F289220

General Info

Members Datasets Scaffolds Average Seq Length
188 149 176 603

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10002337|Ga0105240_1000233726
Length 695
Sequence MATAWRASAESDAREFRGAGEAIGHLLGTSRDIDPRLAVAFGPAVTPRPPRPVRSAQASADVAARPAGGAAANIAGSMSAPSGTTPLAGRPRGREAPXXXXRGDFAVVRRLFPYLWEYRGRVLLALVFLVTAKLANIGVPLVMKRIVDGLSGPQQVLAVPAAALIAYALLRLSSTLFNELRDVVFVKVAQSAMRRIALEVFHHLHALSLRFHLDRQTGGLTRDIERGTRGISTLLSFMVFSVLPTLLEIALVTGFLVYRFDVWFGVITVAALLVYVGLTFSISEWRTKHRRQMNEMDSKANTRAVDSLLNYETVKYFGNERFEATRYDENLRRYEKAVVTSETSLGLLNAVQACVIATAVALLMWRAAEGIVAGSLSLGDLVMVNALLIQLYIPLNFLGVMYREIKQALTDMEKMFRLLSENREVEDRPGAPALAVAGGAIRFDHVDFGYDPERRILHDVTFEVPPGRKVAVVGSSGSGKSTLARLLFRFYDVDAGRIEIDGQDIRDVRQESLRSAIGIVPQDTVLFNDTIYYNIAYGRPGASRGEIENAARVAHIAGFIARLPNGWETTVGERGLKLSGGEKQRVSIARTLLKHPPILVFDEATSALDSSTEKAIQGELAEISRDHTTLVIAHRLSTIVDADEILVLDHGRIVERGSFRELLTADGRFAEMWRLQQEEGRKQDAAGIEPADATT

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
7 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
8 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
9 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
83 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
140 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
141 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
148 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
149 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.02
Metatranscriptomes 1.6
Isolates 6.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.38
Nodule 3.72
Rhizoplane 1.06
Rhizosphere 82.98
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10006410 3300005327 Bacteria 9538
2 Ga0070658_10085789 3300005327 Bacteria 2589
3 Ga0070676_10003412 3300005328 Bacteria 8274
4 Ga0070666_10016622 3300005335 Bacteria 4708
5 Ga0070680_100019887 3300005336 Bacteria 5324
6 Ga0070680_100072680 3300005336 Bacteria 2827
7 Ga0070689_100033885 3300005340 Bacteria 3894
8 Ga0070668_100062185 3300005347 Bacteria 2892
9 Ga0070671_100073828 3300005355 Bacteria 2849
10 Ga0070673_100003672 3300005364 Bacteria 9611
11 Ga0070667_100012676 3300005367 Bacteria 6972
12 Ga0070667_100136314 3300005367 Bacteria 2146
13 Ga0070714_100016468 3300005435 Bacteria 5970
14 Ga0070663_100033199 3300005455 Bacteria 3564
15 Ga0070678_100035298 3300005456 Bacteria 3489
16 Ga0070681_10036061 3300005458 Bacteria 4968
17 Ga0070679_100019006 3300005530 Bacteria 6674
18 Ga0070679_100024788 3300005530 Bacteria 5880
19 Ga0070679_100073966 3300005530 Bacteria 3398
20 Ga0068853_100010481 3300005539 Bacteria 7496
21 Ga0070693_100032246 3300005547 Bacteria 2879
22 Ga0070665_100001945 3300005548 Bacteria 23265
23 Ga0070665_100020092 3300005548 Bacteria 6705
24 Ga0068855_100008801 3300005563 Bacteria 12200
25 Ga0068855_100033564 3300005563 Bacteria 6123
26 Ga0068855_100093343 3300005563 Bacteria 3470
27 Ga0068855_100163384 3300005563 Bacteria 2526
28 Ga0068857_100050226 3300005577 Bacteria 3701
29 Ga0068856_100005672 3300005614 Bacteria 12292
30 Ga0070702_100025963 3300005615 Bacteria 3143
31 Ga0068852_100002545 3300005616 Bacteria 12558
32 Ga0068859_100054806 3300005617 Bacteria 4011
33 Ga0068866_10008041 3300005718 Bacteria 4431
34 Ga0068858_100008670 3300005842 Bacteria 9763
35 Ga0075366_10003337 3300006195 Bacteria 8450
36 Ga0075366_10036937 3300006195 Bacteria 2881
37 Ga0097621_100037825 3300006237 Bacteria 3870
38 Ga0097621_100057490 3300006237 Bacteria 3181
39 Ga0075431_100057905 3300006847 Bacteria 3997
40 Ga0075433_10021854 3300006852 Bacteria 5368
41 Ga0075436_100000894 3300006914 Bacteria 19803
42 Ga0097620_100054807 3300006931 Bacteria 4011
43 Ga0099826_10000014 3300006948 Bacteria 258520
44 Ga0075435_100083485 3300007076 Bacteria 2627
45 Ga0105240_10002337 3300009093 Bacteria 30662
46 Ga0111539_10000336 3300009094 Bacteria 57798
47 Ga0105243_10013032 3300009148 Bacteria 6281
48 Ga0105242_10005269 3300009176 Bacteria 9985
49 Ga0105242_10005996 3300009176 Bacteria 9371
50 Ga0105238_10004860 3300009551 Bacteria 13299
51 Ga0157374_10003896 3300013296 Bacteria 12530
52 Ga0157378_10059280 3300013297 Bacteria 3415
53 Ga0157378_10087291 3300013297 Bacteria 2829
54 Ga0163162_10054400 3300013306 Bacteria 4026
55 Ga0163162_10086730 3300013306 Bacteria 3208
56 Ga0157372_10002215 3300013307 Bacteria 21115
57 Ga0157372_10019996 3300013307 Bacteria 7218
58 Ga0157379_10112613 3300014968 Bacteria 2445
59 Ga0207656_10010503 3300025321 Bacteria 3472
60 Ga0207682_10000921 3300025893 Bacteria 13640
61 Ga0207688_10014908 3300025901 Bacteria 4217
62 Ga0207645_10007830 3300025907 Bacteria 7513
63 Ga0207645_10020151 3300025907 Bacteria 4366
64 Ga0207695_10002750 3300025913 Bacteria 25639
65 Ga0207662_10019940 3300025918 Bacteria 3820
66 Ga0207652_10019582 3300025921 Bacteria 5568
67 Ga0207644_10060646 3300025931 Bacteria 2737
68 Ga0207709_10054180 3300025935 Bacteria 2472
69 Ga0207670_10077028 3300025936 Bacteria 2322
70 Ga0207669_10047711 3300025937 Bacteria 2539
71 Ga0207691_10053608 3300025940 Bacteria 3682
72 Ga0207689_10002937 3300025942 Bacteria 15742
73 Ga0207689_10055149 3300025942 Bacteria 3272
74 Ga0207667_10003244 3300025949 Bacteria 20067
75 Ga0207667_10034719 3300025949 Bacteria 5413
76 Ga0207658_10007142 3300025986 Bacteria 7608
77 Ga0207678_10038284 3300026067 Bacteria 4167
78 Ga0207648_10003756 3300026089 Bacteria 15865
79 Ga0207648_10010364 3300026089 Bacteria 8839
80 Ga0207648_10010429 3300026089 Bacteria 8803
81 Ga0207674_10022969 3300026116 Bacteria 6690
82 Ga0207674_10027821 3300026116 Bacteria 5974
83 Ga0207675_100027144 3300026118 Bacteria 5332
84 Ga0207683_10003568 3300026121 Bacteria 13568
85 Ga0207698_10022660 3300026142 Bacteria 4370
86 Ga0209282_1000048 3300027666 Bacteria 111312
87 Ga0207428_10006055 3300027907 Bacteria 11179
88 Ga0268266_10002184 3300028379 Bacteria 21420
89 Ga0307515_10028345 3300028794 Bacteria 9520
90 Ga0307515_10093677 3300028794 Bacteria 3721
91 Ga0265338_10012149 3300028800 Bacteria 9842
92 Ga0265331_10005307 3300031250 Bacteria 7799
93 Ga0265327_10000027 3300031251 Bacteria 364541
94 Ga0265327_10000295 3300031251 Bacteria 96706
95 Ga0307513_10014280 3300031456 Bacteria 9708
96 Ga0316575_10025938 3300031665 Bacteria 2276
97 Ga0316579_10000477 3300031691 Bacteria 12987
98 Ga0316579_10018034 3300031691 Bacteria 3102
99 Ga0316579_10029408 3300031691 Bacteria 2507
100 Ga0316576_10002666 3300031727 Bacteria 10208
101 Ga0316578_10004203 3300031728 Bacteria 6758
102 Ga0316578_10004506 3300031728 Bacteria 6588
103 Ga0316578_10018055 3300031728 Bacteria 3855
104 Ga0316577_10008991 3300031733 Bacteria 5361
105 Ga0316583_10005002 3300032133 Bacteria 4741
106 Ga0316583_10014295 3300032133 Bacteria 2863
107 Ga0316580_10010471 3300032139 Bacteria 2803
108 Ga0316580_10011514 3300032139 Bacteria 2686
109 Ga0316593_10015029 3300032168 Bacteria 2322
110 Ga0307510_10006573 3300033180 Bacteria 13866
111 Ga0316588_1010311 3300033528 Bacteria 1967
112 Ga0316596_1004090 3300033541 Bacteria 3242
113 Ga0316574_0001145 3300035398 Bacteria 12201
114 Ga0373935_0037752 3300035692 Bacteria 3023
115 Ga0373927_0034509 3300035695 Bacteria 3291
116 Ga0316582_0001699 3300036647 Bacteria 9889
117 Ga0316582_0026311 3300036647 Bacteria 3501
118 Ga0316582_0085955 3300036647 Bacteria 2062
119 Ga0316584_0002954 3300036712 Bacteria 10928
120 Ga0316584_0003228 3300036712 Bacteria 10554
121 Ga0316584_0004075 3300036712 Bacteria 9622
122 Ga0316584_0015820 3300036712 Bacteria 5402
123 Ga0316584_0057269 3300036712 Bacteria 2917
124 Ga0373925_0013121 3300037068 Bacteria 5996
125 Ga0395905_0052473 3300037471 Bacteria 3817
126 Ga0436363_0051374 3300039450 Bacteria 36738
127 Ga0439448_0017578 3300042005 Bacteria 2185
128 Ga0453684_0000237 3300044712 Bacteria 236999
129 Ga0453684_0004127 3300044712 Bacteria 31463
130 Ga0453684_0129774 3300044712 Bacteria 3026
131 Ga0466957_0001883 3300044842 Bacteria 11104
132 Ga0451576_0002452 3300045051 Bacteria 27656
133 Ga0466967_0074490 3300045976 Bacteria 3049
134 Ga0495592_0001337 3300046454 Bacteria 17100
135 Ga0495580_0045114 3300046472 Bacteria 3132
136 Ga0495596_0003754 3300046500 Bacteria 7580
137 Ga0495610_0006546 3300046512 Bacteria 7982
138 Ga0495616_0010991 3300046513 Bacteria 5207
139 Ga0495643_0035858 3300046522 Bacteria 2729
140 Ga0495609_0004474 3300046538 Bacteria 7637
141 Ga0495645_0057545 3300046543 Bacteria 2821
142 Ga0495658_0013388 3300046683 Bacteria 4174
143 Ga0495686_0013698 3300047472 Bacteria 5620
144 Ga0496104_0012825 3300048907 Bacteria 7549
145 Ga0496110_0115614 3300048913 Bacteria 2415
146 Ga0496122_0014543 3300048925 Bacteria 7598
147 Ga0501043_0002857 3300049579 Bacteria 14422
148 Ga0501046_0078470 3300049580 Bacteria 2554
149 Ga0501047_0030785 3300049581 Bacteria 5172
150 Ga0501069_0000995 3300049585 Bacteria 13515
151 Ga0501070_0000979 3300049586 Bacteria 25649
152 Ga0501072_0085222 3300049588 Bacteria 2506
153 Ga0501073_0000992 3300049589 Bacteria 20493
154 Ga0501074_0002231 3300049590 Bacteria 13438
155 Ga0501079_0002505 3300049741 Bacteria 13341
156 Ga0501079_0003802 3300049741 Bacteria 11151
157 Ga0501080_0069046 3300049742 Bacteria 3286
158 Ga0501083_0002697 3300049744 Bacteria 12236
159 Ga0501035_0102052 3300049822 Bacteria 2517
160 Ga0501044_0001900 3300049823 Bacteria 24165
161 nmdc:mga03n38_879_c1 3300050490 Bacteria 8082
162 nmdc:mga0k408_16871_c1 3300050493 Bacteria 4060
163 nmdc:mga0k408_5934_c1 3300050493 Bacteria 6516
164 nmdc:mga07m45_10308_c1 3300050496 Bacteria 4876
165 nmdc:mga06r32_23204_c1 3300050510 Bacteria 5738
166 nmdc:mga08y16_7630_c1 3300050511 Bacteria 11323
167 nmdc:mga0rr50_35062_c1 3300050513 Bacteria 3600
168 nmdc:mga08x19_595_c1 3300050514 Bacteria 23443
169 nmdc:mga0sz30_17091_c1 3300050516 Bacteria 2889
170 Ga0500635_0000011 3300053080 Bacteria 144219
171 Ga0500594_0004075 3300053118 Bacteria 3218
172 Ga0500559_0000778 3300053136 Bacteria 20881
173 Ga0500622_0001682 3300053156 Bacteria 17234
174 Ga0500645_002795 3300053730 Bacteria 7526
175 Ga0501084_0066201 3300054114 Bacteria 3023
176 Ga0501082_0000104 3300060353 Bacteria 66425

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10019996 Ga0157372_100199962 491
2 3300005335 Ga0070666_10016622 Ga0070666_100166223 552
3 3300005347 Ga0070668_100062185 Ga0070668_1000621852 552
4 3300005355 Ga0070671_100073828 Ga0070671_1000738283 552
5 3300005456 Ga0070678_100035298 Ga0070678_1000352983 552
6 3300005615 Ga0070702_100025963 Ga0070702_1000259631 552
7 3300005718 Ga0068866_10008041 Ga0068866_100080412 552
8 3300006237 Ga0097621_100057490 Ga0097621_1000574902 552
9 3300009148 Ga0105243_10013032 Ga0105243_100130326 552
10 3300009176 Ga0105242_10005996 Ga0105242_100059967 552
11 3300013297 Ga0157378_10059280 Ga0157378_100592803 552
12 3300014968 Ga0157379_10112613 Ga0157379_101126132 552
13 3300025893 Ga0207682_10000921 Ga0207682_1000092112 552
14 3300025901 Ga0207688_10014908 Ga0207688_100149084 552
15 3300025907 Ga0207645_10020151 Ga0207645_100201513 552
16 3300025918 Ga0207662_10019940 Ga0207662_100199402 552
17 3300025931 Ga0207644_10060646 Ga0207644_100606462 552
18 3300025935 Ga0207709_10054180 Ga0207709_100541801 552
19 3300025940 Ga0207691_10053608 Ga0207691_100536084 552
20 3300025942 Ga0207689_10055149 Ga0207689_100551492 552
21 3300026089 Ga0207648_10010364 Ga0207648_100103649 552
22 3300026118 Ga0207675_100027144 Ga0207675_1000271445 552
23 3300026121 Ga0207683_10003568 Ga0207683_100035683 552
24 3300005336 Ga0070680_100019887 Ga0070680_1000198878 563
25 3300005458 Ga0070681_10036061 Ga0070681_100360617 563
26 3300005530 Ga0070679_100073966 Ga0070679_1000739663 563
27 3300005539 Ga0068853_100010481 Ga0068853_1000104817 563
28 3300005563 Ga0068855_100163384 Ga0068855_1001633842 563
29 3300031691 Ga0316579_10000477 Ga0316579_100004779 568
30 3300031728 Ga0316578_10018055 Ga0316578_100180553 568
31 3300032133 Ga0316583_10005002 Ga0316583_100050025 568
32 3300036712 Ga0316584_0003228 Ga0316584_0003228_7048_8880 568
33 3300046454 Ga0495592_0001337 Ga0495592_0001337_2494_4260 576
34 3300042005 Ga0439448_0017578 Ga0439448_0017578_14_1996 581
35 3300031250 Ga0265331_10005307 Ga0265331_100053075 584
36 3300031251 Ga0265327_10000295 Ga0265327_1000029561 584
37 3300049741 Ga0501079_0002505 Ga0501079_0002505_21_1781 584
38 3300005455 Ga0070663_100033199 Ga0070663_1000331992 585
39 3300005548 Ga0070665_100020092 Ga0070665_1000200927 585
40 3300005563 Ga0068855_100093343 Ga0068855_1000933432 585
41 3300026067 Ga0207678_10038284 Ga0207678_100382843 585
42 3300028379 Ga0268266_10002184 Ga0268266_1000218417 585
43 3300050490 nmdc:mga03n38_879_c1 nmdc:mga03n38_879_c1_370_2364 585
44 3300050496 nmdc:mga07m45_10308_c1 nmdc:mga07m45_10308_c1_1659_3653 585
45 3300005548 Ga0070665_100001945 Ga0070665_10000194518 586
46 3300006237 Ga0097621_100037825 Ga0097621_1000378252 586
47 3300025937 Ga0207669_10047711 Ga0207669_100477112 586
48 3300005842 Ga0068858_100008670 Ga0068858_1000086707 589
49 3300009176 Ga0105242_10005269 Ga0105242_100052693 589
50 3300013306 Ga0163162_10054400 Ga0163162_100544002 589
51 3300026089 Ga0207648_10010429 Ga0207648_100104299 589
52 3300031727 Ga0316576_10002666 Ga0316576_100026663 590
53 3300031728 Ga0316578_10004203 Ga0316578_100042034 590
54 3300032139 Ga0316580_10011514 Ga0316580_100115142 590
55 3300035398 Ga0316574_0001145 Ga0316574_0001145_6522_8327 590
56 3300036712 Ga0316584_0015820 Ga0316584_0015820_85_1890 590
57 3300046522 Ga0495643_0035858 Ga0495643_0035858_312_2267 591
58 3300053136 Ga0500559_0000778 Ga0500559_0000778_12674_14512 591
59 3300044712 Ga0453684_0000237 Ga0453684_0000237_76427_78265 592
60 3300006195 Ga0075366_10003337 Ga0075366_100033375 593
61 3300050493 nmdc:mga0k408_5934_c1 nmdc:mga0k408_5934_c1_4575_6407 593
62 3300031728 Ga0316578_10004506 Ga0316578_100045063 594
63 3300031733 Ga0316577_10008991 Ga0316577_100089912 594
64 3300036647 Ga0316582_0085955 Ga0316582_0085955_169_1995 594
65 3300036712 Ga0316584_0002954 Ga0316584_0002954_3953_5779 594
66 iso_pu_bacteria 2882456835 2882457823 594
67 3300028794 Ga0307515_10028345 Ga0307515_100283458 595
68 3300037068 Ga0373925_0013121 Ga0373925_0013121_2276_4099 595
69 3300053730 Ga0500645_002795 Ga0500645_002795_4883_6706 595
70 3300031691 Ga0316579_10029408 Ga0316579_100294082 596
71 3300032139 Ga0316580_10010471 Ga0316580_100104712 596
72 3300032168 Ga0316593_10015029 Ga0316593_100150292 596
73 3300033528 Ga0316588_1010311 Ga0316588_10103111 596
74 3300033541 Ga0316596_1004090 Ga0316596_10040903 596
75 3300036647 Ga0316582_0001699 Ga0316582_0001699_572_2377 596
76 3300036712 Ga0316584_0004075 Ga0316584_0004075_6135_7940 596
77 3300044712 Ga0453684_0129774 Ga0453684_0129774_993_2873 596
78 3300049580 Ga0501046_0078470 Ga0501046_0078470_115_1917 596
79 3300049822 Ga0501035_0102052 Ga0501035_0102052_337_2139 596
80 3300060353 Ga0501082_0000104 Ga0501082_0000104_7813_9615 596
81 3300031665 Ga0316575_10025938 Ga0316575_100259382 597
82 3300031691 Ga0316579_10018034 Ga0316579_100180342 597
83 3300032133 Ga0316583_10014295 Ga0316583_100142952 597
84 3300036647 Ga0316582_0026311 Ga0316582_0026311_553_2382 597
85 3300045051 Ga0451576_0002452 Ga0451576_0002452_24759_26630 598
86 3300049579 Ga0501043_0002857 Ga0501043_0002857_7197_8999 598
87 3300049823 Ga0501044_0001900 Ga0501044_0001900_11935_13737 598
88 3300013296 Ga0157374_10003896 Ga0157374_100038966 599
89 3300013297 Ga0157378_10087291 Ga0157378_100872912 599
90 iso_pu_bacteria 8055225921 8055228711 599
91 3300006195 Ga0075366_10036937 Ga0075366_100369373 600
92 3300013306 Ga0163162_10086730 Ga0163162_100867302 600
93 3300033180 Ga0307510_10006573 Ga0307510_100065735 600
94 3300036712 Ga0316584_0057269 Ga0316584_0057269_417_2243 600
95 3300050493 nmdc:mga0k408_16871_c1 nmdc:mga0k408_16871_c1_764_2614 600
96 3300050516 nmdc:mga0sz30_17091_c1 nmdc:mga0sz30_17091_c1_1026_2834 600
97 3300053118 Ga0500594_0004075 Ga0500594_0004075_927_2765 600
98 3300053156 Ga0500622_0001682 Ga0500622_0001682_7365_9203 600
99 3300005328 Ga0070676_10003412 Ga0070676_100034124 602
100 3300005364 Ga0070673_100003672 Ga0070673_1000036727 602
101 3300005367 Ga0070667_100136314 Ga0070667_1001363141 602
102 3300005547 Ga0070693_100032246 Ga0070693_1000322463 602
103 3300005577 Ga0068857_100050226 Ga0068857_1000502262 602
104 3300005617 Ga0068859_100054806 Ga0068859_1000548061 602
105 3300006931 Ga0097620_100054807 Ga0097620_1000548073 602
106 3300025907 Ga0207645_10007830 Ga0207645_100078303 602
107 3300025936 Ga0207670_10077028 Ga0207670_100770282 602
108 3300025942 Ga0207689_10002937 Ga0207689_1000293714 602
109 3300026089 Ga0207648_10003756 Ga0207648_100037566 602
110 3300026116 Ga0207674_10022969 Ga0207674_100229696 602
111 3300026116 Ga0207674_10027821 Ga0207674_100278214 602
112 3300046543 Ga0495645_0057545 Ga0495645_0057545_647_2455 602
113 3300005336 Ga0070680_100072680 Ga0070680_1000726802 603
114 3300005367 Ga0070667_100012676 Ga0070667_1000126765 603
115 3300025986 Ga0207658_10007142 Ga0207658_100071423 603
116 3300028794 Ga0307515_10093677 Ga0307515_100936772 603
117 3300028800 Ga0265338_10012149 Ga0265338_100121496 603
118 3300031456 Ga0307513_10014280 Ga0307513_100142808 603
119 3300049581 Ga0501047_0030785 Ga0501047_0030785_3253_5109 603
120 3300049585 Ga0501069_0000995 Ga0501069_0000995_6053_7909 603
121 3300049586 Ga0501070_0000979 Ga0501070_0000979_6990_8846 603
122 3300049588 Ga0501072_0085222 Ga0501072_0085222_141_1997 603
123 3300049589 Ga0501073_0000992 Ga0501073_0000992_12506_14362 603
124 3300049590 Ga0501074_0002231 Ga0501074_0002231_8458_10314 603
125 3300049741 Ga0501079_0003802 Ga0501079_0003802_597_2453 603
126 3300049742 Ga0501080_0069046 Ga0501080_0069046_1278_3134 603
127 3300049744 Ga0501083_0002697 Ga0501083_0002697_7252_9108 603
128 3300054114 Ga0501084_0066201 Ga0501084_0066201_788_2644 603
129 3300044712 Ga0453684_0004127 Ga0453684_0004127_12790_14715 604
130 3300045976 Ga0466967_0074490 Ga0466967_0074490_489_2354 604
131 3300005340 Ga0070689_100033885 Ga0070689_1000338852 605
132 3300006852 Ga0075433_10021854 Ga0075433_100218544 605
133 3300025321 Ga0207656_10010503 Ga0207656_100105032 605
134 3300031251 Ga0265327_10000027 Ga0265327_10000027160 605
135 3300048907 Ga0496104_0012825 Ga0496104_0012825_2068_3894 605
136 3300048913 Ga0496110_0115614 Ga0496110_0115614_202_2028 605
137 iso_pu_bacteria 2643221603 2644028052 605
138 3300035692 Ga0373935_0037752 Ga0373935_0037752_175_2001 606
139 3300035695 Ga0373927_0034509 Ga0373927_0034509_1332_3158 606
140 iso_pu_bacteria 2508501050 2508733393 606
141 iso_pu_bacteria 2513237150 2513953945 606
142 iso_pu_bacteria 2513237165 2514040080 606
143 iso_pu_bacteria 2775506901 2776261296 606
144 iso_pu_bacteria 644736347 644746740 606
145 3300006847 Ga0075431_100057905 Ga0075431_1000579052 607
146 3300046472 Ga0495580_0045114 Ga0495580_0045114_504_2387 607
147 3300046683 Ga0495658_0013388 Ga0495658_0013388_1923_3806 607
148 3300050510 nmdc:mga06r32_23204_c1 nmdc:mga06r32_23204_c1_2233_4062 607
149 iso_pu_bacteria 2508501114 2509074048 607
150 iso_pu_bacteria 2643221654 2644303189 607
151 3300005327 Ga0070658_10085789 Ga0070658_100857891 608
152 3300047472 Ga0495686_0013698 Ga0495686_0013698_2660_4543 608
153 3300053080 Ga0500635_0000011 Ga0500635_0000011_126842_128713 608
154 3300009094 Ga0111539_10000336 Ga0111539_1000033647 609
155 3300027907 Ga0207428_10006055 Ga0207428_100060559 609
156 3300039450 Ga0436363_0051374 Ga0436363_0051374_29568_31538 609
157 3300050511 nmdc:mga08y16_7630_c1 nmdc:mga08y16_7630_c1_3450_5291 609
158 iso_pu_bacteria 2834641062 2834641210 610
159 iso_pu_bacteria 8003400568 8003401108 610
160 3300005616 Ga0068852_100002545 Ga0068852_10000254510 611
161 3300006948 Ga0099826_10000014 Ga0099826_10000014181 611
162 3300026142 Ga0207698_10022660 Ga0207698_100226603 611
163 3300027666 Ga0209282_1000048 Ga0209282_100004848 611
164 3300046500 Ga0495596_0003754 Ga0495596_0003754_5214_7115 611
165 3300046512 Ga0495610_0006546 Ga0495610_0006546_5648_7549 611
166 3300046513 Ga0495616_0010991 Ga0495616_0010991_437_2338 611
167 3300046538 Ga0495609_0004474 Ga0495609_0004474_5296_7197 611
168 3300048925 Ga0496122_0014543 Ga0496122_0014543_5246_7147 611
169 3300005530 Ga0070679_100019006 Ga0070679_1000190065 612
170 3300037471 Ga0395905_0052473 Ga0395905_0052473_1722_3575 612
171 3300005614 Ga0068856_100005672 Ga0068856_1000056728 613
172 3300009551 Ga0105238_10004860 Ga0105238_100048609 613
173 3300013307 Ga0157372_10002215 Ga0157372_1000221515 613
174 3300006914 Ga0075436_100000894 Ga0075436_10000089410 615
175 3300007076 Ga0075435_100083485 Ga0075435_1000834852 615
176 3300044842 Ga0466957_0001883 Ga0466957_0001883_8826_10679 615
177 3300050513 nmdc:mga0rr50_35062_c1 nmdc:mga0rr50_35062_c1_452_2308 615
178 3300050514 nmdc:mga08x19_595_c1 nmdc:mga08x19_595_c1_13868_15724 615
179 3300005327 Ga0070658_10006410 Ga0070658_100064108 616
180 3300005435 Ga0070714_100016468 Ga0070714_1000164684 616
181 3300005530 Ga0070679_100024788 Ga0070679_1000247885 616
182 3300005563 Ga0068855_100008801 Ga0068855_1000088011 616
183 3300005563 Ga0068855_100033564 Ga0068855_1000335644 616
184 3300009093 Ga0105240_10002337 Ga0105240_1000233726 616
185 3300025913 Ga0207695_10002750 Ga0207695_100027502 616
186 3300025921 Ga0207652_10019582 Ga0207652_100195823 616
187 3300025949 Ga0207667_10003244 Ga0207667_100032447 616
188 3300025949 Ga0207667_10034719 Ga0207667_100347193 616

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00664

ABC_membrane

ABC transporter transmembrane region

122

395

0.97

PF00005

ABC_tran

ABC transporter

457

606

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ghi-assembly1.cif.gz_A crystal structure of plasmodium yoelii multidrug resistance protein 2 0.9598 354 598
2ghi-assembly4.cif.gz_D crystal structure of plasmodium yoelii multidrug resistance protein 2 0.943 359 596
2fgk-assembly2.cif.gz_B crystal structure of the abc-cassette e631q mutant of hlyb with bound atp 0.9399 362 597
3vx4-assembly1.cif.gz_A crystal structure of the nucleotide-binding domain of s. mutans coma, a bifunctional atp-binding cassette transporter involved in the quorum-sensing pathway 0.9348 359 594
4mrn-assembly1.cif.gz_A structure of a bacterial atm1-family abc transporter 0.934 23 607
ID Description Score Start End Superfamily
af_O53645_329_572_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9711 361 592 3.40.50.300
af_Q2FVJ2_326_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9666 354 601 3.40.50.300
af_Q7K6A5_1228_1417_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9661 415 584 3.40.50.300
af_A0A0P0VTT5_46_316_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9646 354 588 3.40.50.300
af_O53645_932_1184_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9621 352 596 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W3T926-F1-model_v4 ATP-binding cassette domain-containing protein 0.9742 380 584 GO:0005524
GO:0015421
GO:0016887
AF-A0A2A8D2P9-F1-model_v4 ABC transporter domain-containing protein 0.9711 359 602 GO:0005524
GO:0016887
GO:0034040
AF-A0A820M297-F1-model_v4 Uncharacterized protein 0.9681 355 606 GO:0005524
GO:0005743
GO:0015421
GO:0016887
GO:0090374
AF-A0A7Y4NIU2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9663 406 597 GO:0005524
GO:0015421
GO:0016887
GO:0090374
AF-A0A847KX24-F1-model_v4 deleted 0.9577 387 600

Feature Viewer

pLDDT pTM Quality
85.44 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map