F289629

General Info

Members Datasets Scaffolds Average Seq Length
188 152 188 62

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_11696263|Ga0307410_116962632
Length 68
Sequence VKRIDLIRHREAHGAELLREGGNHSVYVNRGTKQSSAVPRHREVNDFLARKICRDLEIPQPELVSPAV

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
112 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
129 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
130 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
131 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
132 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
145 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
148 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 0.53
Rhizosphere 97.34
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10234738 3300003203 Unclassified 537
2 Ga0065707_10326615 3300005295 Unclassified 957
3 Ga0070680_100417635 3300005336 Bacteria 1144
4 Ga0070674_100128494 3300005356 Bacteria 1886
5 Ga0070673_102381379 3300005364 Bacteria 503
6 Ga0070667_100181130 3300005367 Unclassified 1863
7 Ga0070694_100032772 3300005444 Bacteria 3414
8 Ga0070694_100345900 3300005444 Bacteria 1151
9 Ga0070694_100911641 3300005444 Unclassified 726
10 Ga0070708_101410258 3300005445 Bacteria 650
11 Ga0070681_10194552 3300005458 Bacteria 1947
12 Ga0070681_10609094 3300005458 Bacteria 1007
13 Ga0070707_101365490 3300005468 Unclassified 675
14 Ga0070698_100621745 3300005471 Unclassified 1021
15 Ga0070699_101619311 3300005518 Unclassified 593
16 Ga0070697_100762313 3300005536 Unclassified 855
17 Ga0070695_100704736 3300005545 Bacteria 802
18 Ga0070695_101184428 3300005545 Unclassified 628
19 Ga0070704_100387285 3300005549 Bacteria 1189
20 Ga0070704_100407670 3300005549 Unclassified 1161
21 Ga0070704_100477507 3300005549 Unclassified 1078
22 Ga0068852_100134513 3300005616 Unclassified 2281
23 Ga0068859_100861728 3300005617 Unclassified 992
24 Ga0068866_10143315 3300005718 Bacteria 1374
25 Ga0068862_101817239 3300005844 Unclassified 619
26 Ga0081539_10164005 3300005985 Bacteria 1056
27 Ga0070712_101171081 3300006175 Unclassified 668
28 Ga0075428_100105952 3300006844 Bacteria 3065
29 Ga0075430_100557120 3300006846 Unclassified 945
30 Ga0075431_100317821 3300006847 Bacteria 1571
31 Ga0075433_10839472 3300006852 Bacteria 802
32 Ga0075433_11441362 3300006852 Unclassified 595
33 Ga0075433_11730385 3300006852 Bacteria 538
34 Ga0075429_100353546 3300006880 Bacteria 1286
35 Ga0097620_100861719 3300006931 Unclassified 992
36 Ga0075435_101380997 3300007076 Unclassified 617
37 Ga0099794_10006699 3300007265 Bacteria 4680
38 Ga0099794_10008832 3300007265 Unclassified 4200
39 Ga0099794_10280473 3300007265 Bacteria 861
40 Ga0099794_10400177 3300007265 Bacteria 717
41 Ga0105240_10194802 3300009093 Bacteria 2380
42 Ga0105240_10803975 3300009093 Unclassified 1018
43 Ga0111539_12328369 3300009094 Unclassified 621
44 Ga0105245_10265780 3300009098 Bacteria 1671
45 Ga0114129_10471380 3300009147 Bacteria 1644
46 Ga0114129_12101253 3300009147 Bacteria 681
47 Ga0114129_12475093 3300009147 Unclassified 621
48 Ga0105242_10575688 3300009176 Bacteria 1084
49 Ga0105249_11274279 3300009553 Unclassified 806
50 Ga0105249_12553444 3300009553 Unclassified 583
51 Ga0105239_12805986 3300010375 Unclassified 569
52 Ga0157326_1035409 3300012513 Bacteria 679
53 Ga0157370_10221452 3300013104 Bacteria 1752
54 Ga0157369_11013449 3300013105 Unclassified 850
55 Ga0157378_10374959 3300013297 Bacteria 1396
56 Ga0157378_12157611 3300013297 Unclassified 608
57 Ga0157372_10915441 3300013307 Bacteria 1017
58 Ga0157379_12515761 3300014968 Unclassified 515
59 Ga0182007_10299052 3300015262 Unclassified 590
60 Ga0206356_11838841 3300020070 Unclassified 635
61 Ga0207692_10616308 3300025898 Unclassified 699
62 Ga0207684_10332175 3300025910 Unclassified 1310
63 Ga0207660_10431044 3300025917 Bacteria 1065
64 Ga0207652_10485380 3300025921 Bacteria 1113
65 Ga0207646_10101494 3300025922 Bacteria 2579
66 Ga0207687_10083394 3300025927 Bacteria 2314
67 Ga0207686_11230629 3300025934 Unclassified 613
68 Ga0207709_11468760 3300025935 Bacteria 565
69 Ga0207669_10633683 3300025937 Bacteria 872
70 Ga0207689_11809607 3300025942 Unclassified 504
71 Ga0209588_1222443 3300027671 Unclassified 583
72 Ga0207428_10178575 3300027907 Unclassified 1605
73 Ga0265338_10015054 3300028800 Bacteria 8537
74 Ga0265339_10320264 3300031249 Bacteria 736
75 Ga0307408_101560542 3300031548 Bacteria 626
76 Ga0307408_101615201 3300031548 Unclassified 616
77 Ga0307408_101713186 3300031548 Unclassified 599
78 Ga0307405_10878714 3300031731 Bacteria 757
79 Ga0316577_10320196 3300031733 Bacteria 879
80 Ga0307413_10788690 3300031824 Bacteria 797
81 Ga0307410_10385124 3300031852 Bacteria 1129
82 Ga0307410_11079459 3300031852 Bacteria 695
83 Ga0307410_11696263 3300031852 Bacteria 560
84 Ga0307406_10099678 3300031901 Bacteria 1976
85 Ga0307407_10333734 3300031903 Bacteria 1068
86 Ga0307409_100205318 3300031995 Bacteria 1766
87 Ga0307409_101882699 3300031995 Bacteria 628
88 Ga0307416_100897206 3300032002 Bacteria 986
89 Ga0307416_101791481 3300032002 Unclassified 718
90 Ga0307416_102227671 3300032002 Bacteria 649
91 Ga0307414_10289562 3300032004 Bacteria 1380
92 Ga0307414_10914098 3300032004 Bacteria 805
93 Ga0307414_11227054 3300032004 Bacteria 695
94 Ga0307411_10077532 3300032005 Bacteria 2275
95 Ga0307415_100457241 3300032126 Bacteria 1105
96 Ga0373927_0186197 3300035695 Bacteria 1362
97 Ga0373937_0426172 3300036401 Unclassified 1259
98 Ga0373925_0245017 3300037068 Bacteria 1436
99 Ga0395899_0001313 3300037312 Bacteria 21402
100 Ga0395900_0004659 3300037418 Bacteria 14468
101 Ga0395898_0003115 3300037466 Bacteria 18722
102 Ga0395898_1686125 3300037466 Bacteria 557
103 Ga0395901_0005046 3300038443 Bacteria 13330
104 Ga0436360_0656672 3300039438 Unclassified 674
105 Ga0436363_1325998 3300039450 Bacteria 1292
106 Ga0451577_1232983 3300042876 Unclassified 667
107 Ga0453683_0006237 3300044673 Bacteria 8202
108 Ga0451576_0004829 3300045051 Bacteria 17257
109 Ga0451576_0040160 3300045051 Bacteria 4954
110 Ga0451576_0911110 3300045051 Bacteria 922
111 Ga0451576_1381090 3300045051 Bacteria 733
112 Ga0495592_0145482 3300046454 Unclassified 1644
113 Ga0495629_0262547 3300046459 Bacteria 1187
114 Ga0495651_0254539 3300046462 Unclassified 1197
115 Ga0495653_0235218 3300046463 Unclassified 1224
116 Ga0495662_0063809 3300046476 Unclassified 1780
117 Ga0495664_0875049 3300046477 Unclassified 526
118 Ga0495608_0124821 3300046511 Bacteria 1649
119 Ga0495618_0302298 3300046514 Bacteria 994
120 Ga0495628_0170015 3300046516 Bacteria 1653
121 Ga0495628_0216328 3300046516 Bacteria 1440
122 Ga0495630_0114171 3300046517 Bacteria 2046
123 Ga0495632_0002214 3300046519 Bacteria 15000
124 Ga0495586_0086174 3300046535 Bacteria 1731
125 Ga0495645_0700254 3300046543 Unclassified 615
126 Ga0495667_0058326 3300046559 Bacteria 2536
127 Ga0495635_0033573 3300046663 Bacteria 3560
128 Ga0495588_0089590 3300046674 Bacteria 1611
129 Ga0495657_0121930 3300046675 Unclassified 1641
130 Ga0495623_0212328 3300046679 Unclassified 1107
131 Ga0495646_0397047 3300046680 Unclassified 717
132 Ga0495613_0247681 3300046689 Bacteria 1244
133 Ga0495624_0094863 3300046690 Unclassified 1839
134 Ga0495600_0212758 3300046809 Bacteria 1238
135 Ga0495604_0088528 3300047317 Unclassified 2303
136 Ga0495674_0084222 3300047319 Unclassified 2725
137 Ga0495674_0151878 3300047319 Bacteria 1941
138 Ga0495680_0076205 3300047322 Unclassified 2543
139 Ga0495675_0179155 3300047444 Bacteria 1298
140 Ga0495684_0015976 3300047471 Bacteria 5781
141 Ga0496114_0421659 3300048917 Bacteria 1182
142 Ga0501298_060903 3300049521 Unclassified 799
143 Ga0501303_005682 3300049526 Bacteria 1070
144 Ga0501034_0643206 3300049571 Bacteria 963
145 Ga0501034_1594845 3300049571 Bacteria 526
146 Ga0501036_0043440 3300049572 Bacteria 3806
147 Ga0501037_0080079 3300049573 Bacteria 2370
148 Ga0501038_0043579 3300049574 Bacteria 3901
149 Ga0501040_0722268 3300049576 Unclassified 720
150 Ga0501041_0138103 3300049577 Bacteria 1519
151 Ga0501042_0089275 3300049578 Bacteria 2211
152 Ga0501048_0140966 3300049582 Bacteria 1704
153 Ga0501067_0183603 3300049583 Unclassified 1165
154 Ga0501070_1331879 3300049586 Unclassified 547
155 Ga0501071_0020989 3300049587 Bacteria 4546
156 Ga0501072_0046299 3300049588 Bacteria 3423
157 Ga0501073_0607055 3300049589 Bacteria 755
158 Ga0501075_0035933 3300049591 Bacteria 3696
159 Ga0501077_0891905 3300049593 Unclassified 572
160 Ga0501199_017431 3300049650 Bacteria 815
161 Ga0501217_073909 3300049661 Bacteria 932
162 Ga0501235_098057 3300049669 Unclassified 713
163 Ga0501236_004519 3300049670 Bacteria 1653
164 Ga0501221_223847 3300049704 Unclassified 531
165 Ga0501079_0047096 3300049741 Bacteria 3326
166 Ga0501080_0319279 3300049742 Bacteria 1406
167 Ga0501081_0106505 3300049743 Bacteria 1987
168 Ga0501081_1067702 3300049743 Unclassified 611
169 Ga0501083_0352405 3300049744 Bacteria 957
170 Ga0501266_024335 3300049763 Unclassified 841
171 Ga0501035_0297316 3300049822 Bacteria 1361
172 Ga0501044_0212125 3300049823 Bacteria 1890
173 nmdc:mga05p37_1032714_c1 3300050507 Unclassified 534
174 nmdc:mga05p37_1472526_c1 3300050507 Bacteria 680
175 nmdc:mga09592_1081_c1 3300050508 Bacteria 21649
176 nmdc:mga06r32_865002_c1 3300050510 Unclassified 862
177 nmdc:mga0a205_1175862_c1 3300050515 Bacteria 615
178 nmdc:mga0a205_1237278_c1 3300050515 Unclassified 594
179 Ga0495601_0526197 3300053077 Unclassified 762
180 Ga0500635_0340641 3300053080 Unclassified 593
181 Ga0495619_0922147 3300053085 Unclassified 587
182 Ga0495619_1064174 3300053085 Unclassified 539
183 Ga0500658_0303872 3300053134 Unclassified 733
184 Ga0500639_146718 3300053163 Bacteria 1094
185 Ga0501084_0058452 3300054114 Bacteria 3226
186 Ga0587072_167500 3300059643 Bacteria 541
187 Ga0501082_0154608 3300060353 Bacteria 1993
188 Ga0530510_0113745 3300061734 Bacteria 1983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_10332175 Ga0207684_103321751 55
2 3300005295 Ga0065707_10326615 Ga0065707_103266151 61
3 3300005336 Ga0070680_100417635 Ga0070680_1004176351 61
4 3300005356 Ga0070674_100128494 Ga0070674_1001284943 61
5 3300005364 Ga0070673_102381379 Ga0070673_1023813791 61
6 3300005444 Ga0070694_100032772 Ga0070694_1000327727 61
7 3300005444 Ga0070694_100345900 Ga0070694_1003459001 61
8 3300005444 Ga0070694_100911641 Ga0070694_1009116411 61
9 3300005445 Ga0070708_101410258 Ga0070708_1014102582 61
10 3300005458 Ga0070681_10609094 Ga0070681_106090942 61
11 3300005471 Ga0070698_100621745 Ga0070698_1006217452 61
12 3300005545 Ga0070695_100704736 Ga0070695_1007047361 61
13 3300005549 Ga0070704_100387285 Ga0070704_1003872853 61
14 3300005549 Ga0070704_100477507 Ga0070704_1004775071 61
15 3300005616 Ga0068852_100134513 Ga0068852_1001345138 61
16 3300005718 Ga0068866_10143315 Ga0068866_101433152 61
17 3300005844 Ga0068862_101817239 Ga0068862_1018172392 61
18 3300006844 Ga0075428_100105952 Ga0075428_1001059522 61
19 3300006846 Ga0075430_100557120 Ga0075430_1005571201 61
20 3300006847 Ga0075431_100317821 Ga0075431_1003178212 61
21 3300006852 Ga0075433_10839472 Ga0075433_108394722 61
22 3300006852 Ga0075433_11441362 Ga0075433_114413622 61
23 3300006880 Ga0075429_100353546 Ga0075429_1003535464 61
24 3300007076 Ga0075435_101380997 Ga0075435_1013809972 61
25 3300007265 Ga0099794_10008832 Ga0099794_100088326 61
26 3300007265 Ga0099794_10280473 Ga0099794_102804733 61
27 3300009093 Ga0105240_10194802 Ga0105240_101948025 61
28 3300009093 Ga0105240_10803975 Ga0105240_108039751 61
29 3300009094 Ga0111539_12328369 Ga0111539_123283692 61
30 3300009147 Ga0114129_10471380 Ga0114129_104713804 61
31 3300009147 Ga0114129_12101253 Ga0114129_121012531 61
32 3300009147 Ga0114129_12475093 Ga0114129_124750932 61
33 3300009553 Ga0105249_11274279 Ga0105249_112742792 61
34 3300009553 Ga0105249_12553444 Ga0105249_125534442 61
35 3300010375 Ga0105239_12805986 Ga0105239_128059862 61
36 3300012513 Ga0157326_1035409 Ga0157326_10354093 61
37 3300013104 Ga0157370_10221452 Ga0157370_102214521 61
38 3300013105 Ga0157369_11013449 Ga0157369_110134492 61
39 3300013297 Ga0157378_10374959 Ga0157378_103749592 61
40 3300013307 Ga0157372_10915441 Ga0157372_109154411 61
41 3300015262 Ga0182007_10299052 Ga0182007_102990523 61
42 3300020070 Ga0206356_11838841 Ga0206356_118388411 61
43 3300025898 Ga0207692_10616308 Ga0207692_106163082 61
44 3300025917 Ga0207660_10431044 Ga0207660_104310441 61
45 3300025921 Ga0207652_10485380 Ga0207652_104853802 61
46 3300025934 Ga0207686_11230629 Ga0207686_112306291 61
47 3300025937 Ga0207669_10633683 Ga0207669_106336832 61
48 3300027671 Ga0209588_1222443 Ga0209588_12224432 61
49 3300027907 Ga0207428_10178575 Ga0207428_101785754 61
50 3300028800 Ga0265338_10015054 Ga0265338_1001505410 61
51 3300031548 Ga0307408_101560542 Ga0307408_1015605422 61
52 3300031548 Ga0307408_101615201 Ga0307408_1016152011 61
53 3300031548 Ga0307408_101713186 Ga0307408_1017131861 61
54 3300031731 Ga0307405_10878714 Ga0307405_108787142 61
55 3300031733 Ga0316577_10320196 Ga0316577_103201962 61
56 3300031824 Ga0307413_10788690 Ga0307413_107886901 61
57 3300031852 Ga0307410_10385124 Ga0307410_103851242 61
58 3300031852 Ga0307410_11079459 Ga0307410_110794592 61
59 3300031901 Ga0307406_10099678 Ga0307406_100996782 61
60 3300031903 Ga0307407_10333734 Ga0307407_103337344 61
61 3300031995 Ga0307409_100205318 Ga0307409_1002053183 61
62 3300031995 Ga0307409_101882699 Ga0307409_1018826992 61
63 3300032002 Ga0307416_100897206 Ga0307416_1008972062 61
64 3300032002 Ga0307416_101791481 Ga0307416_1017914812 61
65 3300032002 Ga0307416_102227671 Ga0307416_1022276712 61
66 3300032004 Ga0307414_10289562 Ga0307414_102895621 61
67 3300032004 Ga0307414_10914098 Ga0307414_109140982 61
68 3300032005 Ga0307411_10077532 Ga0307411_100775325 61
69 3300036401 Ga0373937_0426172 Ga0373937_0426172_522_707 61
70 3300037312 Ga0395899_0001313 Ga0395899_0001313_18866_19051 61
71 3300037418 Ga0395900_0004659 Ga0395900_0004659_2352_2537 61
72 3300037466 Ga0395898_0003115 Ga0395898_0003115_2352_2537 61
73 3300038443 Ga0395901_0005046 Ga0395901_0005046_2633_2818 61
74 3300044673 Ga0453683_0006237 Ga0453683_0006237_7416_7601 61
75 3300045051 Ga0451576_0004829 Ga0451576_0004829_7643_7828 61
76 3300045051 Ga0451576_0040160 Ga0451576_0040160_1737_1922 61
77 3300045051 Ga0451576_0911110 Ga0451576_0911110_338_523 61
78 3300045051 Ga0451576_1381090 Ga0451576_1381090_117_302 61
79 3300046454 Ga0495592_0145482 Ga0495592_0145482_966_1151 61
80 3300046459 Ga0495629_0262547 Ga0495629_0262547_629_814 61
81 3300046462 Ga0495651_0254539 Ga0495651_0254539_764_949 61
82 3300046463 Ga0495653_0235218 Ga0495653_0235218_691_876 61
83 3300046476 Ga0495662_0063809 Ga0495662_0063809_1429_1614 61
84 3300046477 Ga0495664_0875049 Ga0495664_0875049_10_195 61
85 3300046511 Ga0495608_0124821 Ga0495608_0124821_968_1153 61
86 3300046514 Ga0495618_0302298 Ga0495618_0302298_572_757 61
87 3300046516 Ga0495628_0170015 Ga0495628_0170015_834_1019 61
88 3300046516 Ga0495628_0216328 Ga0495628_0216328_768_953 61
89 3300046517 Ga0495630_0114171 Ga0495630_0114171_1028_1213 61
90 3300046535 Ga0495586_0086174 Ga0495586_0086174_788_973 61
91 3300046543 Ga0495645_0700254 Ga0495645_0700254_23_208 61
92 3300046559 Ga0495667_0058326 Ga0495667_0058326_1661_1846 61
93 3300046663 Ga0495635_0033573 Ga0495635_0033573_1386_1571 61
94 3300046674 Ga0495588_0089590 Ga0495588_0089590_1178_1363 61
95 3300046675 Ga0495657_0121930 Ga0495657_0121930_641_826 61
96 3300046679 Ga0495623_0212328 Ga0495623_0212328_190_375 61
97 3300046680 Ga0495646_0397047 Ga0495646_0397047_105_290 61
98 3300046689 Ga0495613_0247681 Ga0495613_0247681_779_964 61
99 3300046690 Ga0495624_0094863 Ga0495624_0094863_647_832 61
100 3300046809 Ga0495600_0212758 Ga0495600_0212758_337_522 61
101 3300047317 Ga0495604_0088528 Ga0495604_0088528_806_991 61
102 3300047319 Ga0495674_0084222 Ga0495674_0084222_1818_2003 61
103 3300047322 Ga0495680_0076205 Ga0495680_0076205_949_1134 61
104 3300047444 Ga0495675_0179155 Ga0495675_0179155_794_979 61
105 3300047471 Ga0495684_0015976 Ga0495684_0015976_790_975 61
106 3300048917 Ga0496114_0421659 Ga0496114_0421659_297_482 61
107 3300049521 Ga0501298_060903 Ga0501298_060903_290_475 61
108 3300049526 Ga0501303_005682 Ga0501303_005682_17_202 61
109 3300049571 Ga0501034_0643206 Ga0501034_0643206_457_642 61
110 3300049571 Ga0501034_1594845 Ga0501034_1594845_151_336 61
111 3300049572 Ga0501036_0043440 Ga0501036_0043440_1547_1732 61
112 3300049573 Ga0501037_0080079 Ga0501037_0080079_2011_2196 61
113 3300049574 Ga0501038_0043579 Ga0501038_0043579_2482_2667 61
114 3300049576 Ga0501040_0722268 Ga0501040_0722268_161_346 61
115 3300049577 Ga0501041_0138103 Ga0501041_0138103_75_260 61
116 3300049578 Ga0501042_0089275 Ga0501042_0089275_920_1105 61
117 3300049582 Ga0501048_0140966 Ga0501048_0140966_285_470 61
118 3300049586 Ga0501070_1331879 Ga0501070_1331879_218_403 61
119 3300049589 Ga0501073_0607055 Ga0501073_0607055_109_294 61
120 3300049591 Ga0501075_0035933 Ga0501075_0035933_424_609 61
121 3300049593 Ga0501077_0891905 Ga0501077_0891905_370_555 61
122 3300049650 Ga0501199_017431 Ga0501199_017431_590_775 61
123 3300049661 Ga0501217_073909 Ga0501217_073909_691_876 61
124 3300049669 Ga0501235_098057 Ga0501235_098057_486_671 61
125 3300049670 Ga0501236_004519 Ga0501236_004519_158_343 61
126 3300049704 Ga0501221_223847 Ga0501221_223847_111_296 61
127 3300049741 Ga0501079_0047096 Ga0501079_0047096_1648_1833 61
128 3300049742 Ga0501080_0319279 Ga0501080_0319279_218_403 61
129 3300049743 Ga0501081_0106505 Ga0501081_0106505_1600_1785 61
130 3300049744 Ga0501083_0352405 Ga0501083_0352405_756_941 61
131 3300049763 Ga0501266_024335 Ga0501266_024335_265_450 61
132 3300049822 Ga0501035_0297316 Ga0501035_0297316_1152_1337 61
133 3300049823 Ga0501044_0212125 Ga0501044_0212125_1358_1543 61
134 3300050507 nmdc:mga05p37_1032714_c1 nmdc:mga05p37_1032714_c1_317_502 61
135 3300050507 nmdc:mga05p37_1472526_c1 nmdc:mga05p37_1472526_c1_196_381 61
136 3300050508 nmdc:mga09592_1081_c1 nmdc:mga09592_1081_c1_9048_9233 61
137 3300050510 nmdc:mga06r32_865002_c1 nmdc:mga06r32_865002_c1_651_836 61
138 3300050515 nmdc:mga0a205_1175862_c1 nmdc:mga0a205_1175862_c1_328_513 61
139 3300050515 nmdc:mga0a205_1237278_c1 nmdc:mga0a205_1237278_c1_287_472 61
140 3300053077 Ga0495601_0526197 Ga0495601_0526197_421_606 61
141 3300053080 Ga0500635_0340641 Ga0500635_0340641_280_465 61
142 3300053085 Ga0495619_0922147 Ga0495619_0922147_136_321 61
143 3300053085 Ga0495619_1064174 Ga0495619_1064174_175_360 61
144 3300053134 Ga0500658_0303872 Ga0500658_0303872_353_538 61
145 3300053163 Ga0500639_146718 Ga0500639_146718_282_467 61
146 3300054114 Ga0501084_0058452 Ga0501084_0058452_2724_2909 61
147 3300059643 Ga0587072_167500 Ga0587072_167500_148_333 61
148 3300061734 Ga0530510_0113745 Ga0530510_0113745_1741_1926 61
149 3300003203 JGI25406J46586_10234738 JGI25406J46586_102347381 62
150 3300005367 Ga0070667_100181130 Ga0070667_1001811302 62
151 3300005458 Ga0070681_10194552 Ga0070681_101945524 62
152 3300005468 Ga0070707_101365490 Ga0070707_1013654902 62
153 3300005518 Ga0070699_101619311 Ga0070699_1016193111 62
154 3300005536 Ga0070697_100762313 Ga0070697_1007623132 62
155 3300005545 Ga0070695_101184428 Ga0070695_1011844281 62
156 3300005549 Ga0070704_100407670 Ga0070704_1004076701 62
157 3300005617 Ga0068859_100861728 Ga0068859_1008617284 62
158 3300005985 Ga0081539_10164005 Ga0081539_101640052 62
159 3300006175 Ga0070712_101171081 Ga0070712_1011710812 62
160 3300006852 Ga0075433_11730385 Ga0075433_117303851 62
161 3300006931 Ga0097620_100861719 Ga0097620_1008617194 62
162 3300007265 Ga0099794_10006699 Ga0099794_100066991 62
163 3300007265 Ga0099794_10400177 Ga0099794_104001772 62
164 3300009098 Ga0105245_10265780 Ga0105245_102657803 62
165 3300009176 Ga0105242_10575688 Ga0105242_105756884 62
166 3300013297 Ga0157378_12157611 Ga0157378_121576111 62
167 3300014968 Ga0157379_12515761 Ga0157379_125157612 62
168 3300025922 Ga0207646_10101494 Ga0207646_101014943 62
169 3300025927 Ga0207687_10083394 Ga0207687_100833942 62
170 3300025935 Ga0207709_11468760 Ga0207709_114687602 62
171 3300025942 Ga0207689_11809607 Ga0207689_118096072 62
172 3300031249 Ga0265339_10320264 Ga0265339_103202641 62
173 3300031852 Ga0307410_11696263 Ga0307410_116962632 62
174 3300032004 Ga0307414_11227054 Ga0307414_112270542 62
175 3300032126 Ga0307415_100457241 Ga0307415_1004572412 62
176 3300035695 Ga0373927_0186197 Ga0373927_0186197_732_920 62
177 3300037068 Ga0373925_0245017 Ga0373925_0245017_443_631 62
178 3300037466 Ga0395898_1686125 Ga0395898_1686125_83_277 62
179 3300039438 Ga0436360_0656672 Ga0436360_0656672_283_471 62
180 3300039450 Ga0436363_1325998 Ga0436363_1325998_287_484 62
181 3300042876 Ga0451577_1232983 Ga0451577_1232983_388_579 62
182 3300046519 Ga0495632_0002214 Ga0495632_0002214_6823_7020 62
183 3300047319 Ga0495674_0151878 Ga0495674_0151878_319_507 62
184 3300049583 Ga0501067_0183603 Ga0501067_0183603_613_804 62
185 3300049587 Ga0501071_0020989 Ga0501071_0020989_2396_2602 62
186 3300049588 Ga0501072_0046299 Ga0501072_0046299_1959_2165 62
187 3300049743 Ga0501081_1067702 Ga0501081_1067702_331_522 62
188 3300060353 Ga0501082_0154608 Ga0501082_0154608_1733_1939 62

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

4

58

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.9023 2 58
7mkn-assembly1.cif.gz_L escherichia coli rna polymerase and rapa elongation complex 0.8704 15 40
5j3b-assembly2.cif.gz_B structure of translation elongation factor p from acinetobacter baumannii 0.866 15 40
1yby-assembly1.cif.gz_B conserved hypothetical protein cth-95 from clostridium thermocellum 0.8633 15 40
6hpb-assembly1.cif.gz_A crystal structure of the e.coli hicab toxin-antitoxin complex 0.8596 2 57
ID Description Score Start End Superfamily
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.9023 2 58 3.30.920.30
af_F4JUX3_135_197_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8859 15 39 2.40.50.140
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8707 1 58 3.30.920.30
af_P45757_87_154_2.30.30.830 Mainly Beta;Roll;SH3 type barrels.; 0.8614 14 41 2.30.30.830
af_P76106_1_57_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.85 1 58 3.30.920.30
ID Description Score Start End GO Terms
AF-A0A351JN76-F1-model_v4 Addiction module toxin, HicA family 1.008 1 60
AF-A0A0S8EQB9-F1-model_v4 Addiction module toxin, HicA family 1.007 1 62 GO:0003729
GO:0004519
AF-A0A6N9C9H3-F1-model_v4 Addiction module toxin, HicA family 1.007 1 53 GO:0003729
GO:0004519
AF-A0A450WF52-F1-model_v4 HicA toxin of toxin-antitoxin 1.006 1 61 GO:0003729
GO:0004519
AF-A0A2M7SCS3-F1-model_v4 Addiction module toxin, HicA family 1.005 1 62 GO:0003729
GO:0004519

Feature Viewer

pLDDT pTM Quality
92.49 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map