F289220
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 188 | 149 | 176 | 603 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10002337|Ga0105240_1000233726 |
| Length | 695 |
| Sequence | MATAWRASAESDAREFRGAGEAIGHLLGTSRDIDPRLAVAFGPAVTPRPPRPVRSAQASADVAARPAGGAAANIAGSMSAPSGTTPLAGRPRGREAPXXXXRGDFAVVRRLFPYLWEYRGRVLLALVFLVTAKLANIGVPLVMKRIVDGLSGPQQVLAVPAAALIAYALLRLSSTLFNELRDVVFVKVAQSAMRRIALEVFHHLHALSLRFHLDRQTGGLTRDIERGTRGISTLLSFMVFSVLPTLLEIALVTGFLVYRFDVWFGVITVAALLVYVGLTFSISEWRTKHRRQMNEMDSKANTRAVDSLLNYETVKYFGNERFEATRYDENLRRYEKAVVTSETSLGLLNAVQACVIATAVALLMWRAAEGIVAGSLSLGDLVMVNALLIQLYIPLNFLGVMYREIKQALTDMEKMFRLLSENREVEDRPGAPALAVAGGAIRFDHVDFGYDPERRILHDVTFEVPPGRKVAVVGSSGSGKSTLARLLFRFYDVDAGRIEIDGQDIRDVRQESLRSAIGIVPQDTVLFNDTIYYNIAYGRPGASRGEIENAARVAHIAGFIARLPNGWETTVGERGLKLSGGEKQRVSIARTLLKHPPILVFDEATSALDSSTEKAIQGELAEISRDHTTLVIAHRLSTIVDADEILVLDHGRIVERGSFRELLTADGRFAEMWRLQQEEGRKQDAAGIEPADATT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 6 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 7 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 8 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 9 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 42 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 75 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 78 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 80 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 81 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 82 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 83 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 84 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 85 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 86 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 87 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 88 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 89 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 91 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 94 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 95 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 96 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 97 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 98 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 100 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 101 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 102 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 103 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 104 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 105 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 106 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 117 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 118 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 119 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 133 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 134 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 135 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 140 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 141 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 142 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 143 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 144 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 145 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 148 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 149 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.02 |
| Metatranscriptomes | 1.6 |
| Isolates | 6.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.38 |
| Nodule | 3.72 |
| Rhizoplane | 1.06 |
| Rhizosphere | 82.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10006410 | 3300005327 | Bacteria | 9538 |
| 2 | Ga0070658_10085789 | 3300005327 | Bacteria | 2589 |
| 3 | Ga0070676_10003412 | 3300005328 | Bacteria | 8274 |
| 4 | Ga0070666_10016622 | 3300005335 | Bacteria | 4708 |
| 5 | Ga0070680_100019887 | 3300005336 | Bacteria | 5324 |
| 6 | Ga0070680_100072680 | 3300005336 | Bacteria | 2827 |
| 7 | Ga0070689_100033885 | 3300005340 | Bacteria | 3894 |
| 8 | Ga0070668_100062185 | 3300005347 | Bacteria | 2892 |
| 9 | Ga0070671_100073828 | 3300005355 | Bacteria | 2849 |
| 10 | Ga0070673_100003672 | 3300005364 | Bacteria | 9611 |
| 11 | Ga0070667_100012676 | 3300005367 | Bacteria | 6972 |
| 12 | Ga0070667_100136314 | 3300005367 | Bacteria | 2146 |
| 13 | Ga0070714_100016468 | 3300005435 | Bacteria | 5970 |
| 14 | Ga0070663_100033199 | 3300005455 | Bacteria | 3564 |
| 15 | Ga0070678_100035298 | 3300005456 | Bacteria | 3489 |
| 16 | Ga0070681_10036061 | 3300005458 | Bacteria | 4968 |
| 17 | Ga0070679_100019006 | 3300005530 | Bacteria | 6674 |
| 18 | Ga0070679_100024788 | 3300005530 | Bacteria | 5880 |
| 19 | Ga0070679_100073966 | 3300005530 | Bacteria | 3398 |
| 20 | Ga0068853_100010481 | 3300005539 | Bacteria | 7496 |
| 21 | Ga0070693_100032246 | 3300005547 | Bacteria | 2879 |
| 22 | Ga0070665_100001945 | 3300005548 | Bacteria | 23265 |
| 23 | Ga0070665_100020092 | 3300005548 | Bacteria | 6705 |
| 24 | Ga0068855_100008801 | 3300005563 | Bacteria | 12200 |
| 25 | Ga0068855_100033564 | 3300005563 | Bacteria | 6123 |
| 26 | Ga0068855_100093343 | 3300005563 | Bacteria | 3470 |
| 27 | Ga0068855_100163384 | 3300005563 | Bacteria | 2526 |
| 28 | Ga0068857_100050226 | 3300005577 | Bacteria | 3701 |
| 29 | Ga0068856_100005672 | 3300005614 | Bacteria | 12292 |
| 30 | Ga0070702_100025963 | 3300005615 | Bacteria | 3143 |
| 31 | Ga0068852_100002545 | 3300005616 | Bacteria | 12558 |
| 32 | Ga0068859_100054806 | 3300005617 | Bacteria | 4011 |
| 33 | Ga0068866_10008041 | 3300005718 | Bacteria | 4431 |
| 34 | Ga0068858_100008670 | 3300005842 | Bacteria | 9763 |
| 35 | Ga0075366_10003337 | 3300006195 | Bacteria | 8450 |
| 36 | Ga0075366_10036937 | 3300006195 | Bacteria | 2881 |
| 37 | Ga0097621_100037825 | 3300006237 | Bacteria | 3870 |
| 38 | Ga0097621_100057490 | 3300006237 | Bacteria | 3181 |
| 39 | Ga0075431_100057905 | 3300006847 | Bacteria | 3997 |
| 40 | Ga0075433_10021854 | 3300006852 | Bacteria | 5368 |
| 41 | Ga0075436_100000894 | 3300006914 | Bacteria | 19803 |
| 42 | Ga0097620_100054807 | 3300006931 | Bacteria | 4011 |
| 43 | Ga0099826_10000014 | 3300006948 | Bacteria | 258520 |
| 44 | Ga0075435_100083485 | 3300007076 | Bacteria | 2627 |
| 45 | Ga0105240_10002337 | 3300009093 | Bacteria | 30662 |
| 46 | Ga0111539_10000336 | 3300009094 | Bacteria | 57798 |
| 47 | Ga0105243_10013032 | 3300009148 | Bacteria | 6281 |
| 48 | Ga0105242_10005269 | 3300009176 | Bacteria | 9985 |
| 49 | Ga0105242_10005996 | 3300009176 | Bacteria | 9371 |
| 50 | Ga0105238_10004860 | 3300009551 | Bacteria | 13299 |
| 51 | Ga0157374_10003896 | 3300013296 | Bacteria | 12530 |
| 52 | Ga0157378_10059280 | 3300013297 | Bacteria | 3415 |
| 53 | Ga0157378_10087291 | 3300013297 | Bacteria | 2829 |
| 54 | Ga0163162_10054400 | 3300013306 | Bacteria | 4026 |
| 55 | Ga0163162_10086730 | 3300013306 | Bacteria | 3208 |
| 56 | Ga0157372_10002215 | 3300013307 | Bacteria | 21115 |
| 57 | Ga0157372_10019996 | 3300013307 | Bacteria | 7218 |
| 58 | Ga0157379_10112613 | 3300014968 | Bacteria | 2445 |
| 59 | Ga0207656_10010503 | 3300025321 | Bacteria | 3472 |
| 60 | Ga0207682_10000921 | 3300025893 | Bacteria | 13640 |
| 61 | Ga0207688_10014908 | 3300025901 | Bacteria | 4217 |
| 62 | Ga0207645_10007830 | 3300025907 | Bacteria | 7513 |
| 63 | Ga0207645_10020151 | 3300025907 | Bacteria | 4366 |
| 64 | Ga0207695_10002750 | 3300025913 | Bacteria | 25639 |
| 65 | Ga0207662_10019940 | 3300025918 | Bacteria | 3820 |
| 66 | Ga0207652_10019582 | 3300025921 | Bacteria | 5568 |
| 67 | Ga0207644_10060646 | 3300025931 | Bacteria | 2737 |
| 68 | Ga0207709_10054180 | 3300025935 | Bacteria | 2472 |
| 69 | Ga0207670_10077028 | 3300025936 | Bacteria | 2322 |
| 70 | Ga0207669_10047711 | 3300025937 | Bacteria | 2539 |
| 71 | Ga0207691_10053608 | 3300025940 | Bacteria | 3682 |
| 72 | Ga0207689_10002937 | 3300025942 | Bacteria | 15742 |
| 73 | Ga0207689_10055149 | 3300025942 | Bacteria | 3272 |
| 74 | Ga0207667_10003244 | 3300025949 | Bacteria | 20067 |
| 75 | Ga0207667_10034719 | 3300025949 | Bacteria | 5413 |
| 76 | Ga0207658_10007142 | 3300025986 | Bacteria | 7608 |
| 77 | Ga0207678_10038284 | 3300026067 | Bacteria | 4167 |
| 78 | Ga0207648_10003756 | 3300026089 | Bacteria | 15865 |
| 79 | Ga0207648_10010364 | 3300026089 | Bacteria | 8839 |
| 80 | Ga0207648_10010429 | 3300026089 | Bacteria | 8803 |
| 81 | Ga0207674_10022969 | 3300026116 | Bacteria | 6690 |
| 82 | Ga0207674_10027821 | 3300026116 | Bacteria | 5974 |
| 83 | Ga0207675_100027144 | 3300026118 | Bacteria | 5332 |
| 84 | Ga0207683_10003568 | 3300026121 | Bacteria | 13568 |
| 85 | Ga0207698_10022660 | 3300026142 | Bacteria | 4370 |
| 86 | Ga0209282_1000048 | 3300027666 | Bacteria | 111312 |
| 87 | Ga0207428_10006055 | 3300027907 | Bacteria | 11179 |
| 88 | Ga0268266_10002184 | 3300028379 | Bacteria | 21420 |
| 89 | Ga0307515_10028345 | 3300028794 | Bacteria | 9520 |
| 90 | Ga0307515_10093677 | 3300028794 | Bacteria | 3721 |
| 91 | Ga0265338_10012149 | 3300028800 | Bacteria | 9842 |
| 92 | Ga0265331_10005307 | 3300031250 | Bacteria | 7799 |
| 93 | Ga0265327_10000027 | 3300031251 | Bacteria | 364541 |
| 94 | Ga0265327_10000295 | 3300031251 | Bacteria | 96706 |
| 95 | Ga0307513_10014280 | 3300031456 | Bacteria | 9708 |
| 96 | Ga0316575_10025938 | 3300031665 | Bacteria | 2276 |
| 97 | Ga0316579_10000477 | 3300031691 | Bacteria | 12987 |
| 98 | Ga0316579_10018034 | 3300031691 | Bacteria | 3102 |
| 99 | Ga0316579_10029408 | 3300031691 | Bacteria | 2507 |
| 100 | Ga0316576_10002666 | 3300031727 | Bacteria | 10208 |
| 101 | Ga0316578_10004203 | 3300031728 | Bacteria | 6758 |
| 102 | Ga0316578_10004506 | 3300031728 | Bacteria | 6588 |
| 103 | Ga0316578_10018055 | 3300031728 | Bacteria | 3855 |
| 104 | Ga0316577_10008991 | 3300031733 | Bacteria | 5361 |
| 105 | Ga0316583_10005002 | 3300032133 | Bacteria | 4741 |
| 106 | Ga0316583_10014295 | 3300032133 | Bacteria | 2863 |
| 107 | Ga0316580_10010471 | 3300032139 | Bacteria | 2803 |
| 108 | Ga0316580_10011514 | 3300032139 | Bacteria | 2686 |
| 109 | Ga0316593_10015029 | 3300032168 | Bacteria | 2322 |
| 110 | Ga0307510_10006573 | 3300033180 | Bacteria | 13866 |
| 111 | Ga0316588_1010311 | 3300033528 | Bacteria | 1967 |
| 112 | Ga0316596_1004090 | 3300033541 | Bacteria | 3242 |
| 113 | Ga0316574_0001145 | 3300035398 | Bacteria | 12201 |
| 114 | Ga0373935_0037752 | 3300035692 | Bacteria | 3023 |
| 115 | Ga0373927_0034509 | 3300035695 | Bacteria | 3291 |
| 116 | Ga0316582_0001699 | 3300036647 | Bacteria | 9889 |
| 117 | Ga0316582_0026311 | 3300036647 | Bacteria | 3501 |
| 118 | Ga0316582_0085955 | 3300036647 | Bacteria | 2062 |
| 119 | Ga0316584_0002954 | 3300036712 | Bacteria | 10928 |
| 120 | Ga0316584_0003228 | 3300036712 | Bacteria | 10554 |
| 121 | Ga0316584_0004075 | 3300036712 | Bacteria | 9622 |
| 122 | Ga0316584_0015820 | 3300036712 | Bacteria | 5402 |
| 123 | Ga0316584_0057269 | 3300036712 | Bacteria | 2917 |
| 124 | Ga0373925_0013121 | 3300037068 | Bacteria | 5996 |
| 125 | Ga0395905_0052473 | 3300037471 | Bacteria | 3817 |
| 126 | Ga0436363_0051374 | 3300039450 | Bacteria | 36738 |
| 127 | Ga0439448_0017578 | 3300042005 | Bacteria | 2185 |
| 128 | Ga0453684_0000237 | 3300044712 | Bacteria | 236999 |
| 129 | Ga0453684_0004127 | 3300044712 | Bacteria | 31463 |
| 130 | Ga0453684_0129774 | 3300044712 | Bacteria | 3026 |
| 131 | Ga0466957_0001883 | 3300044842 | Bacteria | 11104 |
| 132 | Ga0451576_0002452 | 3300045051 | Bacteria | 27656 |
| 133 | Ga0466967_0074490 | 3300045976 | Bacteria | 3049 |
| 134 | Ga0495592_0001337 | 3300046454 | Bacteria | 17100 |
| 135 | Ga0495580_0045114 | 3300046472 | Bacteria | 3132 |
| 136 | Ga0495596_0003754 | 3300046500 | Bacteria | 7580 |
| 137 | Ga0495610_0006546 | 3300046512 | Bacteria | 7982 |
| 138 | Ga0495616_0010991 | 3300046513 | Bacteria | 5207 |
| 139 | Ga0495643_0035858 | 3300046522 | Bacteria | 2729 |
| 140 | Ga0495609_0004474 | 3300046538 | Bacteria | 7637 |
| 141 | Ga0495645_0057545 | 3300046543 | Bacteria | 2821 |
| 142 | Ga0495658_0013388 | 3300046683 | Bacteria | 4174 |
| 143 | Ga0495686_0013698 | 3300047472 | Bacteria | 5620 |
| 144 | Ga0496104_0012825 | 3300048907 | Bacteria | 7549 |
| 145 | Ga0496110_0115614 | 3300048913 | Bacteria | 2415 |
| 146 | Ga0496122_0014543 | 3300048925 | Bacteria | 7598 |
| 147 | Ga0501043_0002857 | 3300049579 | Bacteria | 14422 |
| 148 | Ga0501046_0078470 | 3300049580 | Bacteria | 2554 |
| 149 | Ga0501047_0030785 | 3300049581 | Bacteria | 5172 |
| 150 | Ga0501069_0000995 | 3300049585 | Bacteria | 13515 |
| 151 | Ga0501070_0000979 | 3300049586 | Bacteria | 25649 |
| 152 | Ga0501072_0085222 | 3300049588 | Bacteria | 2506 |
| 153 | Ga0501073_0000992 | 3300049589 | Bacteria | 20493 |
| 154 | Ga0501074_0002231 | 3300049590 | Bacteria | 13438 |
| 155 | Ga0501079_0002505 | 3300049741 | Bacteria | 13341 |
| 156 | Ga0501079_0003802 | 3300049741 | Bacteria | 11151 |
| 157 | Ga0501080_0069046 | 3300049742 | Bacteria | 3286 |
| 158 | Ga0501083_0002697 | 3300049744 | Bacteria | 12236 |
| 159 | Ga0501035_0102052 | 3300049822 | Bacteria | 2517 |
| 160 | Ga0501044_0001900 | 3300049823 | Bacteria | 24165 |
| 161 | nmdc:mga03n38_879_c1 | 3300050490 | Bacteria | 8082 |
| 162 | nmdc:mga0k408_16871_c1 | 3300050493 | Bacteria | 4060 |
| 163 | nmdc:mga0k408_5934_c1 | 3300050493 | Bacteria | 6516 |
| 164 | nmdc:mga07m45_10308_c1 | 3300050496 | Bacteria | 4876 |
| 165 | nmdc:mga06r32_23204_c1 | 3300050510 | Bacteria | 5738 |
| 166 | nmdc:mga08y16_7630_c1 | 3300050511 | Bacteria | 11323 |
| 167 | nmdc:mga0rr50_35062_c1 | 3300050513 | Bacteria | 3600 |
| 168 | nmdc:mga08x19_595_c1 | 3300050514 | Bacteria | 23443 |
| 169 | nmdc:mga0sz30_17091_c1 | 3300050516 | Bacteria | 2889 |
| 170 | Ga0500635_0000011 | 3300053080 | Bacteria | 144219 |
| 171 | Ga0500594_0004075 | 3300053118 | Bacteria | 3218 |
| 172 | Ga0500559_0000778 | 3300053136 | Bacteria | 20881 |
| 173 | Ga0500622_0001682 | 3300053156 | Bacteria | 17234 |
| 174 | Ga0500645_002795 | 3300053730 | Bacteria | 7526 |
| 175 | Ga0501084_0066201 | 3300054114 | Bacteria | 3023 |
| 176 | Ga0501082_0000104 | 3300060353 | Bacteria | 66425 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_10019996 | Ga0157372_100199962 | 491 |
| 2 | 3300005335 | Ga0070666_10016622 | Ga0070666_100166223 | 552 |
| 3 | 3300005347 | Ga0070668_100062185 | Ga0070668_1000621852 | 552 |
| 4 | 3300005355 | Ga0070671_100073828 | Ga0070671_1000738283 | 552 |
| 5 | 3300005456 | Ga0070678_100035298 | Ga0070678_1000352983 | 552 |
| 6 | 3300005615 | Ga0070702_100025963 | Ga0070702_1000259631 | 552 |
| 7 | 3300005718 | Ga0068866_10008041 | Ga0068866_100080412 | 552 |
| 8 | 3300006237 | Ga0097621_100057490 | Ga0097621_1000574902 | 552 |
| 9 | 3300009148 | Ga0105243_10013032 | Ga0105243_100130326 | 552 |
| 10 | 3300009176 | Ga0105242_10005996 | Ga0105242_100059967 | 552 |
| 11 | 3300013297 | Ga0157378_10059280 | Ga0157378_100592803 | 552 |
| 12 | 3300014968 | Ga0157379_10112613 | Ga0157379_101126132 | 552 |
| 13 | 3300025893 | Ga0207682_10000921 | Ga0207682_1000092112 | 552 |
| 14 | 3300025901 | Ga0207688_10014908 | Ga0207688_100149084 | 552 |
| 15 | 3300025907 | Ga0207645_10020151 | Ga0207645_100201513 | 552 |
| 16 | 3300025918 | Ga0207662_10019940 | Ga0207662_100199402 | 552 |
| 17 | 3300025931 | Ga0207644_10060646 | Ga0207644_100606462 | 552 |
| 18 | 3300025935 | Ga0207709_10054180 | Ga0207709_100541801 | 552 |
| 19 | 3300025940 | Ga0207691_10053608 | Ga0207691_100536084 | 552 |
| 20 | 3300025942 | Ga0207689_10055149 | Ga0207689_100551492 | 552 |
| 21 | 3300026089 | Ga0207648_10010364 | Ga0207648_100103649 | 552 |
| 22 | 3300026118 | Ga0207675_100027144 | Ga0207675_1000271445 | 552 |
| 23 | 3300026121 | Ga0207683_10003568 | Ga0207683_100035683 | 552 |
| 24 | 3300005336 | Ga0070680_100019887 | Ga0070680_1000198878 | 563 |
| 25 | 3300005458 | Ga0070681_10036061 | Ga0070681_100360617 | 563 |
| 26 | 3300005530 | Ga0070679_100073966 | Ga0070679_1000739663 | 563 |
| 27 | 3300005539 | Ga0068853_100010481 | Ga0068853_1000104817 | 563 |
| 28 | 3300005563 | Ga0068855_100163384 | Ga0068855_1001633842 | 563 |
| 29 | 3300031691 | Ga0316579_10000477 | Ga0316579_100004779 | 568 |
| 30 | 3300031728 | Ga0316578_10018055 | Ga0316578_100180553 | 568 |
| 31 | 3300032133 | Ga0316583_10005002 | Ga0316583_100050025 | 568 |
| 32 | 3300036712 | Ga0316584_0003228 | Ga0316584_0003228_7048_8880 | 568 |
| 33 | 3300046454 | Ga0495592_0001337 | Ga0495592_0001337_2494_4260 | 576 |
| 34 | 3300042005 | Ga0439448_0017578 | Ga0439448_0017578_14_1996 | 581 |
| 35 | 3300031250 | Ga0265331_10005307 | Ga0265331_100053075 | 584 |
| 36 | 3300031251 | Ga0265327_10000295 | Ga0265327_1000029561 | 584 |
| 37 | 3300049741 | Ga0501079_0002505 | Ga0501079_0002505_21_1781 | 584 |
| 38 | 3300005455 | Ga0070663_100033199 | Ga0070663_1000331992 | 585 |
| 39 | 3300005548 | Ga0070665_100020092 | Ga0070665_1000200927 | 585 |
| 40 | 3300005563 | Ga0068855_100093343 | Ga0068855_1000933432 | 585 |
| 41 | 3300026067 | Ga0207678_10038284 | Ga0207678_100382843 | 585 |
| 42 | 3300028379 | Ga0268266_10002184 | Ga0268266_1000218417 | 585 |
| 43 | 3300050490 | nmdc:mga03n38_879_c1 | nmdc:mga03n38_879_c1_370_2364 | 585 |
| 44 | 3300050496 | nmdc:mga07m45_10308_c1 | nmdc:mga07m45_10308_c1_1659_3653 | 585 |
| 45 | 3300005548 | Ga0070665_100001945 | Ga0070665_10000194518 | 586 |
| 46 | 3300006237 | Ga0097621_100037825 | Ga0097621_1000378252 | 586 |
| 47 | 3300025937 | Ga0207669_10047711 | Ga0207669_100477112 | 586 |
| 48 | 3300005842 | Ga0068858_100008670 | Ga0068858_1000086707 | 589 |
| 49 | 3300009176 | Ga0105242_10005269 | Ga0105242_100052693 | 589 |
| 50 | 3300013306 | Ga0163162_10054400 | Ga0163162_100544002 | 589 |
| 51 | 3300026089 | Ga0207648_10010429 | Ga0207648_100104299 | 589 |
| 52 | 3300031727 | Ga0316576_10002666 | Ga0316576_100026663 | 590 |
| 53 | 3300031728 | Ga0316578_10004203 | Ga0316578_100042034 | 590 |
| 54 | 3300032139 | Ga0316580_10011514 | Ga0316580_100115142 | 590 |
| 55 | 3300035398 | Ga0316574_0001145 | Ga0316574_0001145_6522_8327 | 590 |
| 56 | 3300036712 | Ga0316584_0015820 | Ga0316584_0015820_85_1890 | 590 |
| 57 | 3300046522 | Ga0495643_0035858 | Ga0495643_0035858_312_2267 | 591 |
| 58 | 3300053136 | Ga0500559_0000778 | Ga0500559_0000778_12674_14512 | 591 |
| 59 | 3300044712 | Ga0453684_0000237 | Ga0453684_0000237_76427_78265 | 592 |
| 60 | 3300006195 | Ga0075366_10003337 | Ga0075366_100033375 | 593 |
| 61 | 3300050493 | nmdc:mga0k408_5934_c1 | nmdc:mga0k408_5934_c1_4575_6407 | 593 |
| 62 | 3300031728 | Ga0316578_10004506 | Ga0316578_100045063 | 594 |
| 63 | 3300031733 | Ga0316577_10008991 | Ga0316577_100089912 | 594 |
| 64 | 3300036647 | Ga0316582_0085955 | Ga0316582_0085955_169_1995 | 594 |
| 65 | 3300036712 | Ga0316584_0002954 | Ga0316584_0002954_3953_5779 | 594 |
| 66 | iso_pu_bacteria | 2882456835 | 2882457823 | 594 |
| 67 | 3300028794 | Ga0307515_10028345 | Ga0307515_100283458 | 595 |
| 68 | 3300037068 | Ga0373925_0013121 | Ga0373925_0013121_2276_4099 | 595 |
| 69 | 3300053730 | Ga0500645_002795 | Ga0500645_002795_4883_6706 | 595 |
| 70 | 3300031691 | Ga0316579_10029408 | Ga0316579_100294082 | 596 |
| 71 | 3300032139 | Ga0316580_10010471 | Ga0316580_100104712 | 596 |
| 72 | 3300032168 | Ga0316593_10015029 | Ga0316593_100150292 | 596 |
| 73 | 3300033528 | Ga0316588_1010311 | Ga0316588_10103111 | 596 |
| 74 | 3300033541 | Ga0316596_1004090 | Ga0316596_10040903 | 596 |
| 75 | 3300036647 | Ga0316582_0001699 | Ga0316582_0001699_572_2377 | 596 |
| 76 | 3300036712 | Ga0316584_0004075 | Ga0316584_0004075_6135_7940 | 596 |
| 77 | 3300044712 | Ga0453684_0129774 | Ga0453684_0129774_993_2873 | 596 |
| 78 | 3300049580 | Ga0501046_0078470 | Ga0501046_0078470_115_1917 | 596 |
| 79 | 3300049822 | Ga0501035_0102052 | Ga0501035_0102052_337_2139 | 596 |
| 80 | 3300060353 | Ga0501082_0000104 | Ga0501082_0000104_7813_9615 | 596 |
| 81 | 3300031665 | Ga0316575_10025938 | Ga0316575_100259382 | 597 |
| 82 | 3300031691 | Ga0316579_10018034 | Ga0316579_100180342 | 597 |
| 83 | 3300032133 | Ga0316583_10014295 | Ga0316583_100142952 | 597 |
| 84 | 3300036647 | Ga0316582_0026311 | Ga0316582_0026311_553_2382 | 597 |
| 85 | 3300045051 | Ga0451576_0002452 | Ga0451576_0002452_24759_26630 | 598 |
| 86 | 3300049579 | Ga0501043_0002857 | Ga0501043_0002857_7197_8999 | 598 |
| 87 | 3300049823 | Ga0501044_0001900 | Ga0501044_0001900_11935_13737 | 598 |
| 88 | 3300013296 | Ga0157374_10003896 | Ga0157374_100038966 | 599 |
| 89 | 3300013297 | Ga0157378_10087291 | Ga0157378_100872912 | 599 |
| 90 | iso_pu_bacteria | 8055225921 | 8055228711 | 599 |
| 91 | 3300006195 | Ga0075366_10036937 | Ga0075366_100369373 | 600 |
| 92 | 3300013306 | Ga0163162_10086730 | Ga0163162_100867302 | 600 |
| 93 | 3300033180 | Ga0307510_10006573 | Ga0307510_100065735 | 600 |
| 94 | 3300036712 | Ga0316584_0057269 | Ga0316584_0057269_417_2243 | 600 |
| 95 | 3300050493 | nmdc:mga0k408_16871_c1 | nmdc:mga0k408_16871_c1_764_2614 | 600 |
| 96 | 3300050516 | nmdc:mga0sz30_17091_c1 | nmdc:mga0sz30_17091_c1_1026_2834 | 600 |
| 97 | 3300053118 | Ga0500594_0004075 | Ga0500594_0004075_927_2765 | 600 |
| 98 | 3300053156 | Ga0500622_0001682 | Ga0500622_0001682_7365_9203 | 600 |
| 99 | 3300005328 | Ga0070676_10003412 | Ga0070676_100034124 | 602 |
| 100 | 3300005364 | Ga0070673_100003672 | Ga0070673_1000036727 | 602 |
| 101 | 3300005367 | Ga0070667_100136314 | Ga0070667_1001363141 | 602 |
| 102 | 3300005547 | Ga0070693_100032246 | Ga0070693_1000322463 | 602 |
| 103 | 3300005577 | Ga0068857_100050226 | Ga0068857_1000502262 | 602 |
| 104 | 3300005617 | Ga0068859_100054806 | Ga0068859_1000548061 | 602 |
| 105 | 3300006931 | Ga0097620_100054807 | Ga0097620_1000548073 | 602 |
| 106 | 3300025907 | Ga0207645_10007830 | Ga0207645_100078303 | 602 |
| 107 | 3300025936 | Ga0207670_10077028 | Ga0207670_100770282 | 602 |
| 108 | 3300025942 | Ga0207689_10002937 | Ga0207689_1000293714 | 602 |
| 109 | 3300026089 | Ga0207648_10003756 | Ga0207648_100037566 | 602 |
| 110 | 3300026116 | Ga0207674_10022969 | Ga0207674_100229696 | 602 |
| 111 | 3300026116 | Ga0207674_10027821 | Ga0207674_100278214 | 602 |
| 112 | 3300046543 | Ga0495645_0057545 | Ga0495645_0057545_647_2455 | 602 |
| 113 | 3300005336 | Ga0070680_100072680 | Ga0070680_1000726802 | 603 |
| 114 | 3300005367 | Ga0070667_100012676 | Ga0070667_1000126765 | 603 |
| 115 | 3300025986 | Ga0207658_10007142 | Ga0207658_100071423 | 603 |
| 116 | 3300028794 | Ga0307515_10093677 | Ga0307515_100936772 | 603 |
| 117 | 3300028800 | Ga0265338_10012149 | Ga0265338_100121496 | 603 |
| 118 | 3300031456 | Ga0307513_10014280 | Ga0307513_100142808 | 603 |
| 119 | 3300049581 | Ga0501047_0030785 | Ga0501047_0030785_3253_5109 | 603 |
| 120 | 3300049585 | Ga0501069_0000995 | Ga0501069_0000995_6053_7909 | 603 |
| 121 | 3300049586 | Ga0501070_0000979 | Ga0501070_0000979_6990_8846 | 603 |
| 122 | 3300049588 | Ga0501072_0085222 | Ga0501072_0085222_141_1997 | 603 |
| 123 | 3300049589 | Ga0501073_0000992 | Ga0501073_0000992_12506_14362 | 603 |
| 124 | 3300049590 | Ga0501074_0002231 | Ga0501074_0002231_8458_10314 | 603 |
| 125 | 3300049741 | Ga0501079_0003802 | Ga0501079_0003802_597_2453 | 603 |
| 126 | 3300049742 | Ga0501080_0069046 | Ga0501080_0069046_1278_3134 | 603 |
| 127 | 3300049744 | Ga0501083_0002697 | Ga0501083_0002697_7252_9108 | 603 |
| 128 | 3300054114 | Ga0501084_0066201 | Ga0501084_0066201_788_2644 | 603 |
| 129 | 3300044712 | Ga0453684_0004127 | Ga0453684_0004127_12790_14715 | 604 |
| 130 | 3300045976 | Ga0466967_0074490 | Ga0466967_0074490_489_2354 | 604 |
| 131 | 3300005340 | Ga0070689_100033885 | Ga0070689_1000338852 | 605 |
| 132 | 3300006852 | Ga0075433_10021854 | Ga0075433_100218544 | 605 |
| 133 | 3300025321 | Ga0207656_10010503 | Ga0207656_100105032 | 605 |
| 134 | 3300031251 | Ga0265327_10000027 | Ga0265327_10000027160 | 605 |
| 135 | 3300048907 | Ga0496104_0012825 | Ga0496104_0012825_2068_3894 | 605 |
| 136 | 3300048913 | Ga0496110_0115614 | Ga0496110_0115614_202_2028 | 605 |
| 137 | iso_pu_bacteria | 2643221603 | 2644028052 | 605 |
| 138 | 3300035692 | Ga0373935_0037752 | Ga0373935_0037752_175_2001 | 606 |
| 139 | 3300035695 | Ga0373927_0034509 | Ga0373927_0034509_1332_3158 | 606 |
| 140 | iso_pu_bacteria | 2508501050 | 2508733393 | 606 |
| 141 | iso_pu_bacteria | 2513237150 | 2513953945 | 606 |
| 142 | iso_pu_bacteria | 2513237165 | 2514040080 | 606 |
| 143 | iso_pu_bacteria | 2775506901 | 2776261296 | 606 |
| 144 | iso_pu_bacteria | 644736347 | 644746740 | 606 |
| 145 | 3300006847 | Ga0075431_100057905 | Ga0075431_1000579052 | 607 |
| 146 | 3300046472 | Ga0495580_0045114 | Ga0495580_0045114_504_2387 | 607 |
| 147 | 3300046683 | Ga0495658_0013388 | Ga0495658_0013388_1923_3806 | 607 |
| 148 | 3300050510 | nmdc:mga06r32_23204_c1 | nmdc:mga06r32_23204_c1_2233_4062 | 607 |
| 149 | iso_pu_bacteria | 2508501114 | 2509074048 | 607 |
| 150 | iso_pu_bacteria | 2643221654 | 2644303189 | 607 |
| 151 | 3300005327 | Ga0070658_10085789 | Ga0070658_100857891 | 608 |
| 152 | 3300047472 | Ga0495686_0013698 | Ga0495686_0013698_2660_4543 | 608 |
| 153 | 3300053080 | Ga0500635_0000011 | Ga0500635_0000011_126842_128713 | 608 |
| 154 | 3300009094 | Ga0111539_10000336 | Ga0111539_1000033647 | 609 |
| 155 | 3300027907 | Ga0207428_10006055 | Ga0207428_100060559 | 609 |
| 156 | 3300039450 | Ga0436363_0051374 | Ga0436363_0051374_29568_31538 | 609 |
| 157 | 3300050511 | nmdc:mga08y16_7630_c1 | nmdc:mga08y16_7630_c1_3450_5291 | 609 |
| 158 | iso_pu_bacteria | 2834641062 | 2834641210 | 610 |
| 159 | iso_pu_bacteria | 8003400568 | 8003401108 | 610 |
| 160 | 3300005616 | Ga0068852_100002545 | Ga0068852_10000254510 | 611 |
| 161 | 3300006948 | Ga0099826_10000014 | Ga0099826_10000014181 | 611 |
| 162 | 3300026142 | Ga0207698_10022660 | Ga0207698_100226603 | 611 |
| 163 | 3300027666 | Ga0209282_1000048 | Ga0209282_100004848 | 611 |
| 164 | 3300046500 | Ga0495596_0003754 | Ga0495596_0003754_5214_7115 | 611 |
| 165 | 3300046512 | Ga0495610_0006546 | Ga0495610_0006546_5648_7549 | 611 |
| 166 | 3300046513 | Ga0495616_0010991 | Ga0495616_0010991_437_2338 | 611 |
| 167 | 3300046538 | Ga0495609_0004474 | Ga0495609_0004474_5296_7197 | 611 |
| 168 | 3300048925 | Ga0496122_0014543 | Ga0496122_0014543_5246_7147 | 611 |
| 169 | 3300005530 | Ga0070679_100019006 | Ga0070679_1000190065 | 612 |
| 170 | 3300037471 | Ga0395905_0052473 | Ga0395905_0052473_1722_3575 | 612 |
| 171 | 3300005614 | Ga0068856_100005672 | Ga0068856_1000056728 | 613 |
| 172 | 3300009551 | Ga0105238_10004860 | Ga0105238_100048609 | 613 |
| 173 | 3300013307 | Ga0157372_10002215 | Ga0157372_1000221515 | 613 |
| 174 | 3300006914 | Ga0075436_100000894 | Ga0075436_10000089410 | 615 |
| 175 | 3300007076 | Ga0075435_100083485 | Ga0075435_1000834852 | 615 |
| 176 | 3300044842 | Ga0466957_0001883 | Ga0466957_0001883_8826_10679 | 615 |
| 177 | 3300050513 | nmdc:mga0rr50_35062_c1 | nmdc:mga0rr50_35062_c1_452_2308 | 615 |
| 178 | 3300050514 | nmdc:mga08x19_595_c1 | nmdc:mga08x19_595_c1_13868_15724 | 615 |
| 179 | 3300005327 | Ga0070658_10006410 | Ga0070658_100064108 | 616 |
| 180 | 3300005435 | Ga0070714_100016468 | Ga0070714_1000164684 | 616 |
| 181 | 3300005530 | Ga0070679_100024788 | Ga0070679_1000247885 | 616 |
| 182 | 3300005563 | Ga0068855_100008801 | Ga0068855_1000088011 | 616 |
| 183 | 3300005563 | Ga0068855_100033564 | Ga0068855_1000335644 | 616 |
| 184 | 3300009093 | Ga0105240_10002337 | Ga0105240_1000233726 | 616 |
| 185 | 3300025913 | Ga0207695_10002750 | Ga0207695_100027502 | 616 |
| 186 | 3300025921 | Ga0207652_10019582 | Ga0207652_100195823 | 616 |
| 187 | 3300025949 | Ga0207667_10003244 | Ga0207667_100032447 | 616 |
| 188 | 3300025949 | Ga0207667_10034719 | Ga0207667_100347193 | 616 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ghi-assembly1.cif.gz_A | crystal structure of plasmodium yoelii multidrug resistance protein 2 | 0.9598 | 354 | 598 |
| 2ghi-assembly4.cif.gz_D | crystal structure of plasmodium yoelii multidrug resistance protein 2 | 0.943 | 359 | 596 |
| 2fgk-assembly2.cif.gz_B | crystal structure of the abc-cassette e631q mutant of hlyb with bound atp | 0.9399 | 362 | 597 |
| 3vx4-assembly1.cif.gz_A | crystal structure of the nucleotide-binding domain of s. mutans coma, a bifunctional atp-binding cassette transporter involved in the quorum-sensing pathway | 0.9348 | 359 | 594 |
| 4mrn-assembly1.cif.gz_A | structure of a bacterial atm1-family abc transporter | 0.934 | 23 | 607 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53645_329_572_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9711 | 361 | 592 | 3.40.50.300 |
| af_Q2FVJ2_326_574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9666 | 354 | 601 | 3.40.50.300 |
| af_Q7K6A5_1228_1417_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9661 | 415 | 584 | 3.40.50.300 |
| af_A0A0P0VTT5_46_316_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9646 | 354 | 588 | 3.40.50.300 |
| af_O53645_932_1184_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9621 | 352 | 596 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W3T926-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9742 | 380 | 584 |
GO:0005524
GO:0015421 GO:0016887 |
| AF-A0A2A8D2P9-F1-model_v4 | ABC transporter domain-containing protein | 0.9711 | 359 | 602 |
GO:0005524
GO:0016887 GO:0034040 |
| AF-A0A820M297-F1-model_v4 | Uncharacterized protein | 0.9681 | 355 | 606 |
GO:0005524
GO:0005743 GO:0015421 GO:0016887 GO:0090374 |
| AF-A0A7Y4NIU2-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9663 | 406 | 597 |
GO:0005524
GO:0015421 GO:0016887 GO:0090374 |
| AF-A0A847KX24-F1-model_v4 | deleted | 0.9577 | 387 | 600 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar