F290038

General Info

Members Datasets Scaffolds Average Seq Length
188 123 183 435

Family's Representative Sequence

Representative Sequence 3300049679|Ga0501249_000559|Ga0501249_000559_1565_2908
Length 447
Sequence MPDFATSTDAAVQAQLDRLWRLSPGADILGLDRIAKLCDRLGNPERALPPVLHVAGTNGKGSTCAYLRAAIEAAGLKAHVFTSPHLVRFNERIRLAGSLIDDEALASLLSEVLDASEGMGADGIGASFFEVTTAAAFLAFSRTPADACIIEVGLGGRLDATNILPAPAICGIAQLGLDHQGFLGDSLEGIGAEKAGIAKPEVPIVTLAYPPGVAARVSETIEAAGGVQLVKGGSWDAAAYQGRLHYRDSQGKLELPLPGLAGEHQALNAALAVAMLRHQSAIAIPTSALRAAMGWADWPARLQPLRGGALVDLLPPGAELWIDGGHNPSAGRVVGDFLRAHVAEGQPVHIVLGLLSNKDAAGFLAAMGRLPARFHMVPVPGHEHHAPATLAETARLAGFDAAPAAGFEEALRTIGAGTPGDMPPMVLVGGSLYLAGRALEANGTVVD

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
4 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
5 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
102 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
103 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.34
Metatranscriptomes 0
Isolates 2.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.11
Nodule 0
Rhizoplane 1.6
Rhizosphere 85.64
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008530 3300001979 Bacteria 4077
2 JGI24737J22298_10000759 3300001990 Bacteria 11386
3 JGI25150J39212_1002146 3300002774 Bacteria 5087
4 JGI25153J46596_10000044 3300003215 Bacteria 154263
5 Ga0055526_1001015 3300003771 Bacteria 20581
6 Ga0055537_1001082 3300003773 Bacteria 11973
7 Ga0055536_1015446 3300003781 Bacteria 2612
8 Ga0055540_1001031 3300003792 Bacteria 17839
9 Ga0065715_10002687 3300005293 Bacteria 5566
10 Ga0070658_10035966 3300005327 Bacteria 3990
11 Ga0070670_100004106 3300005331 Bacteria 12167
12 Ga0070670_100010512 3300005331 Bacteria 7902
13 Ga0070670_100107426 3300005331 Bacteria 2405
14 Ga0070670_100135237 3300005331 Bacteria 2130
15 Ga0070677_10045930 3300005333 Bacteria 1744
16 Ga0070666_10067924 3300005335 Bacteria 2421
17 Ga0070668_100000027 3300005347 Bacteria 89913
18 Ga0070668_100007160 3300005347 Bacteria 8268
19 Ga0070668_100064415 3300005347 Bacteria 2842
20 Ga0070669_100005253 3300005353 Bacteria 9348
21 Ga0070675_100001950 3300005354 Bacteria 15280
22 Ga0070671_100000517 3300005355 Bacteria 27085
23 Ga0070674_100013191 3300005356 Bacteria 5100
24 Ga0070667_100000017 3300005367 Bacteria 230531
25 Ga0070667_100010670 3300005367 Bacteria 7589
26 Ga0070714_100016112 3300005435 Bacteria 6027
27 Ga0070701_10028919 3300005438 Bacteria 2727
28 Ga0070662_100004739 3300005457 Bacteria 8618
29 Ga0068853_100014481 3300005539 Bacteria 6460
30 Ga0070672_100009625 3300005543 Bacteria 6669
31 Ga0070665_100000495 3300005548 Bacteria 56309
32 Ga0070664_100140697 3300005564 Bacteria 2125
33 Ga0068854_100007103 3300005578 Bacteria 7149
34 Ga0068854_100015048 3300005578 Bacteria 5115
35 Ga0068859_100015868 3300005617 Bacteria 7569
36 Ga0068864_100072697 3300005618 Bacteria 2998
37 Ga0068861_100007076 3300005719 Bacteria 7676
38 Ga0068870_10075650 3300005840 Bacteria 1847
39 Ga0068858_100000103 3300005842 Bacteria 88754
40 Ga0068860_100000056 3300005843 Bacteria 202751
41 Ga0068860_100112286 3300005843 Bacteria 2606
42 Ga0068862_100003209 3300005844 Bacteria 14172
43 Ga0068862_100007954 3300005844 Bacteria 8771
44 Ga0068862_100008298 3300005844 Bacteria 8596
45 Ga0081539_10034464 3300005985 Bacteria 3061
46 Ga0075431_100002929 3300006847 Bacteria 16528
47 Ga0097620_100015868 3300006931 Bacteria 7569
48 Ga0111539_10063371 3300009094 Bacteria 4375
49 Ga0105245_10012868 3300009098 Bacteria 7292
50 Ga0105249_10044324 3300009553 Bacteria 4045
51 Ga0105249_10100350 3300009553 Bacteria 2722
52 Ga0163163_10205862 3300014325 Bacteria 2016
53 Ga0157380_10001003 3300014326 Bacteria 17954
54 Ga0157380_10014580 3300014326 Bacteria 5755
55 Ga0163161_10014074 3300017792 Bacteria 5569
56 Ga0207425_1000026 3300025245 Bacteria 301303
57 Ga0209129_1003119 3300025258 Bacteria 7453
58 Ga0209565_1000064 3300025263 Bacteria 180732
59 Ga0209676_1017321 3300025292 Bacteria 2556
60 Ga0209025_1000551 3300025294 Bacteria 69956
61 Ga0209564_1003266 3300025295 Bacteria 11313
62 Ga0209564_1007685 3300025295 Bacteria 5497
63 Ga0209758_1000004 3300025297 Bacteria 1375322
64 Ga0209050_1000001 3300025298 Bacteria 3563507
65 Ga0207426_1034028 3300025302 Bacteria 1638
66 Ga0209051_1000977 3300025303 Bacteria 27827
67 Ga0209257_1001394 3300025304 Bacteria 28964
68 Ga0209257_1001457 3300025304 Bacteria 27957
69 Ga0207697_10001097 3300025315 Bacteria 14929
70 Ga0207682_10000194 3300025893 Bacteria 27727
71 Ga0207681_10010533 3300025923 Bacteria 5664
72 Ga0207681_10115960 3300025923 Bacteria 1956
73 Ga0207650_10002162 3300025925 Bacteria 13739
74 Ga0207650_10004509 3300025925 Bacteria 9523
75 Ga0207650_10039837 3300025925 Bacteria 3435
76 Ga0207687_10009601 3300025927 Bacteria 6325
77 Ga0207664_10106987 3300025929 Bacteria 2320
78 Ga0207644_10000066 3300025931 Bacteria 76450
79 Ga0207644_10023854 3300025931 Bacteria 4195
80 Ga0207644_10090441 3300025931 Bacteria 2281
81 Ga0207690_10007474 3300025932 Bacteria 6485
82 Ga0207706_10000842 3300025933 Bacteria 31703
83 Ga0207669_10008651 3300025937 Bacteria 4792
84 Ga0207691_10001329 3300025940 Bacteria 24679
85 Ga0207712_10042085 3300025961 Bacteria 3144
86 Ga0207668_10000012 3300025972 Bacteria 182541
87 Ga0207668_10002501 3300025972 Bacteria 10730
88 Ga0207668_10061429 3300025972 Bacteria 2643
89 Ga0207658_10000011 3300025986 Bacteria 239620
90 Ga0207658_10018905 3300025986 Bacteria 4765
91 Ga0207703_10000538 3300026035 Bacteria 38989
92 Ga0207678_10043047 3300026067 Bacteria 3909
93 Ga0207641_10000228 3300026088 Bacteria 72357
94 Ga0207641_10008110 3300026088 Bacteria 8698
95 Ga0207676_10034351 3300026095 Bacteria 3839
96 Ga0207675_100004634 3300026118 Bacteria 13247
97 Ga0207675_100045944 3300026118 Bacteria 4079
98 Ga0209974_10013014 3300027876 Bacteria 2775
99 Ga0207428_10068306 3300027907 Bacteria 2796
100 Ga0268266_10000187 3300028379 Bacteria 110229
101 Ga0268265_10005447 3300028380 Bacteria 8696
102 Ga0268265_10021329 3300028380 Bacteria 4536
103 Ga0268265_10070941 3300028380 Bacteria 2711
104 Ga0268264_10000089 3300028381 Bacteria 234760
105 Ga0265320_10002553 3300031240 Bacteria 12651
106 Ga0307408_100005357 3300031548 Bacteria 8594
107 Ga0307408_100010187 3300031548 Bacteria 6203
108 Ga0307408_100274968 3300031548 Bacteria 1400
109 Ga0307405_10009232 3300031731 Bacteria 5046
110 Ga0307405_10112303 3300031731 Bacteria 1849
111 Ga0307413_10007915 3300031824 Bacteria 4974
112 Ga0307413_10032055 3300031824 Bacteria 2973
113 Ga0307413_10095901 3300031824 Bacteria 1946
114 Ga0307413_10136598 3300031824 Bacteria 1687
115 Ga0307410_10000950 3300031852 Bacteria 12438
116 Ga0307410_10001231 3300031852 Bacteria 11376
117 Ga0307410_10041979 3300031852 Bacteria 3020
118 Ga0307410_10117778 3300031852 Bacteria 1932
119 Ga0307406_10009924 3300031901 Bacteria 5359
120 Ga0307406_10071595 3300031901 Bacteria 2272
121 Ga0307406_10109785 3300031901 Bacteria 1897
122 Ga0307406_10122834 3300031901 Bacteria 1808
123 Ga0307407_10002684 3300031903 Bacteria 7053
124 Ga0307412_10003973 3300031911 Bacteria 8241
125 Ga0307412_10005581 3300031911 Bacteria 7063
126 Ga0307412_10007706 3300031911 Bacteria 6120
127 Ga0307412_10009356 3300031911 Bacteria 5619
128 Ga0307409_100010106 3300031995 Bacteria 5841
129 Ga0307409_100044492 3300031995 Bacteria 3344
130 Ga0307409_100068718 3300031995 Bacteria 2803
131 Ga0307409_100144560 3300031995 Bacteria 2054
132 Ga0307416_100004113 3300032002 Bacteria 8710
133 Ga0307416_100005918 3300032002 Bacteria 7593
134 Ga0307416_100006047 3300032002 Bacteria 7534
135 Ga0307416_100006547 3300032002 Bacteria 7302
136 Ga0307416_100037515 3300032002 Bacteria 3729
137 Ga0307414_10002312 3300032004 Bacteria 9958
138 Ga0307414_10020178 3300032004 Bacteria 4148
139 Ga0307414_10024322 3300032004 Bacteria 3861
140 Ga0307414_10056012 3300032004 Bacteria 2763
141 Ga0307414_10074199 3300032004 Bacteria 2463
142 Ga0307414_10078149 3300032004 Bacteria 2411
143 Ga0307414_10091551 3300032004 Bacteria 2260
144 Ga0307414_10130448 3300032004 Bacteria 1950
145 Ga0307414_10274989 3300032004 Bacteria 1412
146 Ga0307411_10002021 3300032005 Bacteria 8698
147 Ga0307411_10027530 3300032005 Bacteria 3441
148 Ga0307411_10039694 3300032005 Bacteria 2979
149 Ga0307411_10043277 3300032005 Bacteria 2880
150 Ga0307411_10067679 3300032005 Bacteria 2404
151 Ga0307411_10075244 3300032005 Bacteria 2304
152 Ga0307411_10097372 3300032005 Bacteria 2070
153 Ga0307415_100007815 3300032126 Bacteria 5876
154 Ga0307415_100179771 3300032126 Bacteria 1659
155 Ga0395905_0000916 3300037471 Bacteria 38099
156 Ga0395901_0000232 3300038443 Bacteria 69963
157 Ga0395901_0272751 3300038443 Bacteria 1759
158 Ga0436365_1651232 3300039437 Bacteria 4808
159 Ga0439465_0011637 3300041413 Bacteria 2761
160 Ga0450914_000025 3300042118 Bacteria 3351
161 Ga0450905_000175 3300042142 Bacteria 7050
162 Ga0450889_000241 3300042144 Bacteria 6040
163 Ga0466966_0017375 3300044684 Bacteria 4754
164 Ga0466963_0004364 3300044694 Bacteria 8215
165 Ga0453684_0048407 3300044712 Bacteria 5623
166 Ga0466957_0012107 3300044842 Bacteria 4989
167 Ga0466959_0040639 3300045049 Bacteria 3435
168 Ga0466967_0009738 3300045976 Bacteria 7158
169 Ga0495663_0001533 3300046525 Bacteria 7262
170 Ga0495659_0032502 3300046664 Bacteria 1827
171 Ga0495669_0003083 3300046684 Bacteria 6851
172 Ga0495669_0032147 3300046684 Bacteria 2306
173 Ga0495677_0010900 3300047445 Bacteria 3330
174 Ga0496110_0150010 3300048913 Bacteria 2110
175 Ga0496115_0030760 3300048918 Bacteria 4226
176 Ga0501032_0150877 3300049569 Bacteria 1528
177 Ga0501043_0022431 3300049579 Bacteria 4952
178 Ga0501047_0027918 3300049581 Bacteria 5439
179 Ga0501249_000559 3300049679 Bacteria 8859
180 Ga0501035_0043704 3300049822 Bacteria 4037
181 Ga0501044_0099704 3300049823 Bacteria 2923
182 nmdc:mga06r32_6152_c1 3300050510 Bacteria 10773
183 nmdc:mga08y16_72146_c1 3300050511 Bacteria 3598

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10007706 Ga0307412_100077064 387
2 3300048913 Ga0496110_0150010 Ga0496110_0150010_874_2094 406
3 3300032004 Ga0307414_10056012 Ga0307414_100560122 417
4 3300038443 Ga0395901_0272751 Ga0395901_0272751_36_1334 418
5 3300027876 Ga0209974_10013014 Ga0209974_100130143 420
6 3300028380 Ga0268265_10070941 Ga0268265_100709412 420
7 3300026088 Ga0207641_10000228 Ga0207641_1000022822 421
8 3300031240 Ga0265320_10002553 Ga0265320_100025539 424
9 3300044712 Ga0453684_0048407 Ga0453684_0048407_3420_4724 424
10 3300025931 Ga0207644_10090441 Ga0207644_100904412 426
11 3300005985 Ga0081539_10034464 Ga0081539_100344642 430
12 3300005327 Ga0070658_10035966 Ga0070658_100359664 432
13 3300005435 Ga0070714_100016112 Ga0070714_1000161127 432
14 3300005548 Ga0070665_100000495 Ga0070665_1000004959 432
15 3300025929 Ga0207664_10106987 Ga0207664_101069872 432
16 3300028379 Ga0268266_10000187 Ga0268266_1000018767 432
17 3300044684 Ga0466966_0017375 Ga0466966_0017375_3336_4643 432
18 3300044694 Ga0466963_0004364 Ga0466963_0004364_5710_7017 432
19 3300044842 Ga0466957_0012107 Ga0466957_0012107_1911_3218 432
20 3300045049 Ga0466959_0040639 Ga0466959_0040639_1993_3300 432
21 3300045976 Ga0466967_0009738 Ga0466967_0009738_3275_4582 432
22 3300049569 Ga0501032_0150877 Ga0501032_0150877_158_1483 432
23 3300049579 Ga0501043_0022431 Ga0501043_0022431_2624_3949 432
24 3300049581 Ga0501047_0027918 Ga0501047_0027918_2723_4048 432
25 3300049822 Ga0501035_0043704 Ga0501035_0043704_1588_2913 432
26 3300049823 Ga0501044_0099704 Ga0501044_0099704_865_2190 432
27 3300002774 JGI25150J39212_1002146 JGI25150J39212_10021461 434
28 3300003215 JGI25153J46596_10000044 JGI25153J46596_10000044126 434
29 3300003771 Ga0055526_1001015 Ga0055526_100101523 434
30 3300003773 Ga0055537_1001082 Ga0055537_10010829 434
31 3300003781 Ga0055536_1015446 Ga0055536_10154462 434
32 3300003792 Ga0055540_1001031 Ga0055540_100103121 434
33 3300025245 Ga0207425_1000026 Ga0207425_1000026221 434
34 3300025258 Ga0209129_1003119 Ga0209129_10031191 434
35 3300025263 Ga0209565_1000064 Ga0209565_100006445 434
36 3300025292 Ga0209676_1017321 Ga0209676_10173211 434
37 3300025294 Ga0209025_1000551 Ga0209025_100055111 434
38 3300025295 Ga0209564_1003266 Ga0209564_10032668 434
39 3300025295 Ga0209564_1007685 Ga0209564_10076851 434
40 3300025297 Ga0209758_1000004 Ga0209758_10000041163 434
41 3300025298 Ga0209050_1000001 Ga0209050_10000013160 434
42 3300025302 Ga0207426_1034028 Ga0207426_10340281 434
43 3300025303 Ga0209051_1000977 Ga0209051_100097729 434
44 3300025304 Ga0209257_1001394 Ga0209257_100139423 434
45 3300025304 Ga0209257_1001457 Ga0209257_100145722 434
46 3300041413 Ga0439465_0011637 Ga0439465_0011637_323_1627 434
47 3300001990 JGI24737J22298_10000759 JGI24737J22298_100007598 436
48 3300005293 Ga0065715_10002687 Ga0065715_100026872 436
49 3300005331 Ga0070670_100004106 Ga0070670_1000041068 436
50 3300005331 Ga0070670_100010512 Ga0070670_1000105128 436
51 3300005331 Ga0070670_100107426 Ga0070670_1001074262 436
52 3300005331 Ga0070670_100135237 Ga0070670_1001352372 436
53 3300005333 Ga0070677_10045930 Ga0070677_100459302 436
54 3300005335 Ga0070666_10067924 Ga0070666_100679241 436
55 3300005347 Ga0070668_100000027 Ga0070668_10000002785 436
56 3300005347 Ga0070668_100007160 Ga0070668_1000071602 436
57 3300005347 Ga0070668_100064415 Ga0070668_1000644152 436
58 3300005353 Ga0070669_100005253 Ga0070669_1000052538 436
59 3300005354 Ga0070675_100001950 Ga0070675_1000019509 436
60 3300005355 Ga0070671_100000517 Ga0070671_10000051710 436
61 3300005356 Ga0070674_100013191 Ga0070674_1000131914 436
62 3300005367 Ga0070667_100000017 Ga0070667_100000017158 436
63 3300005367 Ga0070667_100010670 Ga0070667_1000106705 436
64 3300005438 Ga0070701_10028919 Ga0070701_100289193 436
65 3300005457 Ga0070662_100004739 Ga0070662_1000047399 436
66 3300005539 Ga0068853_100014481 Ga0068853_1000144815 436
67 3300005543 Ga0070672_100009625 Ga0070672_1000096255 436
68 3300005564 Ga0070664_100140697 Ga0070664_1001406972 436
69 3300005578 Ga0068854_100007103 Ga0068854_1000071032 436
70 3300005617 Ga0068859_100015868 Ga0068859_1000158682 436
71 3300005618 Ga0068864_100072697 Ga0068864_1000726972 436
72 3300005719 Ga0068861_100007076 Ga0068861_10000707611 436
73 3300005840 Ga0068870_10075650 Ga0068870_100756502 436
74 3300005842 Ga0068858_100000103 Ga0068858_1000001035 436
75 3300005843 Ga0068860_100000056 Ga0068860_10000005686 436
76 3300005843 Ga0068860_100112286 Ga0068860_1001122863 436
77 3300005844 Ga0068862_100003209 Ga0068862_10000320911 436
78 3300005844 Ga0068862_100007954 Ga0068862_10000795411 436
79 3300005844 Ga0068862_100008298 Ga0068862_1000082985 436
80 3300006847 Ga0075431_100002929 Ga0075431_10000292914 436
81 3300006931 Ga0097620_100015868 Ga0097620_1000158682 436
82 3300009094 Ga0111539_10063371 Ga0111539_100633713 436
83 3300009098 Ga0105245_10012868 Ga0105245_100128685 436
84 3300009553 Ga0105249_10044324 Ga0105249_100443243 436
85 3300009553 Ga0105249_10100350 Ga0105249_101003502 436
86 3300014325 Ga0163163_10205862 Ga0163163_102058622 436
87 3300014326 Ga0157380_10001003 Ga0157380_1000100310 436
88 3300014326 Ga0157380_10014580 Ga0157380_100145803 436
89 3300017792 Ga0163161_10014074 Ga0163161_100140745 436
90 3300025315 Ga0207697_10001097 Ga0207697_100010975 436
91 3300025893 Ga0207682_10000194 Ga0207682_1000019419 436
92 3300025923 Ga0207681_10010533 Ga0207681_100105332 436
93 3300025923 Ga0207681_10115960 Ga0207681_101159602 436
94 3300025925 Ga0207650_10002162 Ga0207650_100021625 436
95 3300025925 Ga0207650_10004509 Ga0207650_100045095 436
96 3300025925 Ga0207650_10039837 Ga0207650_100398372 436
97 3300025927 Ga0207687_10009601 Ga0207687_100096014 436
98 3300025931 Ga0207644_10000066 Ga0207644_1000006634 436
99 3300025931 Ga0207644_10023854 Ga0207644_100238542 436
100 3300025932 Ga0207690_10007474 Ga0207690_100074745 436
101 3300025933 Ga0207706_10000842 Ga0207706_1000084228 436
102 3300025937 Ga0207669_10008651 Ga0207669_100086515 436
103 3300025940 Ga0207691_10001329 Ga0207691_100013299 436
104 3300025961 Ga0207712_10042085 Ga0207712_100420852 436
105 3300025972 Ga0207668_10000012 Ga0207668_1000001284 436
106 3300025972 Ga0207668_10002501 Ga0207668_100025012 436
107 3300025972 Ga0207668_10061429 Ga0207668_100614292 436
108 3300025986 Ga0207658_10000011 Ga0207658_1000001185 436
109 3300025986 Ga0207658_10018905 Ga0207658_100189051 436
110 3300026035 Ga0207703_10000538 Ga0207703_1000053837 436
111 3300026067 Ga0207678_10043047 Ga0207678_100430473 436
112 3300026088 Ga0207641_10008110 Ga0207641_100081103 436
113 3300026095 Ga0207676_10034351 Ga0207676_100343512 436
114 3300026118 Ga0207675_100004634 Ga0207675_1000046343 436
115 3300026118 Ga0207675_100045944 Ga0207675_1000459444 436
116 3300027907 Ga0207428_10068306 Ga0207428_100683062 436
117 3300028380 Ga0268265_10005447 Ga0268265_100054475 436
118 3300028380 Ga0268265_10021329 Ga0268265_100213295 436
119 3300028381 Ga0268264_10000089 Ga0268264_10000089165 436
120 3300031548 Ga0307408_100005357 Ga0307408_1000053579 436
121 3300031548 Ga0307408_100010187 Ga0307408_1000101874 436
122 3300031548 Ga0307408_100274968 Ga0307408_1002749681 436
123 3300031731 Ga0307405_10009232 Ga0307405_100092325 436
124 3300031731 Ga0307405_10112303 Ga0307405_101123032 436
125 3300031824 Ga0307413_10032055 Ga0307413_100320553 436
126 3300031824 Ga0307413_10095901 Ga0307413_100959011 436
127 3300031824 Ga0307413_10136598 Ga0307413_101365982 436
128 3300031852 Ga0307410_10000950 Ga0307410_1000095016 436
129 3300031852 Ga0307410_10001231 Ga0307410_100012317 436
130 3300031852 Ga0307410_10041979 Ga0307410_100419792 436
131 3300031852 Ga0307410_10117778 Ga0307410_101177781 436
132 3300031901 Ga0307406_10009924 Ga0307406_100099243 436
133 3300031901 Ga0307406_10109785 Ga0307406_101097852 436
134 3300031901 Ga0307406_10122834 Ga0307406_101228342 436
135 3300031903 Ga0307407_10002684 Ga0307407_100026846 436
136 3300031911 Ga0307412_10003973 Ga0307412_100039735 436
137 3300031911 Ga0307412_10005581 Ga0307412_100055812 436
138 3300031911 Ga0307412_10009356 Ga0307412_100093562 436
139 3300031995 Ga0307409_100010106 Ga0307409_1000101062 436
140 3300031995 Ga0307409_100068718 Ga0307409_1000687183 436
141 3300031995 Ga0307409_100144560 Ga0307409_1001445602 436
142 3300032002 Ga0307416_100004113 Ga0307416_1000041139 436
143 3300032002 Ga0307416_100005918 Ga0307416_1000059185 436
144 3300032002 Ga0307416_100006047 Ga0307416_1000060475 436
145 3300032002 Ga0307416_100006547 Ga0307416_1000065477 436
146 3300032002 Ga0307416_100037515 Ga0307416_1000375153 436
147 3300032004 Ga0307414_10002312 Ga0307414_100023123 436
148 3300032004 Ga0307414_10020178 Ga0307414_100201783 436
149 3300032004 Ga0307414_10024322 Ga0307414_100243222 436
150 3300032004 Ga0307414_10074199 Ga0307414_100741992 436
151 3300032004 Ga0307414_10078149 Ga0307414_100781492 436
152 3300032004 Ga0307414_10091551 Ga0307414_100915512 436
153 3300032004 Ga0307414_10130448 Ga0307414_101304482 436
154 3300032004 Ga0307414_10274989 Ga0307414_102749891 436
155 3300032005 Ga0307411_10002021 Ga0307411_100020215 436
156 3300032005 Ga0307411_10027530 Ga0307411_100275303 436
157 3300032005 Ga0307411_10039694 Ga0307411_100396943 436
158 3300032005 Ga0307411_10067679 Ga0307411_100676792 436
159 3300032005 Ga0307411_10075244 Ga0307411_100752442 436
160 3300032005 Ga0307411_10097372 Ga0307411_100973722 436
161 3300032126 Ga0307415_100007815 Ga0307415_1000078154 436
162 3300037471 Ga0395905_0000916 Ga0395905_0000916_9388_10698 436
163 3300038443 Ga0395901_0000232 Ga0395901_0000232_61164_62474 436
164 3300042118 Ga0450914_000025 Ga0450914_000025_1852_3162 436
165 3300042142 Ga0450905_000175 Ga0450905_000175_1983_3293 436
166 3300042144 Ga0450889_000241 Ga0450889_000241_986_2296 436
167 3300046525 Ga0495663_0001533 Ga0495663_0001533_4507_5817 436
168 3300046664 Ga0495659_0032502 Ga0495659_0032502_85_1395 436
169 3300046684 Ga0495669_0003083 Ga0495669_0003083_2433_3743 436
170 3300046684 Ga0495669_0032147 Ga0495669_0032147_75_1385 436
171 3300047445 Ga0495677_0010900 Ga0495677_0010900_444_1754 436
172 3300050510 nmdc:mga06r32_6152_c1 nmdc:mga06r32_6152_c1_2955_4265 436
173 3300050511 nmdc:mga08y16_72146_c1 nmdc:mga08y16_72146_c1_860_2170 436
174 3300032005 Ga0307411_10043277 Ga0307411_100432773 437
175 iso_pu_bacteria 2599185354 2600200575 437
176 iso_pu_bacteria 2643221541 2643730819 437
177 iso_pu_bacteria 2643221606 2644044528 437
178 iso_pu_bacteria 2643221671 2644391547 437
179 iso_pu_bacteria 2751185897 2753763645 437
180 3300031824 Ga0307413_10007915 Ga0307413_100079154 438
181 3300031901 Ga0307406_10071595 Ga0307406_100715952 438
182 3300031995 Ga0307409_100044492 Ga0307409_1000444922 438
183 3300032126 Ga0307415_100179771 Ga0307415_1001797711 438
184 3300039437 Ga0436365_1651232 Ga0436365_1651232_2406_3722 438
185 3300048918 Ga0496115_0030760 Ga0496115_0030760_2520_3845 441
186 3300001979 JGI24740J21852_10008530 JGI24740J21852_100085303 442
187 3300005578 Ga0068854_100015048 Ga0068854_1000150483 442
188 3300049679 Ga0501249_000559 Ga0501249_000559_1565_2908 442

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w78-assembly1.cif.gz_A e.coli folc in complex with dhpp and adp 0.9377 4 435
1w78-assembly1.cif.gz_A e.coli folc in complex with dhpp and adp 0.9201 4 435
3qcz-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase with mn, amppnp and l-glutamate bound 0.9178 4 436
3pyz-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase complexed with amppnp and mn ion from yersinia pestis c092 0.9165 4 436
3n2a-assembly1.cif.gz_A crystal structure of bifunctional folylpolyglutamate synthase/dihydrofolate synthase from yersinia pestis co92 0.9108 4 436
ID Description Score Start End Superfamily
af_Q2FXR9_1_294_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9322 14 293 3.40.1190.10
af_Q9UTD0_1_272_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9248 28 294 3.40.1190.10
af_P08192_1_287_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9127 1 294 3.40.1190.10
af_P08192_1_287_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9065 1 294 3.40.1190.10
af_Q9UTD0_1_272_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9052 28 294 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A552UF54-F1-model_v4 Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) 0.9867 3 440 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046656
GO:0046872
AF-A0A552UF54-F1-model_v4 Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) 0.9778 3 440 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046656
GO:0046872
AF-A0A435WV06-F1-model_v4 Bifunctional folylpolyglutamate synthase/dihydrofolate synthase 0.9763 30 182 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-A0A382GKW8-F1-model_v4 Mur ligase central domain-containing protein 0.9753 35 209 GO:0004326
GO:0005524
GO:0005737
GO:0008841
AF-A0A1M3PKK0-F1-model_v4 Dihydrofolate synthase/folylpolyglutamate synthase (EC 6.3.2.12) (EC 6.3.2.17) (Folylpoly-gamma-glutamate synthetase-dihydrofolate synthetase) (Folylpolyglutamate synthetase) (Tetrahydrofolylpolyglutamate synthase) 0.9729 1 442 GO:0004326
GO:0005524
GO:0005737
GO:0008841
GO:0046656
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.37 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map