F289704

General Info

Members Datasets Scaffolds Average Seq Length
188 152 167 323

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0280615|Ga0436365_0280615_558_1589
Length 343
Sequence LPVKRGNDNDELRLDQENVMSSNKADLILIGPKKAVFLERLAPAFDVHVLSEAKDRDALMGKLADRVRALAVTYSNEKVSAEFMSRLPKLEIVSSFGVGYDHVDAKWAGAHGIVVTNTPDVLNEEVADTALGLLLCTVREFPQAERYLRAGKWEQKAYPLSGATLRDRTAGVVGMGRIGRAIARRLDAFGVPVVYHSRHPVPAVPYRHYPNLLAMAKDADILIVIVPGGAETRNMINAQVLDALGPNGILINVARGSVVDEPALIKALQEKKIRAAGLDVFVHEPKVPKELMEMDNVVLFPHLGSASVYTRAQMDLLVVDNLLSWAAGKGPLTPVPEAMPKPK

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2516143018 Ensifer sp. BR816 Isolate Nodule
3 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
4 2643221736 Bosea sp. Root483D1 Isolate Unclassified
5 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
6 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
7 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
8 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
9 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
10 2841760612 Bosea sp. Tri-49 Isolate Nodule
11 2844104063 Bosea sp. Tri-39 Isolate Nodule
12 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
13 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
14 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
15 2851182111 Bosea sp. Tri-44 Isolate Nodule
16 2851246043 Bosea sp. Tri-54 Isolate Nodule
17 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
18 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
19 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
20 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
63 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
64 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
145 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
146 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
150 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.83
Metatranscriptomes 0
Isolates 11.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.64
Nodule 8.51
Rhizoplane 4.26
Rhizosphere 66.49
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006423 3300002987 Bacteria 3523
2 Ga0065165_1000313 3300005262 Bacteria 79494
3 Ga0065712_10112538 3300005290 Bacteria 1792
4 Ga0070677_10000815 3300005333 Bacteria 10310
5 Ga0070689_100089205 3300005340 Bacteria 2428
6 Ga0070675_100049763 3300005354 Bacteria 3440
7 Ga0070674_100094231 3300005356 Bacteria 2168
8 Ga0070674_100257645 3300005356 Bacteria 1373
9 Ga0070673_100379683 3300005364 Bacteria 1260
10 Ga0070662_100239492 3300005457 Bacteria 1455
11 Ga0070681_10465923 3300005458 Bacteria 1176
12 Ga0068867_100043259 3300005459 Bacteria 3297
13 Ga0070685_10007883 3300005466 Bacteria 5455
14 Ga0070699_100245996 3300005518 Bacteria 1597
15 Ga0070686_100047314 3300005544 Bacteria 2719
16 Ga0068857_100202947 3300005577 Bacteria 1807
17 Ga0068856_100692996 3300005614 Bacteria 1039
18 Ga0068859_100059579 3300005617 Bacteria 3846
19 Ga0081538_10004000 3300005981 Bacteria 13727
20 Ga0081539_10002801 3300005985 Bacteria 23305
21 Ga0070717_10141047 3300006028 Bacteria 2079
22 Ga0075365_10109002 3300006038 Bacteria 1902
23 Ga0075367_10107627 3300006178 Bacteria 1709
24 Ga0075369_10029566 3300006186 Bacteria 2302
25 Ga0075427_10000298 3300006194 Bacteria 5395
26 Ga0075428_100104669 3300006844 Bacteria 3086
27 Ga0075430_100000070 3300006846 Bacteria 55805
28 Ga0075430_100078887 3300006846 Bacteria 2760
29 Ga0075431_100001221 3300006847 Bacteria 23276
30 Ga0075431_100047033 3300006847 Bacteria 4448
31 Ga0075433_10000867 3300006852 Bacteria 21175
32 Ga0075433_10066834 3300006852 Bacteria 3155
33 Ga0075434_100000212 3300006871 Bacteria 39628
34 Ga0075434_100012794 3300006871 Bacteria 7966
35 Ga0075434_100106711 3300006871 Bacteria 2811
36 Ga0075429_100003999 3300006880 Bacteria 12622
37 Ga0075436_100002520 3300006914 Bacteria 12602
38 Ga0097620_100059581 3300006931 Bacteria 3846
39 Ga0075435_100015735 3300007076 Bacteria 5690
40 Ga0075435_100030430 3300007076 Bacteria 4245
41 Ga0075435_100164960 3300007076 Bacteria 1868
42 Ga0099795_10012000 3300007788 Bacteria 2613
43 Ga0111539_10000138 3300009094 Bacteria 82968
44 Ga0114129_10134976 3300009147 Bacteria 3386
45 Ga0114129_10160627 3300009147 Bacteria 3070
46 Ga0105246_10086911 3300011119 Bacteria 2243
47 Ga0157369_10175270 3300013105 Bacteria 2258
48 Ga0163163_10003057 3300014325 Bacteria 14159
49 Ga0157380_10062136 3300014326 Bacteria 2991
50 Ga0157376_10072515 3300014969 Bacteria 2929
51 Ga0214544_1000063 3300021320 Bacteria 129929
52 Ga0214542_1000095 3300021321 Bacteria 116012
53 Ga0214542_1011630 3300021321 Bacteria 11926
54 Ga0214543_1000008 3300021327 Bacteria 385680
55 Ga0214543_1000026 3300021327 Bacteria 220652
56 Ga0213875_10082825 3300021388 Bacteria 1497
57 Ga0213875_10121792 3300021388 Bacteria 1219
58 Ga0209130_1000209 3300025284 Bacteria 78300
59 Ga0209025_1010153 3300025294 Bacteria 6423
60 Ga0207426_1007808 3300025302 Bacteria 4426
61 Ga0207682_10002016 3300025893 Bacteria 9198
62 Ga0207684_10017572 3300025910 Bacteria 6134
63 Ga0207707_10129721 3300025912 Bacteria 2205
64 Ga0207707_10309696 3300025912 Bacteria 1365
65 Ga0207660_10004685 3300025917 Bacteria 8908
66 Ga0207662_10029669 3300025918 Bacteria 3170
67 Ga0207659_10023619 3300025926 Bacteria 4106
68 Ga0207700_10133902 3300025928 Bacteria 2027
69 Ga0207700_10141421 3300025928 Bacteria 1978
70 Ga0207706_10157403 3300025933 Bacteria 1997
71 Ga0207709_10117338 3300025935 Bacteria 1791
72 Ga0207670_10104238 3300025936 Bacteria 2031
73 Ga0207689_10093796 3300025942 Bacteria 2466
74 Ga0207640_10032173 3300025981 Bacteria 3251
75 Ga0207648_10016754 3300026089 Bacteria 6685
76 Ga0207674_10147277 3300026116 Bacteria 2313
77 Ga0207683_10004971 3300026121 Bacteria 11437
78 Ga0207428_10000075 3300027907 Bacteria 137887
79 Ga0265337_1000182 3300028556 Bacteria 33103
80 Ga0265330_10034767 3300031235 Bacteria 2250
81 Ga0265332_10000310 3300031238 Bacteria 37390
82 Ga0265332_10124755 3300031238 Bacteria 1081
83 Ga0265325_10116845 3300031241 Bacteria 1290
84 Ga0265329_10048757 3300031242 Bacteria 1351
85 Ga0265340_10000573 3300031247 Bacteria 20425
86 Ga0265340_10084960 3300031247 Bacteria 1485
87 Ga0265340_10095420 3300031247 Bacteria 1387
88 Ga0265339_10001994 3300031249 Bacteria 14995
89 Ga0265339_10032778 3300031249 Bacteria 2930
90 Ga0265331_10010946 3300031250 Bacteria 4987
91 Ga0265316_10059937 3300031344 Bacteria 2959
92 Ga0265314_10124738 3300031711 Bacteria 1615
93 Ga0265342_10000175 3300031712 Bacteria 71083
94 Ga0265342_10153995 3300031712 Bacteria 1274
95 Ga0373950_0009853 3300034818 Bacteria 1534
96 Ga0373939_0000723 3300035114 Bacteria 8168
97 Ga0373943_0066016 3300035170 Bacteria 1821
98 Ga0373946_0033563 3300035171 Bacteria 2067
99 Ga0373935_0026050 3300035692 Bacteria 3606
100 Ga0373927_0054470 3300035695 Bacteria 2587
101 Ga0373927_0132303 3300035695 Bacteria 1630
102 Ga0373927_0167620 3300035695 Bacteria 1439
103 Ga0373947_0038199 3300035725 Bacteria 2851
104 Ga0373925_0045880 3300037068 Bacteria 3247
105 Ga0373925_0057716 3300037068 Bacteria 2909
106 Ga0436364_0415922 3300037853 Bacteria 8626
107 Ga0436364_0788733 3300037853 Bacteria 1650
108 Ga0436364_0803663 3300037853 Bacteria 2928
109 Ga0436364_0870771 3300037853 Bacteria 2578
110 Ga0436364_1160450 3300037853 Bacteria 2330
111 Ga0436365_0280615 3300039437 Bacteria 1777
112 Ga0436365_1077710 3300039437 Bacteria 12347
113 Ga0436365_1262226 3300039437 Bacteria 5231
114 Ga0436360_1046427 3300039438 Bacteria 1019
115 Ga0439459_0021710 3300042438 Bacteria 1236
116 Ga0466966_0012931 3300044684 Bacteria 5527
117 Ga0466966_0050543 3300044684 Bacteria 2644
118 Ga0466961_0170398 3300044693 Bacteria 1354
119 Ga0466959_0133531 3300045049 Bacteria 1758
120 Ga0495603_0071511 3300046455 Bacteria 2039
121 Ga0495629_0150944 3300046459 Bacteria 1615
122 Ga0495638_0026348 3300046460 Bacteria 3768
123 Ga0495639_0056761 3300046475 Bacteria 1788
124 Ga0495640_0014063 3300046533 Bacteria 6070
125 Ga0495621_0002390 3300046539 Bacteria 5053
126 Ga0495660_0034707 3300046810 Bacteria 2821
127 Ga0495636_0036573 3300047318 Bacteria 2026
128 Ga0495676_0021687 3300047321 Bacteria 5605
129 Ga0496102_0024837 3300048905 Bacteria 5330
130 Ga0496104_0004653 3300048907 Bacteria 11941
131 Ga0496105_0014766 3300048908 Bacteria 6217
132 Ga0496108_0079607 3300048911 Bacteria 2774
133 Ga0496109_0011996 3300048912 Bacteria 7463
134 Ga0496111_0003300 3300048914 Bacteria 9978
135 Ga0496114_0086065 3300048917 Bacteria 2663
136 Ga0496115_0017600 3300048918 Bacteria 5469
137 Ga0501072_0002743 3300049588 Bacteria 13221
138 Ga0501073_0077064 3300049589 Bacteria 2320
139 Ga0501083_0243823 3300049744 Bacteria 1170
140 nmdc:mga06z11_195311_c1 3300050494 Bacteria 1173
141 nmdc:mga05p37_210567_c1 3300050507 Bacteria 2350
142 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
143 nmdc:mga09592_2778_c1 3300050508 Bacteria 14177
144 nmdc:mga0qj67_355_c1 3300050509 Bacteria 31660
145 nmdc:mga06r32_251036_c1 3300050510 Bacteria 1757
146 nmdc:mga06r32_48664_c1 3300050510 Bacteria 4053
147 nmdc:mga08y16_2238_c1 3300050511 Bacteria 19836
148 nmdc:mga0n895_115397_c1 3300050512 Bacteria 2704
149 nmdc:mga0n895_13881_c1 3300050512 Bacteria 7293
150 nmdc:mga0n895_71240_c1 3300050512 Bacteria 3446
151 nmdc:mga0rr50_2161_c1 3300050513 Bacteria 10994
152 nmdc:mga08x19_17987_c1 3300050514 Bacteria 4329
153 nmdc:mga0a205_29994_c1 3300050515 Bacteria 5206
154 nmdc:mga0a205_466_c1 3300050515 Bacteria 31480
155 Ga0495619_0090000 3300053085 Bacteria 2077
156 Ga0500644_0001397 3300053088 Bacteria 6436
157 Ga0500651_0010032 3300053093 Bacteria 5659
158 Ga0500566_0114674 3300053094 Bacteria 1460
159 Ga0500641_0003875 3300053096 Bacteria 5286
160 Ga0500641_0181133 3300053096 Bacteria 904
161 Ga0500595_000010 3300053119 Bacteria 275806
162 Ga0500568_0041803 3300053139 Bacteria 1841
163 Ga0500616_0000001 3300053153 Bacteria 1986011
164 Ga0500636_0008931 3300053177 Bacteria 5819
165 Ga0500645_000051 3300053730 Bacteria 98521
166 Ga0500645_038781 3300053730 Bacteria 1413
167 Ga0501082_0000266 3300060353 Bacteria 46186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0788733 Ga0436364_0788733_25_813 259
2 3300053096 Ga0500641_0181133 Ga0500641_0181133_12_842 275
3 3300039438 Ga0436360_1046427 Ga0436360_1046427_19_918 292
4 3300044684 Ga0466966_0050543 Ga0466966_0050543_63_962 298
5 3300045049 Ga0466959_0133531 Ga0466959_0133531_647_1546 298
6 3300021321 Ga0214542_1011630 Ga0214542_10116303 304
7 3300021327 Ga0214543_1000008 Ga0214543_1000008239 304
8 iso_pu_bacteria 2508501122 2509110239 312
9 iso_pu_bacteria 2516143018 2516205274 312
10 iso_pu_bacteria 2558860100 2558860427 312
11 iso_pu_bacteria 2657244999 2657684439 312
12 iso_pu_bacteria 2751185821 2753461063 312
13 iso_pu_bacteria 2791355094 2792642745 312
14 iso_pu_bacteria 2802429268 2804753342 312
15 iso_pu_bacteria 2847417321 2847420468 312
16 iso_pu_bacteria 2848992105 2848995340 312
17 iso_pu_bacteria 2850079185 2850082326 312
18 iso_pu_bacteria 2855872281 2855878405 312
19 iso_pu_bacteria 2913295892 2913299859 312
20 iso_pu_bacteria 2828305725 2828310331 313
21 3300021388 Ga0213875_10082825 Ga0213875_100828252 314
22 3300021320 Ga0214544_1000063 Ga0214544_100006346 315
23 3300021321 Ga0214542_1000095 Ga0214542_100009536 315
24 3300021327 Ga0214543_1000026 Ga0214543_100002636 315
25 iso_pu_bacteria 3003665799 3003668822 315
26 3300053085 Ga0495619_0090000 Ga0495619_0090000_304_1278 316
27 3300044684 Ga0466966_0012931 Ga0466966_0012931_3428_4387 319
28 3300044693 Ga0466961_0170398 Ga0466961_0170398_40_999 319
29 3300013105 Ga0157369_10175270 Ga0157369_101752703 320
30 3300021388 Ga0213875_10121792 Ga0213875_101217922 320
31 3300037853 Ga0436364_0870771 Ga0436364_0870771_168_1142 320
32 iso_pu_bacteria 2643221736 2644746175 320
33 iso_pu_bacteria 2841760612 2841766123 320
34 iso_pu_bacteria 2844104063 2844105889 320
35 iso_pu_bacteria 2851182111 2851186387 320
36 iso_pu_bacteria 2851246043 2851246245 320
37 iso_pu_bacteria 2917699015 2917703894 320
38 iso_pu_bacteria 8057529695 8057531529 320
39 3300005290 Ga0065712_10112538 Ga0065712_101125382 321
40 3300005333 Ga0070677_10000815 Ga0070677_100008157 321
41 3300005340 Ga0070689_100089205 Ga0070689_1000892051 321
42 3300005354 Ga0070675_100049763 Ga0070675_1000497631 321
43 3300005356 Ga0070674_100094231 Ga0070674_1000942313 321
44 3300005356 Ga0070674_100257645 Ga0070674_1002576452 321
45 3300005457 Ga0070662_100239492 Ga0070662_1002394922 321
46 3300005459 Ga0068867_100043259 Ga0068867_1000432593 321
47 3300005466 Ga0070685_10007883 Ga0070685_100078832 321
48 3300005544 Ga0070686_100047314 Ga0070686_1000473142 321
49 3300005577 Ga0068857_100202947 Ga0068857_1002029472 321
50 3300005614 Ga0068856_100692996 Ga0068856_1006929961 321
51 3300005617 Ga0068859_100059579 Ga0068859_1000595794 321
52 3300005985 Ga0081539_10002801 Ga0081539_1000280113 321
53 3300006038 Ga0075365_10109002 Ga0075365_101090021 321
54 3300006178 Ga0075367_10107627 Ga0075367_101076272 321
55 3300006852 Ga0075433_10066834 Ga0075433_100668341 321
56 3300006871 Ga0075434_100106711 Ga0075434_1001067112 321
57 3300006931 Ga0097620_100059581 Ga0097620_1000595812 321
58 3300007076 Ga0075435_100030430 Ga0075435_1000304302 321
59 3300011119 Ga0105246_10086911 Ga0105246_100869112 321
60 3300014325 Ga0163163_10003057 Ga0163163_1000305712 321
61 3300014326 Ga0157380_10062136 Ga0157380_100621363 321
62 3300014969 Ga0157376_10072515 Ga0157376_100725153 321
63 3300025893 Ga0207682_10002016 Ga0207682_100020166 321
64 3300025918 Ga0207662_10029669 Ga0207662_100296692 321
65 3300025926 Ga0207659_10023619 Ga0207659_100236194 321
66 3300025933 Ga0207706_10157403 Ga0207706_101574032 321
67 3300025935 Ga0207709_10117338 Ga0207709_101173382 321
68 3300025936 Ga0207670_10104238 Ga0207670_101042382 321
69 3300025942 Ga0207689_10093796 Ga0207689_100937962 321
70 3300026089 Ga0207648_10016754 Ga0207648_100167544 321
71 3300026116 Ga0207674_10147277 Ga0207674_101472772 321
72 3300026121 Ga0207683_10004971 Ga0207683_100049718 321
73 3300028556 Ga0265337_1000182 Ga0265337_100018218 321
74 3300035170 Ga0373943_0066016 Ga0373943_0066016_710_1690 321
75 3300035695 Ga0373927_0132303 Ga0373927_0132303_122_1102 321
76 3300035725 Ga0373947_0038199 Ga0373947_0038199_1105_2085 321
77 3300037068 Ga0373925_0057716 Ga0373925_0057716_515_1495 321
78 3300037853 Ga0436364_0415922 Ga0436364_0415922_7567_8547 321
79 3300042438 Ga0439459_0021710 Ga0439459_0021710_174_1148 321
80 3300046455 Ga0495603_0071511 Ga0495603_0071511_688_1668 321
81 3300046459 Ga0495629_0150944 Ga0495629_0150944_203_1171 321
82 3300046475 Ga0495639_0056761 Ga0495639_0056761_355_1335 321
83 3300046539 Ga0495621_0002390 Ga0495621_0002390_348_1322 321
84 3300047321 Ga0495676_0021687 Ga0495676_0021687_1941_2921 321
85 3300048905 Ga0496102_0024837 Ga0496102_0024837_1183_2163 321
86 3300048907 Ga0496104_0004653 Ga0496104_0004653_3811_4791 321
87 3300048908 Ga0496105_0014766 Ga0496105_0014766_2155_3135 321
88 3300048911 Ga0496108_0079607 Ga0496108_0079607_1468_2448 321
89 3300048912 Ga0496109_0011996 Ga0496109_0011996_4583_5563 321
90 3300048914 Ga0496111_0003300 Ga0496111_0003300_7242_8222 321
91 3300048917 Ga0496114_0086065 Ga0496114_0086065_143_1123 321
92 3300048918 Ga0496115_0017600 Ga0496115_0017600_1674_2654 321
93 3300050494 nmdc:mga06z11_195311_c1 nmdc:mga06z11_195311_c1_134_1108 321
94 3300050512 nmdc:mga0n895_71240_c1 nmdc:mga0n895_71240_c1_1862_2839 321
95 3300053730 Ga0500645_038781 Ga0500645_038781_62_1036 321
96 3300060353 Ga0501082_0000266 Ga0501082_0000266_32160_33134 321
97 3300005364 Ga0070673_100379683 Ga0070673_1003796832 322
98 3300005981 Ga0081538_10004000 Ga0081538_1000400012 322
99 3300009147 Ga0114129_10160627 Ga0114129_101606272 322
100 3300031238 Ga0265332_10000310 Ga0265332_100003105 322
101 3300031238 Ga0265332_10124755 Ga0265332_101247551 322
102 3300031247 Ga0265340_10000573 Ga0265340_1000057313 322
103 3300031247 Ga0265340_10084960 Ga0265340_100849602 322
104 3300031249 Ga0265339_10001994 Ga0265339_100019942 322
105 3300031344 Ga0265316_10059937 Ga0265316_100599372 322
106 3300031712 Ga0265342_10000175 Ga0265342_1000017528 322
107 3300031712 Ga0265342_10153995 Ga0265342_101539951 322
108 3300035171 Ga0373946_0033563 Ga0373946_0033563_773_1774 322
109 3300035692 Ga0373935_0026050 Ga0373935_0026050_944_1945 322
110 3300035695 Ga0373927_0054470 Ga0373927_0054470_987_1958 322
111 3300035695 Ga0373927_0167620 Ga0373927_0167620_430_1401 322
112 3300037068 Ga0373925_0045880 Ga0373925_0045880_1498_2469 322
113 3300039437 Ga0436365_1077710 Ga0436365_1077710_2620_3597 322
114 3300046460 Ga0495638_0026348 Ga0495638_0026348_1073_2047 322
115 3300046533 Ga0495640_0014063 Ga0495640_0014063_1486_2487 322
116 3300047318 Ga0495636_0036573 Ga0495636_0036573_104_1111 322
117 3300049588 Ga0501072_0002743 Ga0501072_0002743_8336_9313 322
118 3300049744 Ga0501083_0243823 Ga0501083_0243823_70_1047 322
119 3300050507 nmdc:mga05p37_210567_c1 nmdc:mga05p37_210567_c1_84_1064 322
120 3300053088 Ga0500644_0001397 Ga0500644_0001397_2436_3410 322
121 3300053093 Ga0500651_0010032 Ga0500651_0010032_3883_4857 322
122 3300053094 Ga0500566_0114674 Ga0500566_0114674_120_1094 322
123 3300053096 Ga0500641_0003875 Ga0500641_0003875_2826_3800 322
124 3300053119 Ga0500595_000010 Ga0500595_000010_104626_105600 322
125 3300053153 Ga0500616_0000001 Ga0500616_0000001_715888_716862 322
126 3300053730 Ga0500645_000051 Ga0500645_000051_34991_35965 322
127 3300005458 Ga0070681_10465923 Ga0070681_104659231 323
128 3300005518 Ga0070699_100245996 Ga0070699_1002459961 323
129 3300006028 Ga0070717_10141047 Ga0070717_101410473 323
130 3300006186 Ga0075369_10029566 Ga0075369_100295662 323
131 3300006194 Ga0075427_10000298 Ga0075427_100002985 323
132 3300006844 Ga0075428_100104669 Ga0075428_1001046692 323
133 3300006846 Ga0075430_100000070 Ga0075430_10000007042 323
134 3300006846 Ga0075430_100078887 Ga0075430_1000788873 323
135 3300006847 Ga0075431_100001221 Ga0075431_10000122113 323
136 3300006847 Ga0075431_100047033 Ga0075431_1000470334 323
137 3300006852 Ga0075433_10000867 Ga0075433_100008675 323
138 3300006871 Ga0075434_100000212 Ga0075434_10000021225 323
139 3300006871 Ga0075434_100012794 Ga0075434_10001279410 323
140 3300006880 Ga0075429_100003999 Ga0075429_10000399912 323
141 3300006914 Ga0075436_100002520 Ga0075436_1000025204 323
142 3300007076 Ga0075435_100015735 Ga0075435_1000157352 323
143 3300007076 Ga0075435_100164960 Ga0075435_1001649601 323
144 3300007788 Ga0099795_10012000 Ga0099795_100120003 323
145 3300009094 Ga0111539_10000138 Ga0111539_1000013835 323
146 3300009147 Ga0114129_10134976 Ga0114129_101349762 323
147 3300025912 Ga0207707_10129721 Ga0207707_101297212 323
148 3300025912 Ga0207707_10309696 Ga0207707_103096961 323
149 3300025917 Ga0207660_10004685 Ga0207660_100046856 323
150 3300025928 Ga0207700_10141421 Ga0207700_101414212 323
151 3300025981 Ga0207640_10032173 Ga0207640_100321734 323
152 3300027907 Ga0207428_10000075 Ga0207428_1000007573 323
153 3300031235 Ga0265330_10034767 Ga0265330_100347672 323
154 3300031241 Ga0265325_10116845 Ga0265325_101168452 323
155 3300031242 Ga0265329_10048757 Ga0265329_100487572 323
156 3300031247 Ga0265340_10095420 Ga0265340_100954202 323
157 3300031249 Ga0265339_10032778 Ga0265339_100327782 323
158 3300031250 Ga0265331_10010946 Ga0265331_100109463 323
159 3300031711 Ga0265314_10124738 Ga0265314_101247381 323
160 3300034818 Ga0373950_0009853 Ga0373950_0009853_541_1521 323
161 3300035114 Ga0373939_0000723 Ga0373939_0000723_1176_2156 323
162 3300037853 Ga0436364_0803663 Ga0436364_0803663_55_1029 323
163 3300039437 Ga0436365_1262226 Ga0436365_1262226_3856_4836 323
164 3300046810 Ga0495660_0034707 Ga0495660_0034707_1627_2613 323
165 3300049589 Ga0501073_0077064 Ga0501073_0077064_785_1768 323
166 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_46982_47956 323
167 3300050508 nmdc:mga09592_2778_c1 nmdc:mga09592_2778_c1_825_1799 323
168 3300050509 nmdc:mga0qj67_355_c1 nmdc:mga0qj67_355_c1_11918_12892 323
169 3300050510 nmdc:mga06r32_251036_c1 nmdc:mga06r32_251036_c1_600_1574 323
170 3300050510 nmdc:mga06r32_48664_c1 nmdc:mga06r32_48664_c1_1236_2231 323
171 3300050511 nmdc:mga08y16_2238_c1 nmdc:mga08y16_2238_c1_18679_19653 323
172 3300050512 nmdc:mga0n895_115397_c1 nmdc:mga0n895_115397_c1_825_1799 323
173 3300050512 nmdc:mga0n895_13881_c1 nmdc:mga0n895_13881_c1_5975_6958 323
174 3300050513 nmdc:mga0rr50_2161_c1 nmdc:mga0rr50_2161_c1_2927_3901 323
175 3300050514 nmdc:mga08x19_17987_c1 nmdc:mga08x19_17987_c1_1031_2014 323
176 3300050515 nmdc:mga0a205_29994_c1 nmdc:mga0a205_29994_c1_1532_2506 323
177 3300050515 nmdc:mga0a205_466_c1 nmdc:mga0a205_466_c1_985_1959 323
178 3300053139 Ga0500568_0041803 Ga0500568_0041803_718_1695 323
179 3300053177 Ga0500636_0008931 Ga0500636_0008931_3211_4197 323
180 3300002987 JGI25159J45721_1006423 JGI25159J45721_10064233 324
181 3300005262 Ga0065165_1000313 Ga0065165_100031352 324
182 3300025284 Ga0209130_1000209 Ga0209130_100020921 324
183 3300025294 Ga0209025_1010153 Ga0209025_10101534 324
184 3300025302 Ga0207426_1007808 Ga0207426_10078084 324
185 3300025910 Ga0207684_10017572 Ga0207684_100175724 324
186 3300025928 Ga0207700_10133902 Ga0207700_101339021 324
187 3300037853 Ga0436364_1160450 Ga0436364_1160450_444_1433 324
188 3300039437 Ga0436365_0280615 Ga0436365_0280615_558_1589 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

131

304

0.95

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

27

336

0.94

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

169

281

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsw-assembly1.cif.gz_A crystallization and structural analysis of 2-hydroxyacid dehydrogenase from ketogulonicigenium vulgare y25 0.9517 5 317
4lsw-assembly1.cif.gz_A crystallization and structural analysis of 2-hydroxyacid dehydrogenase from ketogulonicigenium vulgare y25 0.9343 5 317
5v72-assembly2.cif.gz_D crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with citrate 0.9341 6 324
5v72-assembly1.cif.gz_A crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with citrate 0.9319 6 324
5v72-assembly2.cif.gz_D crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with citrate 0.9283 6 324
ID Description Score Start End Superfamily
af_Q7XRA3_150_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.983 144 283 3.40.50.720
af_Q9LE33_108_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9813 106 288 3.40.50.720
af_A0A0R0KIU5_101_193_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9737 197 288 3.40.50.720
af_K7KCB6_141_256_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.973 174 288 3.40.50.720
5j23A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9723 106 288 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5K1GTK6-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9824 149 293 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A357G1I8-F1-model_v4 Hydroxyacid dehydrogenase 0.9813 141 284 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A7J0FLL7-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase family protein 0.9807 146 288 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A067FJP7-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9792 105 288 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A434QRP6-F1-model_v4 2-hydroxyacid dehydrogenase 0.9774 126 272 GO:0005829
GO:0016618
GO:0030267
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.17 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map