000795411 | 436 |
| 79 | 3300005844 | Ga0068862_100008298 | Ga0068862_1000082985 | 436 |
| 80 | 3300006847 | Ga0075431_100002929 | Ga0075431_10000292914 | 436 |
| 81 | 3300006931 | Ga0097620_100015868 | Ga0097620_1000158682 | 436 |
| 82 | 3300009094 | Ga0111539_10063371 | Ga0111539_100633713 | 436 |
| 83 | 3300009098 | Ga0105245_10012868 | Ga0105245_100128685 | 436 |
| 84 | 3300009553 | Ga0105249_10044324 | Ga0105249_100443243 | 436 |
| 85 | 3300009553 | Ga0105249_10100350 | Ga0105249_101003502 | 436 |
| 86 | 3300014325 | Ga0163163_10205862 | Ga0163163_102058622 | 436 |
| 87 | 3300014326 | Ga0157380_10001003 | Ga0157380_1000100310 | 436 |
| 88 | 3300014326 | Ga0157380_10014580 | Ga0157380_100145803 | 436 |
| 89 | 3300017792 | Ga0163161_10014074 | Ga0163161_100140745 | 436 |
| 90 | 3300025315 | Ga0207697_10001097 | Ga0207697_100010975 | 436 |
| 91 | 3300025893 | Ga0207682_10000194 | Ga0207682_1000019419 | 436 |
| 92 | 3300025923 | Ga0207681_10010533 | Ga0207681_100105332 | 436 |
| 93 | 3300025923 | Ga0207681_10115960 | Ga0207681_101159602 | 436 |
| 94 | 3300025925 | Ga0207650_10002162 | Ga0207650_100021625 | 436 |
| 95 | 3300025925 | Ga0207650_10004509 | Ga0207650_100045095 | 436 |
| 96 | 3300025925 | Ga0207650_10039837 | Ga0207650_100398372 | 436 |
| 97 | 3300025927 | Ga0207687_10009601 | Ga0207687_100096014 | 436 |
| 98 | 3300025931 | Ga0207644_10000066 | Ga0207644_1000006634 | 436 |
| 99 | 3300025931 | Ga0207644_10023854 | Ga0207644_100238542 | 436 |
| 100 | 3300025932 | Ga0207690_10007474 | Ga0207690_100074745 | 436 |
| 101 | 3300025933 | Ga0207706_10000842 | Ga0207706_1000084228 | 436 |
| 102 | 3300025937 | Ga0207669_10008651 | Ga0207669_100086515 | 436 |
| 103 | 3300025940 | Ga0207691_10001329 | Ga0207691_100013299 | 436 |
| 104 | 3300025961 | Ga0207712_10042085 | Ga0207712_100420852 | 436 |
| 105 | 3300025972 | Ga0207668_10000012 | Ga0207668_1000001284 | 436 |
| 106 | 3300025972 | Ga0207668_10002501 | Ga0207668_100025012 | 436 |
| 107 | 3300025972 | Ga0207668_10061429 | Ga0207668_100614292 | 436 |
| 108 | 3300025986 | Ga0207658_10000011 | Ga0207658_1000001185 | 436 |
| 109 | 3300025986 | Ga0207658_10018905 | Ga0207658_100189051 | 436 |
| 110 | 3300026035 | Ga0207703_10000538 | Ga0207703_1000053837 | 436 |
| 111 | 3300026067 | Ga0207678_10043047 | Ga0207678_100430473 | 436 |
| 112 | 3300026088 | Ga0207641_10008110 | Ga0207641_100081103 | 436 |
| 113 | 3300026095 | Ga0207676_10034351 | Ga0207676_100343512 | 436 |
| 114 | 3300026118 | Ga0207675_100004634 | Ga0207675_1000046343 | 436 |
| 115 | 3300026118 | Ga0207675_100045944 | Ga0207675_1000459444 | 436 |
| 116 | 3300027907 | Ga0207428_10068306 | Ga0207428_100683062 | 436 |
| 117 | 3300028380 | Ga0268265_10005447 | Ga0268265_100054475 | 436 |
| 118 | 3300028380 | Ga0268265_10021329 | Ga0268265_100213295 | 436 |
| 119 | 3300028381 | Ga0268264_10000089 | Ga0268264_10000089165 | 436 |
| 120 | 3300031548 | Ga0307408_100005357 | Ga0307408_1000053579 | 436 |
| 121 | 3300031548 | Ga0307408_100010187 | Ga0307408_1000101874 | 436 |
| 122 | 3300031548 | Ga0307408_100274968 | Ga0307408_1002749681 | 436 |
| 123 | 3300031731 | Ga0307405_10009232 | Ga0307405_100092325 | 436 |
| 124 | 3300031731 | Ga0307405_10112303 | Ga0307405_101123032 | 436 |
| 125 | 3300031824 | Ga0307413_10032055 | Ga0307413_100320553 | 436 |
| 126 | 3300031824 | Ga0307413_10095901 | Ga0307413_100959011 | 436 |
| 127 | 3300031824 | Ga0307413_10136598 | Ga0307413_101365982 | 436 |
| 128 | 3300031852 | Ga0307410_10000950 | Ga0307410_1000095016 | 436 |
| 129 | 3300031852 | Ga0307410_10001231 | Ga0307410_100012317 | 436 |
| 130 | 3300031852 | Ga0307410_10041979 | Ga0307410_100419792 | 436 |
| 131 | 3300031852 | Ga0307410_10117778 | Ga0307410_101177781 | 436 |
| 132 | 3300031901 | Ga0307406_10009924 | Ga0307406_100099243 | 436 |
| 133 | 3300031901 | Ga0307406_10109785 | Ga0307406_101097852 | 436 |
| 134 | 3300031901 | Ga0307406_10122834 | Ga0307406_101228342 | 436 |
| 135 | 3300031903 | Ga0307407_10002684 | Ga0307407_100026846 | 436 |
| 136 | 3300031911 | Ga0307412_10003973 | Ga0307412_100039735 | 436 |
| 137 | 3300031911 | Ga0307412_10005581 | Ga0307412_100055812 | 436 |
| 138 | 3300031911 | Ga0307412_10009356 | Ga0307412_100093562 | 436 |
| 139 | 3300031995 | Ga0307409_100010106 | Ga0307409_1000101062 | 436 |
| 140 | 3300031995 | Ga0307409_100068718 | Ga0307409_1000687183 | 436 |
| 141 | 3300031995 | Ga0307409_100144560 | Ga0307409_1001445602 | 436 |
| 142 | 3300032002 | Ga0307416_100004113 | Ga0307416_1000041139 | 436 |
| 143 | 3300032002 | Ga0307416_100005918 | Ga0307416_1000059185 | 436 |
| 144 | 3300032002 | Ga0307416_100006047 | Ga0307416_1000060475 | 436 |
| 145 | 3300032002 | Ga0307416_100006547 | Ga0307416_1000065477 | 436 |
| 146 | 3300032002 | Ga0307416_100037515 | Ga0307416_1000375153 | 436 |
| 147 | 3300032004 | Ga0307414_10002312 | Ga0307414_100023123 | 436 |
| 148 | 3300032004 | Ga0307414_10020178 | Ga0307414_100201783 | 436 |
| 149 | 3300032004 | Ga0307414_10024322 | Ga0307414_100243222 | 436 |
| 150 | 3300032004 | Ga0307414_10074199 | Ga0307414_100741992 | 436 |
| 151 | 3300032004 | Ga0307414_10078149 | Ga0307414_100781492 | 436 |
| 152 | 3300032004 | Ga0307414_10091551 | Ga0307414_100915512 | 436 |
| 153 | 3300032004 | Ga0307414_10130448 | Ga0307414_101304482 | 436 |
| 154 | 3300032004 | Ga0307414_10274989 | Ga0307414_102749891 | 436 |
| 155 | 3300032005 | Ga0307411_10002021 | Ga0307411_100020215 | 436 |
| 156 | 3300032005 | Ga0307411_10027530 | Ga0307411_100275303 | 436 |
| 157 | 3300032005 | Ga0307411_10039694 | Ga0307411_100396943 | 436 |
| 158 | 3300032005 | Ga0307411_10067679 | Ga0307411_100676792 | 436 |
| 159 | 3300032005 | Ga0307411_10075244 | Ga0307411_100752442 | 436 |
| 160 | 3300032005 | Ga0307411_10097372 | Ga0307411_100973722 | 436 |
| 161 | 3300032126 | Ga0307415_100007815 | Ga0307415_1000078154 | 436 |
| 162 | 3300037471 | Ga0395905_0000916 | Ga0395905_0000916_9388_10698 | 436 |
| 163 | 3300038443 | Ga0395901_0000232 | Ga0395901_0000232_61164_62474 | 436 |
| 164 | 3300042118 | Ga0450914_000025 | Ga0450914_000025_1852_3162 | 436 |
| 165 | 3300042142 | Ga0450905_000175 | Ga0450905_000175_1983_3293 | 436 |
| 166 | 3300042144 | Ga0450889_000241 | Ga0450889_000241_986_2296 | 436 |
| 167 | 3300046525 | Ga0495663_0001533 | Ga0495663_0001533_4507_5817 | 436 |
| 168 | 3300046664 | Ga0495659_0032502 | Ga0495659_0032502_85_1395 | 436 |
| 169 | 3300046684 | Ga0495669_0003083 | Ga0495669_0003083_2433_3743 | 436 |
| 170 | 3300046684 | Ga0495669_0032147 | Ga0495669_0032147_75_1385 | 436 |
| 171 | 3300047445 | Ga0495677_0010900 | Ga0495677_0010900_444_1754 | 436 |
| 172 | 3300050510 | nmdc:mga06r32_6152_c1 | nmdc:mga06r32_6152_c1_2955_4265 | 436 |
| 173 | 3300050511 | nmdc:mga08y16_72146_c1 | nmdc:mga08y16_72146_c1_860_2170 | 436 |
| 174 | 3300032005 | Ga0307411_10043277 | Ga0307411_100432773 | 437 |
| 175 | iso_pu_bacteria | 2599185354 | 2600200575 | 437 |
| 176 | iso_pu_bacteria | 2643221541 | 2643730819 | 437 |
| 177 | iso_pu_bacteria | 2643221606 | 2644044528 | 437 |
| 178 | iso_pu_bacteria | 2643221671 | 2644391547 | 437 |
| 179 | iso_pu_bacteria | 2751185897 | 2753763645 | 437 |
| 180 | 3300031824 | Ga0307413_10007915 | Ga0307413_100079154 | 438 |
| 181 | 3300031901 | Ga0307406_10071595 | Ga0307406_100715952 | 438 |
| 182 | 3300031995 | Ga0307409_100044492 | Ga0307409_1000444922 | 438 |
| 183 | 3300032126 | Ga0307415_100179771 | Ga0307415_1001797711 | 438 |
| 184 | 3300039437 | Ga0436365_1651232 | Ga0436365_1651232_2406_3722 | 438 |
| 185 | 3300048918 | Ga0496115_0030760 | Ga0496115_0030760_2520_3845 | 441 |
| 186 | 3300001979 | JGI24740J21852_10008530 | JGI24740J21852_100085303 | 442 |
| 187 | 3300005578 | Ga0068854_100015048 | Ga0068854_1000150483 | 442 |
| 188 | 3300049679 | Ga0501249_000559 | Ga0501249_000559_1565_2908 | 442 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w78-assembly1.cif.gz_A | e.coli folc in complex with dhpp and adp | 0.9377 | 4 | 435 |
| 1w78-assembly1.cif.gz_A | e.coli folc in complex with dhpp and adp | 0.9201 | 4 | 435 |
| 3qcz-assembly1.cif.gz_A | crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase with mn, amppnp and l-glutamate bound | 0.9178 | 4 | 436 |
| 3pyz-assembly1.cif.gz_A | crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase complexed with amppnp and mn ion from yersinia pestis c092 | 0.9165 | 4 | 436 |
| 3n2a-assembly1.cif.gz_A | crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis co92 | 0.9108 | 4 | 436 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXR9_1_294_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9322 | 14 | 293 | 3.40.1190.10 |
| af_Q9UTD0_1_272_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9248 | 28 | 294 | 3.40.1190.10 |
| af_P08192_1_287_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9127 | 1 | 294 | 3.40.1190.10 |
| af_P08192_1_287_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9065 | 1 | 294 | 3.40.1190.10 |
| af_Q9UTD0_1_272_3.40.1190.10 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain | 0.9052 | 28 | 294 | 3.40.1190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A552UF54-F1-model_v4 | Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) | 0.9867 | 3 | 440 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046656 GO:0046872 |
| AF-A0A552UF54-F1-model_v4 | Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) | 0.9778 | 3 | 440 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046656 GO:0046872 |
| AF-A0A435WV06-F1-model_v4 | Bifunctional folylpolyglutamate synthase/dihydrofolate synthase | 0.9763 | 30 | 182 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 |
| AF-A0A382GKW8-F1-model_v4 | Mur ligase central domain-containing protein | 0.9753 | 35 | 209 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 |
| AF-A0A1M3PKK0-F1-model_v4 | Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) | 0.9729 | 1 | 442 |
GO:0004326
GO:0005524 GO:0005737 GO:0008841 GO:0046656 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar