F289247

General Info

Members Datasets Scaffolds Average Seq Length
188 132 376 252

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10127443|Ga0111539_101274433
Length 279
Sequence VLISCAANFGKETTLAALFIHFISMDIVIIGTGNVAYALAGLIKKSGHILLEVSGRNESELKKIAGAFDVPASSIPNFNKEADLYIVAISDDALYNIGEWLSLERKLVVHTAGSVSKEVLQAVSRNYGVLYPLQSLKKGMKSIPEIPFLVDGNTADDLALIRDFALSLSSKVEVADDEARRKLHLAAVVVNNFTNHLYALAEEYCKKEGLSFDILQPLIMETTHRIKSMSPKTAQTGPAIRNDLSTKKKQLDMLKNHPELRRVYEVMTESIVSRISDSG

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
94 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
95 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
127 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
128 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
129 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
132 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0
Rhizoplane 2.66
Rhizosphere 86.17
Stem 0
Stem Tuber 0
Unclassified 23.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10127443 3300009094 Bacteria 2981
2 rootH1_10010170 3300003323 Bacteria 5608
3 rootH1_10026824 3300003323 Bacteria 22983
4 Ga0070683_100022625 3300005329 Bacteria 5621
5 Ga0070670_100620109 3300005331 Bacteria 969
6 Ga0070666_10055712 3300005335 Bacteria 2669
7 Ga0070666_10310894 3300005335 Bacteria 1123
8 Ga0070680_100004542 3300005336 Bacteria 10443
9 Ga0068868_100343757 3300005338 Unclassified 1276
10 Ga0070660_100008391 3300005339 Bacteria 7222
11 Ga0070660_100160920 3300005339 Bacteria 1809
12 Ga0070687_100034283 3300005343 Unclassified 2511
13 Ga0070675_100166631 3300005354 Unclassified 1898
14 Ga0070671_100032925 3300005355 Bacteria 4284
15 Ga0070671_100062701 3300005355 Bacteria 3095
16 Ga0070671_100323657 3300005355 Bacteria 1314
17 Ga0070674_100044197 3300005356 Bacteria 3035
18 Ga0070674_100061419 3300005356 Bacteria 2622
19 Ga0070673_100114288 3300005364 Unclassified 2243
20 Ga0070673_100625949 3300005364 Unclassified 983
21 Ga0070688_100088939 3300005365 Bacteria 2014
22 Ga0070678_100178235 3300005456 Unclassified 1737
23 Ga0070681_10051045 3300005458 Unclassified 4126
24 Ga0070685_10402632 3300005466 Bacteria 948
25 Ga0070679_100003499 3300005530 Bacteria 14380
26 Ga0068853_100157008 3300005539 Bacteria 2050
27 Ga0068853_100762040 3300005539 Unclassified 925
28 Ga0070672_100047712 3300005543 Unclassified 3324
29 Ga0070686_100144660 3300005544 Bacteria 1659
30 Ga0068855_100231880 3300005563 Bacteria 2067
31 Ga0070664_100076746 3300005564 Unclassified 2871
32 Ga0068854_100516800 3300005578 Unclassified 1008
33 Ga0070702_100002159 3300005615 Bacteria 8362
34 Ga0068852_100051694 3300005616 Bacteria 3528
35 Ga0068859_100426220 3300005617 Bacteria 1423
36 Ga0068864_100880547 3300005618 Bacteria 883
37 Ga0068866_10377221 3300005718 Unclassified 908
38 Ga0068861_100071480 3300005719 Unclassified 2690
39 Ga0068863_100043172 3300005841 Bacteria 4281
40 Ga0068858_100202879 3300005842 Unclassified 1876
41 Ga0068858_100657719 3300005842 Unclassified 1018
42 Ga0068860_100274604 3300005843 Unclassified 1646
43 Ga0097621_100001025 3300006237 Bacteria 19666
44 Ga0068871_100000029 3300006358 Bacteria 77924
45 Ga0068871_100451281 3300006358 Bacteria 1152
46 Ga0075431_100037366 3300006847 Bacteria 5003
47 Ga0075429_100220910 3300006880 Bacteria 1660
48 Ga0097620_100426218 3300006931 Bacteria 1423
49 Ga0105242_10044361 3300009176 Bacteria 3601
50 Ga0105242_10868815 3300009176 Bacteria 899
51 Ga0105248_10035786 3300009177 Bacteria 5554
52 Ga0105249_10027167 3300009553 Bacteria 5163
53 Ga0105246_10170582 3300011119 Bacteria 1666
54 Ga0157370_10113362 3300013104 Bacteria 2534
55 Ga0157369_10170113 3300013105 Bacteria 2296
56 Ga0157369_10902703 3300013105 Unclassified 906
57 Ga0157374_10086475 3300013296 Bacteria 2983
58 Ga0157374_10320832 3300013296 Unclassified 1535
59 Ga0157374_10541187 3300013296 Bacteria 1172
60 Ga0157378_10006350 3300013297 Bacteria 10342
61 Ga0157378_10024040 3300013297 Bacteria 5360
62 Ga0157378_10308858 3300013297 Bacteria 1533
63 Ga0163162_10000195 3300013306 Bacteria 55910
64 Ga0163162_10111492 3300013306 Bacteria 2833
65 Ga0163162_10161294 3300013306 Bacteria 2364
66 Ga0163162_10721651 3300013306 Bacteria 1117
67 Ga0157372_10344952 3300013307 Bacteria 1735
68 Ga0157372_10600856 3300013307 Bacteria 1282
69 Ga0157375_10003192 3300013308 Bacteria 14233
70 Ga0157375_10068336 3300013308 Bacteria 3555
71 Ga0157375_10460093 3300013308 Bacteria 1438
72 Ga0157375_10473753 3300013308 Unclassified 1417
73 Ga0157375_10517043 3300013308 Bacteria 1357
74 Ga0163163_10000377 3300014325 Bacteria 42550
75 Ga0157380_10003319 3300014326 Bacteria 11040
76 Ga0157377_10019507 3300014745 Unclassified 3544
77 Ga0157379_10115480 3300014968 Bacteria 2413
78 Ga0157379_10197202 3300014968 Bacteria 1820
79 Ga0157379_10306462 3300014968 Bacteria 1448
80 Ga0157376_10001210 3300014969 Bacteria 17016
81 Ga0157376_10038455 3300014969 Bacteria 3893
82 Ga0163161_10001838 3300017792 Bacteria 15498
83 Ga0163161_10015414 3300017792 Bacteria 5329
84 Ga0213876_10021883 3300021384 Bacteria 3382
85 Ga0209646_1000869 3300025246 Bacteria 10077
86 Ga0207642_10288408 3300025899 Unclassified 947
87 Ga0207688_10017830 3300025901 Unclassified 3863
88 Ga0207680_10072938 3300025903 Unclassified 2133
89 Ga0207645_10008391 3300025907 Bacteria 7206
90 Ga0207705_10080766 3300025909 Bacteria 2369
91 Ga0207707_10109442 3300025912 Unclassified 2415
92 Ga0207660_10227606 3300025917 Bacteria 1465
93 Ga0207657_10085867 3300025919 Bacteria 2635
94 Ga0207652_10001304 3300025921 Bacteria 22193
95 Ga0207652_10082269 3300025921 Bacteria 2817
96 Ga0207681_10422861 3300025923 Unclassified 1080
97 Ga0207659_10136677 3300025926 Unclassified 1898
98 Ga0207644_10049101 3300025931 Bacteria 3019
99 Ga0207644_10111686 3300025931 Unclassified 2068
100 Ga0207706_10225847 3300025933 Unclassified 1639
101 Ga0207711_10042818 3300025941 Bacteria 3859
102 Ga0207661_10013687 3300025944 Bacteria 5924
103 Ga0207679_10143101 3300025945 Unclassified 1935
104 Ga0207667_10142802 3300025949 Bacteria 2465
105 Ga0207712_10277658 3300025961 Bacteria 1366
106 Ga0207640_10249554 3300025981 Bacteria 1376
107 Ga0207658_10407666 3300025986 Unclassified 1196
108 Ga0207703_10208201 3300026035 Unclassified 1742
109 Ga0207641_10039570 3300026088 Bacteria 3944
110 Ga0207648_10106648 3300026089 Bacteria 2459
111 Ga0207648_10264478 3300026089 Bacteria 1535
112 Ga0207676_10464462 3300026095 Bacteria 1196
113 Ga0207675_100047745 3300026118 Bacteria 3996
114 Ga0207675_100485312 3300026118 Bacteria 1229
115 Ga0207683_10104780 3300026121 Bacteria 2528
116 Ga0207683_10181010 3300026121 Unclassified 1911
117 Ga0207698_10039811 3300026142 Bacteria 3485
118 Ga0207698_10283308 3300026142 Unclassified 1534
119 Ga0268264_10369449 3300028381 Bacteria 1371
120 Ga0265327_10008375 3300031251 Bacteria 7714
121 Ga0307513_10279181 3300031456 Bacteria 1449
122 Ga0307513_10287734 3300031456 Unclassified 1417
123 Ga0307509_10232530 3300031507 Bacteria 1645
124 Ga0307516_10002853 3300031730 Bacteria 22760
125 Ga0307414_10049223 3300032004 Bacteria 2912
126 Ga0373925_0092987 3300037068 Bacteria 2308
127 Ga0436365_1321487 3300039437 Bacteria 32026
128 Ga0451800_0434419 3300041459 Bacteria 1021
129 Ga0451802_1683940 3300041460 Bacteria 1484
130 Ga0439457_025741 3300042014 Bacteria 1301
131 Ga0439462_0017510 3300042015 Bacteria 1856
132 Ga0466972_0000083 3300044658 Bacteria 87204
133 Ga0466972_0005305 3300044658 Bacteria 6452
134 Ga0466972_0024493 3300044658 Bacteria 2995
135 Ga0453684_0103310 3300044712 Bacteria 3483
136 Ga0453684_0187022 3300044712 Bacteria 2426
137 Ga0466968_0202947 3300044735 Bacteria 929
138 Ga0466957_0002599 3300044842 Bacteria 9731
139 Ga0466960_0081132 3300044901 Bacteria 1635
140 Ga0495638_0282267 3300046460 Bacteria 902
141 Ga0495668_0001819 3300046616 Bacteria 19357
142 Ga0496101_0155743 3300048904 Unclassified 1750
143 Ga0496106_0359076 3300048909 Unclassified 1170
144 Ga0496114_0061432 3300048917 Bacteria 3143
145 Ga0496122_0237146 3300048925 Bacteria 1032
146 Ga0496124_0031102 3300048927 Bacteria 4729
147 Ga0501032_0041697 3300049569 Bacteria 3116
148 Ga0501032_0415416 3300049569 Unclassified 863
149 Ga0501033_0031320 3300049570 Bacteria 3997
150 Ga0501034_0041801 3300049571 Bacteria 4638
151 Ga0501034_0077379 3300049571 Bacteria 3332
152 Ga0501034_0207037 3300049571 Unclassified 1918
153 Ga0501036_0042765 3300049572 Bacteria 3836
154 Ga0501037_0053512 3300049573 Unclassified 2952
155 Ga0501038_0020779 3300049574 Bacteria 5901
156 Ga0501043_0039135 3300049579 Bacteria 3727
157 Ga0501043_0049203 3300049579 Unclassified 3314
158 Ga0501043_0144995 3300049579 Bacteria 1859
159 Ga0501043_0207002 3300049579 Bacteria 1521
160 Ga0501043_0586542 3300049579 Bacteria 825
161 Ga0501047_0030011 3300049581 Bacteria 5242
162 Ga0501047_0037567 3300049581 Bacteria 4682
163 Ga0501047_0055081 3300049581 Bacteria 3846
164 Ga0501047_0232147 3300049581 Bacteria 1698
165 Ga0501047_0468336 3300049581 Bacteria 1088
166 Ga0501219_000036 3300049703 Bacteria 21384
167 Ga0501035_0004654 3300049822 Bacteria 13021
168 Ga0501035_0034702 3300049822 Unclassified 4582
169 Ga0501035_0096728 3300049822 Bacteria 2594
170 Ga0501044_0016696 3300049823 Bacteria 7881
171 Ga0501044_0046074 3300049823 Unclassified 4516
172 Ga0501044_0128745 3300049823 Unclassified 2527
173 Ga0501044_0170142 3300049823 Unclassified 2151
174 Ga0501284_00038 3300050005 Bacteria 54754
175 nmdc:mga0k408_146070_c1 3300050493 Unclassified 1408
176 nmdc:mga05p37_122877_c1 3300050507 Bacteria 3189
177 nmdc:mga09592_131423_c1 3300050508 Bacteria 2154
178 nmdc:mga06r32_50633_c1 3300050510 Bacteria 3973
179 nmdc:mga08y16_185633_c1 3300050511 Bacteria 2158
180 Ga0500578_0000066 3300053086 Bacteria 116854
181 Ga0500578_0073441 3300053086 Bacteria 2179
182 Ga0500583_0000002 3300053092 Bacteria 232826
183 Ga0500583_0002659 3300053092 Bacteria 5429
184 Ga0500572_027815 3300053111 Bacteria 1552
185 Ga0500589_038583 3300053147 Bacteria 2230
186 Ga0500622_0040148 3300053156 Bacteria 2437
187 Ga0500636_0133017 3300053177 Bacteria 1384
188 2819589647 2818991444 Bacteria 6968812
189 Ga0111539_10127443
190 rootH1_10010170
191 rootH1_10026824
192 Ga0070683_100022625
193 Ga0070670_100620109
194 Ga0070666_10055712
195 Ga0070666_10310894
196 Ga0070680_100004542
197 Ga0068868_100343757
198 Ga0070660_100008391
199 Ga0070660_100160920
200 Ga0070687_100034283
201 Ga0070675_100166631
202 Ga0070671_100032925
203 Ga0070671_100062701
204 Ga0070671_100323657
205 Ga0070674_100044197
206 Ga0070674_100061419
207 Ga0070673_100114288
208 Ga0070673_100625949
209 Ga0070688_100088939
210 Ga0070678_100178235
211 Ga0070681_10051045
212 Ga0070685_10402632
213 Ga0070679_100003499
214 Ga0068853_100157008
215 Ga0068853_100762040
216 Ga0070672_100047712
217 Ga0070686_100144660
218 Ga0068855_100231880
219 Ga0070664_100076746
220 Ga0068854_100516800
221 Ga0070702_100002159
222 Ga0068852_100051694
223 Ga0068859_100426220
224 Ga0068864_100880547
225 Ga0068866_10377221
226 Ga0068861_100071480
227 Ga0068863_100043172
228 Ga0068858_100202879
229 Ga0068858_100657719
230 Ga0068860_100274604
231 Ga0097621_100001025
232 Ga0068871_100000029
233 Ga0068871_100451281
234 Ga0075431_100037366
235 Ga0075429_100220910
236 Ga0097620_100426218
237 Ga0105242_10044361
238 Ga0105242_10868815
239 Ga0105248_10035786
240 Ga0105249_10027167
241 Ga0105246_10170582
242 Ga0157370_10113362
243 Ga0157369_10170113
244 Ga0157369_10902703
245 Ga0157374_10086475
246 Ga0157374_10320832
247 Ga0157374_10541187
248 Ga0157378_10006350
249 Ga0157378_10024040
250 Ga0157378_10308858
251 Ga0163162_10000195
252 Ga0163162_10111492
253 Ga0163162_10161294
254 Ga0163162_10721651
255 Ga0157372_10344952
256 Ga0157372_10600856
257 Ga0157375_10003192
258 Ga0157375_10068336
259 Ga0157375_10460093
260 Ga0157375_10473753
261 Ga0157375_10517043
262 Ga0163163_10000377
263 Ga0157380_10003319
264 Ga0157377_10019507
265 Ga0157379_10115480
266 Ga0157379_10197202
267 Ga0157379_10306462
268 Ga0157376_10001210
269 Ga0157376_10038455
270 Ga0163161_10001838
271 Ga0163161_10015414
272 Ga0213876_10021883
273 Ga0209646_1000869
274 Ga0207642_10288408
275 Ga0207688_10017830
276 Ga0207680_10072938
277 Ga0207645_10008391
278 Ga0207705_10080766
279 Ga0207707_10109442
280 Ga0207660_10227606
281 Ga0207657_10085867
282 Ga0207652_10001304
283 Ga0207652_10082269
284 Ga0207681_10422861
285 Ga0207659_10136677
286 Ga0207644_10049101
287 Ga0207644_10111686
288 Ga0207706_10225847
289 Ga0207711_10042818
290 Ga0207661_10013687
291 Ga0207679_10143101
292 Ga0207667_10142802
293 Ga0207712_10277658
294 Ga0207640_10249554
295 Ga0207658_10407666
296 Ga0207703_10208201
297 Ga0207641_10039570
298 Ga0207648_10106648
299 Ga0207648_10264478
300 Ga0207676_10464462
301 Ga0207675_100047745
302 Ga0207675_100485312
303 Ga0207683_10104780
304 Ga0207683_10181010
305 Ga0207698_10039811
306 Ga0207698_10283308
307 Ga0268264_10369449
308 Ga0265327_10008375
309 Ga0307513_10279181
310 Ga0307513_10287734
311 Ga0307509_10232530
312 Ga0307516_10002853
313 Ga0307414_10049223
314 Ga0373925_0092987
315 Ga0436365_1321487
316 Ga0451800_0434419
317 Ga0451802_1683940
318 Ga0439457_025741
319 Ga0439462_0017510
320 Ga0466972_0000083
321 Ga0466972_0005305
322 Ga0466972_0024493
323 Ga0453684_0103310
324 Ga0453684_0187022
325 Ga0466968_0202947
326 Ga0466957_0002599
327 Ga0466960_0081132
328 Ga0495638_0282267
329 Ga0495668_0001819
330 Ga0496101_0155743
331 Ga0496106_0359076
332 Ga0496114_0061432
333 Ga0496122_0237146
334 Ga0496124_0031102
335 Ga0501032_0041697
336 Ga0501032_0415416
337 Ga0501033_0031320
338 Ga0501034_0041801
339 Ga0501034_0077379
340 Ga0501034_0207037
341 Ga0501036_0042765
342 Ga0501037_0053512
343 Ga0501038_0020779
344 Ga0501043_0039135
345 Ga0501043_0049203
346 Ga0501043_0144995
347 Ga0501043_0207002
348 Ga0501043_0586542
349 Ga0501047_0030011
350 Ga0501047_0037567
351 Ga0501047_0055081
352 Ga0501047_0232147
353 Ga0501047_0468336
354 Ga0501219_000036
355 Ga0501035_0004654
356 Ga0501035_0034702
357 Ga0501035_0096728
358 Ga0501044_0016696
359 Ga0501044_0046074
360 Ga0501044_0128745
361 Ga0501044_0170142
362 Ga0501284_00038
363 nmdc:mga0k408_146070_c1
364 nmdc:mga05p37_122877_c1
365 nmdc:mga09592_131423_c1
366 nmdc:mga06r32_50633_c1
367 nmdc:mga08y16_185633_c1
368 Ga0500578_0000066
369 Ga0500578_0073441
370 Ga0500583_0000002
371 Ga0500583_0002659
372 Ga0500572_027815
373 Ga0500589_038583
374 Ga0500622_0040148
375 Ga0500636_0133017
376 2819589647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10728

DUF2520

Domain of unknown function (DUF2520)

146

271

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

26

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d1l-assembly1.cif.gz_B crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis 0.9092 14 193
3d1l-assembly1.cif.gz_B crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis 0.8312 14 193
2i76-assembly1.cif.gz_B crystal structure of protein tm1727 from thermotoga maritima 0.8087 14 197
2i76-assembly1.cif.gz_A crystal structure of protein tm1727 from thermotoga maritima 0.7787 14 196
2i76-assembly1.cif.gz_B crystal structure of protein tm1727 from thermotoga maritima 0.7572 14 197
ID Description Score Start End Superfamily
3d1lB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;ProC-like, C-terminal domain 0.9489 98 193 1.10.1040.20
3d1lB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;ProC-like, C-terminal domain 0.9202 98 193 1.10.1040.20
af_O06279_7_172_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7971 14 93 3.40.50.720
af_A0A1D8PKZ7_1_169_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7791 31 98 3.40.50.720
2i76B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;ProC-like, C-terminal domain 0.7784 102 197 1.10.1040.20
ID Description Score Start End GO Terms
AF-A0A3C1T3K1-F1-model_v4 DUF2520 domain-containing protein 0.9943 82 193
AF-A0A3C0IM21-F1-model_v4 DUF2520 domain-containing protein 0.9849 118 195
AF-A0A7D5S3P9-F1-model_v4 DUF2520 domain-containing protein 0.9781 133 197
AF-A0A3S0K1U8-F1-model_v4 DUF2520 domain-containing protein 0.9768 76 197
AF-A0A522E8L8-F1-model_v4 DUF2520 domain-containing protein 0.9767 66 193

Map