F289156

General Info

Members Datasets Scaffolds Average Seq Length
188 134 376 136

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_102373325|Ga0075428_1023733251
Length 137
Sequence MGKLAEIKTKQTSSSVEDFINTIQDEQKRKDSFVILEMMKKATGEEPKIWGSSMIGFGNKRYKSPATGREVDWFKIGFSPRKSNFSLHLVLDLQQHADILKKLGKHKTGVGCLYINKLEDVDQKVLEKMIKEAAKGK

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
99 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
100 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
101 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
110 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
111 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
112 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
113 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
114 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
115 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
116 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
117 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
118 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
119 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
120 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
121 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
122 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
123 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
126 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
127 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
128 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
129 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 0
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 12.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_102373325 3300006844 Bacteria 545
2 Ga0070690_100406246 3300005330 Bacteria 1001
3 Ga0070670_100136329 3300005331 Bacteria 2121
4 Ga0070670_100179697 3300005331 Bacteria 1837
5 Ga0070670_100242599 3300005331 Bacteria 1569
6 Ga0070670_101105059 3300005331 Bacteria 723
7 Ga0070666_10702737 3300005335 Bacteria 741
8 Ga0070680_100130013 3300005336 Bacteria 2106
9 Ga0070660_100528172 3300005339 Bacteria 983
10 Ga0070689_100111060 3300005340 Bacteria 2180
11 Ga0070689_100583065 3300005340 Bacteria 967
12 Ga0070668_100115590 3300005347 Bacteria 2139
13 Ga0070669_101253515 3300005353 Bacteria 641
14 Ga0070675_101597401 3300005354 Bacteria 602
15 Ga0070674_100255370 3300005356 Unclassified 1378
16 Ga0070674_100386424 3300005356 Bacteria 1140
17 Ga0070674_101255688 3300005356 Bacteria 659
18 Ga0070674_102205629 3300005356 Unclassified 503
19 Ga0070673_100305539 3300005364 Unclassified 1402
20 Ga0070673_100966569 3300005364 Bacteria 792
21 Ga0070688_100018835 3300005365 Bacteria 3991
22 Ga0070688_100133114 3300005365 Unclassified 1680
23 Ga0070688_100605408 3300005365 Bacteria 839
24 Ga0070659_100106324 3300005366 Bacteria 2262
25 Ga0070667_100133786 3300005367 Bacteria 2166
26 Ga0070663_100194221 3300005455 Bacteria 1581
27 Ga0070678_100060065 3300005456 Unclassified 2797
28 Ga0070678_100417712 3300005456 Bacteria 1168
29 Ga0070678_101846416 3300005456 Bacteria 570
30 Ga0070662_101587000 3300005457 Bacteria 565
31 Ga0070681_10103451 3300005458 Bacteria 2792
32 Ga0068867_100534114 3300005459 Bacteria 1013
33 Ga0068867_102303570 3300005459 Unclassified 512
34 Ga0070699_100504881 3300005518 Bacteria 1099
35 Ga0070684_101196014 3300005535 Bacteria 715
36 Ga0070672_100039912 3300005543 Bacteria 3599
37 Ga0070672_100216894 3300005543 Bacteria 1604
38 Ga0070693_100803972 3300005547 Bacteria 697
39 Ga0070665_100490112 3300005548 Bacteria 1240
40 Ga0070665_101560732 3300005548 Bacteria 668
41 Ga0068857_100485340 3300005577 Bacteria 1158
42 Ga0068852_100078312 3300005616 Bacteria 2924
43 Ga0068859_100000060 3300005617 Bacteria 113756
44 Ga0068859_100004566 3300005617 Bacteria 14125
45 Ga0068864_100203693 3300005618 Bacteria 1819
46 Ga0068864_100373131 3300005618 Bacteria 1350
47 Ga0068864_100588002 3300005618 Bacteria 1079
48 Ga0068864_100603432 3300005618 Bacteria 1065
49 Ga0068866_10463359 3300005718 Unclassified 831
50 Ga0068861_100230326 3300005719 Bacteria 1571
51 Ga0068861_100342685 3300005719 Unclassified 1308
52 Ga0068861_102400809 3300005719 Unclassified 530
53 Ga0068851_10087404 3300005834 Bacteria 1637
54 Ga0068870_10557218 3300005840 Bacteria 773
55 Ga0068863_100016722 3300005841 Bacteria 7038
56 Ga0068858_100015599 3300005842 Bacteria 7146
57 Ga0068860_100003027 3300005843 Bacteria 17356
58 Ga0068871_100069544 3300006358 Bacteria 2891
59 Ga0068871_100200743 3300006358 Bacteria 1721
60 Ga0075428_100037606 3300006844 Bacteria 5327
61 Ga0075430_100064423 3300006846 Unclassified 3079
62 Ga0075431_100044702 3300006847 Bacteria 4566
63 Ga0075434_100760720 3300006871 Bacteria 986
64 Ga0097620_100000060 3300006931 Bacteria 113756
65 Ga0097620_100004566 3300006931 Bacteria 14125
66 Ga0097620_101429227 3300006931 Bacteria 763
67 Ga0105247_10003050 3300009101 Bacteria 11085
68 Ga0114129_10101558 3300009147 Bacteria 3979
69 Ga0105243_11020703 3300009148 Bacteria 831
70 Ga0105241_10000574 3300009174 Bacteria 27676
71 Ga0105242_10335816 3300009176 Bacteria 1391
72 Ga0105237_10000926 3300009545 Bacteria 39497
73 Ga0105249_10607481 3300009553 Bacteria 1149
74 Ga0105030_118419 3300009987 Unclassified 628
75 Ga0105246_10005217 3300011119 Bacteria 7901
76 Ga0157370_10590840 3300013104 Unclassified 1017
77 Ga0157374_10044902 3300013296 Bacteria 4087
78 Ga0157378_11378816 3300013297 Bacteria 748
79 Ga0163162_10717665 3300013306 Bacteria 1120
80 Ga0163162_11044876 3300013306 Bacteria 924
81 Ga0157372_10159772 3300013307 Bacteria 2604
82 Ga0157372_10988230 3300013307 Bacteria 975
83 Ga0157375_10526679 3300013308 Bacteria 1345
84 Ga0157375_10886696 3300013308 Bacteria 1037
85 Ga0157375_12186112 3300013308 Unclassified 659
86 Ga0157380_10000289 3300014326 Bacteria 30209
87 Ga0157380_10011723 3300014326 Bacteria 6339
88 Ga0157380_10115289 3300014326 Bacteria 2265
89 Ga0157380_10358028 3300014326 Bacteria 1368
90 Ga0157380_10420652 3300014326 Bacteria 1274
91 Ga0157380_10475702 3300014326 Bacteria 1207
92 Ga0157379_10438127 3300014968 Bacteria 1205
93 Ga0157376_10357000 3300014969 Bacteria 1401
94 Ga0163161_10020016 3300017792 Bacteria 4694
95 Ga0163161_10154356 3300017792 Bacteria 1747
96 Ga0163161_10406629 3300017792 Bacteria 1092
97 Ga0207656_10084995 3300025321 Bacteria 1428
98 Ga0207682_10027903 3300025893 Bacteria 2250
99 Ga0207682_10502056 3300025893 Unclassified 574
100 Ga0207642_10917706 3300025899 Unclassified 561
101 Ga0207710_10006489 3300025900 Bacteria 4988
102 Ga0207680_10000018 3300025903 Bacteria 94318
103 Ga0207645_10741812 3300025907 Bacteria 668
104 Ga0207654_10001609 3300025911 Bacteria 11836
105 Ga0207707_10479127 3300025912 Unclassified 1063
106 Ga0207671_10020343 3300025914 Bacteria 5054
107 Ga0207681_11182545 3300025923 Bacteria 642
108 Ga0207681_11498771 3300025923 Bacteria 566
109 Ga0207659_10304349 3300025926 Bacteria 1310
110 Ga0207690_10376826 3300025932 Bacteria 1127
111 Ga0207686_10358549 3300025934 Bacteria 1100
112 Ga0207670_10248764 3300025936 Bacteria 1373
113 Ga0207669_10030333 3300025937 Bacteria 3004
114 Ga0207669_10357078 3300025937 Bacteria 1131
115 Ga0207669_11920344 3300025937 Bacteria 506
116 Ga0207691_10056879 3300025940 Unclassified 3562
117 Ga0207691_10335711 3300025940 Bacteria 1294
118 Ga0207689_10001878 3300025942 Bacteria 19852
119 Ga0207661_10322879 3300025944 Bacteria 1388
120 Ga0207651_10697241 3300025960 Bacteria 894
121 Ga0207651_12115894 3300025960 Bacteria 505
122 Ga0207712_10049918 3300025961 Bacteria 2919
123 Ga0207640_11304517 3300025981 Bacteria 648
124 Ga0207658_10079025 3300025986 Bacteria 2515
125 Ga0207677_10175936 3300026023 Bacteria 1678
126 Ga0207703_10006326 3300026035 Bacteria 9467
127 Ga0207641_10000308 3300026088 Bacteria 60892
128 Ga0207648_10079786 3300026089 Unclassified 2855
129 Ga0207648_10511391 3300026089 Bacteria 1100
130 Ga0207648_10582682 3300026089 Bacteria 1030
131 Ga0207676_10020180 3300026095 Bacteria 4871
132 Ga0207676_10217619 3300026095 Bacteria 1699
133 Ga0207676_10279236 3300026095 Unclassified 1516
134 Ga0207676_11884114 3300026095 Bacteria 597
135 Ga0207674_10446586 3300026116 Bacteria 1250
136 Ga0207675_100499467 3300026118 Bacteria 1211
137 Ga0207675_100504174 3300026118 Bacteria 1205
138 Ga0207683_10198584 3300026121 Unclassified 1823
139 Ga0207698_10098699 3300026142 Bacteria 2414
140 Ga0209968_1057008 3300027526 Bacteria 685
141 Ga0268266_10167182 3300028379 Bacteria 1994
142 Ga0268264_10122700 3300028381 Bacteria 2292
143 Ga0307515_10000091 3300028794 Bacteria 214014
144 Ga0307405_11931829 3300031731 Unclassified 527
145 Ga0307411_11032226 3300032005 Bacteria 738
146 Ga0307411_11125638 3300032005 Unclassified 709
147 Ga0439441_004925 3300042001 Bacteria 2049
148 Ga0450894_016921 3300042131 Bacteria 969
149 Ga0450896_061290 3300042133 Bacteria 613
150 Ga0450898_016995 3300042134 Bacteria 1248
151 Ga0451577_0848196 3300042876 Bacteria 824
152 Ga0453683_0261828 3300044673 Bacteria 1103
153 Ga0453684_0076549 3300044712 Bacteria 4200
154 Ga0453684_1446654 3300044712 Bacteria 711
155 Ga0495598_0049108 3300046537 Bacteria 1264
156 Ga0495668_0037405 3300046616 Bacteria 2715
157 Ga0495672_0008023 3300047320 Bacteria 7854
158 Ga0495672_0063932 3300047320 Bacteria 2109
159 Ga0495686_0009739 3300047472 Bacteria 6896
160 Ga0501198_009204 3300049649 Bacteria 1446
161 Ga0501206_009744 3300049653 Bacteria 1281
162 Ga0501209_229549 3300049656 Bacteria 577
163 Ga0501222_007225 3300049662 Bacteria 1485
164 Ga0501223_004822 3300049663 Bacteria 2865
165 Ga0501224_023340 3300049664 Bacteria 923
166 Ga0501233_004839 3300049668 Bacteria 2485
167 Ga0501235_009018 3300049669 Bacteria 2177
168 Ga0501235_026381 3300049669 Bacteria 1302
169 Ga0501238_018915 3300049671 Bacteria 966
170 Ga0501243_113492 3300049675 Bacteria 556
171 Ga0501253_001689 3300049683 Bacteria 2317
172 Ga0501259_001119 3300049688 Bacteria 4472
173 Ga0501259_002851 3300049688 Bacteria 2772
174 Ga0501225_0018446 3300049705 Bacteria 1934
175 Ga0501234_043021 3300049707 Bacteria 742
176 Ga0501245_002464 3300049708 Bacteria 2473
177 Ga0501080_1892035 3300049742 Bacteria 500
178 Ga0501232_002217 3300049757 Bacteria 1664
179 Ga0501268_099053 3300049765 Bacteria 623
180 Ga0501271_004144 3300049768 Bacteria 1364
181 Ga0501280_014539 3300049776 Bacteria 1121
182 Ga0501212_014869 3300049851 Bacteria 1156
183 nmdc:mga05p37_1134904_c1 3300050507 Unclassified 815
184 nmdc:mga05p37_919147_c1 3300050507 Bacteria 941
185 nmdc:mga09592_67792_c1 3300050508 Bacteria 3027
186 nmdc:mga0qj67_29494_c1 3300050509 Bacteria 4262
187 nmdc:mga06r32_448419_c1 3300050510 Unclassified 1270
188 Ga0500568_0053187 3300053139 Bacteria 1588
189 Ga0075428_102373325
190 Ga0070690_100406246
191 Ga0070670_100136329
192 Ga0070670_100179697
193 Ga0070670_100242599
194 Ga0070670_101105059
195 Ga0070666_10702737
196 Ga0070680_100130013
197 Ga0070660_100528172
198 Ga0070689_100111060
199 Ga0070689_100583065
200 Ga0070668_100115590
201 Ga0070669_101253515
202 Ga0070675_101597401
203 Ga0070674_100255370
204 Ga0070674_100386424
205 Ga0070674_101255688
206 Ga0070674_102205629
207 Ga0070673_100305539
208 Ga0070673_100966569
209 Ga0070688_100018835
210 Ga0070688_100133114
211 Ga0070688_100605408
212 Ga0070659_100106324
213 Ga0070667_100133786
214 Ga0070663_100194221
215 Ga0070678_100060065
216 Ga0070678_100417712
217 Ga0070678_101846416
218 Ga0070662_101587000
219 Ga0070681_10103451
220 Ga0068867_100534114
221 Ga0068867_102303570
222 Ga0070699_100504881
223 Ga0070684_101196014
224 Ga0070672_100039912
225 Ga0070672_100216894
226 Ga0070693_100803972
227 Ga0070665_100490112
228 Ga0070665_101560732
229 Ga0068857_100485340
230 Ga0068852_100078312
231 Ga0068859_100000060
232 Ga0068859_100004566
233 Ga0068864_100203693
234 Ga0068864_100373131
235 Ga0068864_100588002
236 Ga0068864_100603432
237 Ga0068866_10463359
238 Ga0068861_100230326
239 Ga0068861_100342685
240 Ga0068861_102400809
241 Ga0068851_10087404
242 Ga0068870_10557218
243 Ga0068863_100016722
244 Ga0068858_100015599
245 Ga0068860_100003027
246 Ga0068871_100069544
247 Ga0068871_100200743
248 Ga0075428_100037606
249 Ga0075430_100064423
250 Ga0075431_100044702
251 Ga0075434_100760720
252 Ga0097620_100000060
253 Ga0097620_100004566
254 Ga0097620_101429227
255 Ga0105247_10003050
256 Ga0114129_10101558
257 Ga0105243_11020703
258 Ga0105241_10000574
259 Ga0105242_10335816
260 Ga0105237_10000926
261 Ga0105249_10607481
262 Ga0105030_118419
263 Ga0105246_10005217
264 Ga0157370_10590840
265 Ga0157374_10044902
266 Ga0157378_11378816
267 Ga0163162_10717665
268 Ga0163162_11044876
269 Ga0157372_10159772
270 Ga0157372_10988230
271 Ga0157375_10526679
272 Ga0157375_10886696
273 Ga0157375_12186112
274 Ga0157380_10000289
275 Ga0157380_10011723
276 Ga0157380_10115289
277 Ga0157380_10358028
278 Ga0157380_10420652
279 Ga0157380_10475702
280 Ga0157379_10438127
281 Ga0157376_10357000
282 Ga0163161_10020016
283 Ga0163161_10154356
284 Ga0163161_10406629
285 Ga0207656_10084995
286 Ga0207682_10027903
287 Ga0207682_10502056
288 Ga0207642_10917706
289 Ga0207710_10006489
290 Ga0207680_10000018
291 Ga0207645_10741812
292 Ga0207654_10001609
293 Ga0207707_10479127
294 Ga0207671_10020343
295 Ga0207681_11182545
296 Ga0207681_11498771
297 Ga0207659_10304349
298 Ga0207690_10376826
299 Ga0207686_10358549
300 Ga0207670_10248764
301 Ga0207669_10030333
302 Ga0207669_10357078
303 Ga0207669_11920344
304 Ga0207691_10056879
305 Ga0207691_10335711
306 Ga0207689_10001878
307 Ga0207661_10322879
308 Ga0207651_10697241
309 Ga0207651_12115894
310 Ga0207712_10049918
311 Ga0207640_11304517
312 Ga0207658_10079025
313 Ga0207677_10175936
314 Ga0207703_10006326
315 Ga0207641_10000308
316 Ga0207648_10079786
317 Ga0207648_10511391
318 Ga0207648_10582682
319 Ga0207676_10020180
320 Ga0207676_10217619
321 Ga0207676_10279236
322 Ga0207676_11884114
323 Ga0207674_10446586
324 Ga0207675_100499467
325 Ga0207675_100504174
326 Ga0207683_10198584
327 Ga0207698_10098699
328 Ga0209968_1057008
329 Ga0268266_10167182
330 Ga0268264_10122700
331 Ga0307515_10000091
332 Ga0307405_11931829
333 Ga0307411_11032226
334 Ga0307411_11125638
335 Ga0439441_004925
336 Ga0450894_016921
337 Ga0450896_061290
338 Ga0450898_016995
339 Ga0451577_0848196
340 Ga0453683_0261828
341 Ga0453684_0076549
342 Ga0453684_1446654
343 Ga0495598_0049108
344 Ga0495668_0037405
345 Ga0495672_0008023
346 Ga0495672_0063932
347 Ga0495686_0009739
348 Ga0501198_009204
349 Ga0501206_009744
350 Ga0501209_229549
351 Ga0501222_007225
352 Ga0501223_004822
353 Ga0501224_023340
354 Ga0501233_004839
355 Ga0501235_009018
356 Ga0501235_026381
357 Ga0501238_018915
358 Ga0501243_113492
359 Ga0501253_001689
360 Ga0501259_001119
361 Ga0501259_002851
362 Ga0501225_0018446
363 Ga0501234_043021
364 Ga0501245_002464
365 Ga0501080_1892035
366 Ga0501232_002217
367 Ga0501268_099053
368 Ga0501271_004144
369 Ga0501280_014539
370 Ga0501212_014869
371 nmdc:mga05p37_1134904_c1
372 nmdc:mga05p37_919147_c1
373 nmdc:mga09592_67792_c1
374 nmdc:mga0qj67_29494_c1
375 nmdc:mga06r32_448419_c1
376 Ga0500568_0053187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

28

134

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6848 17 129
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.664 17 131
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.5961 17 131
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.5764 17 129
6k4y-assembly1.cif.gz_M cryoem structure of sigma appropriation complex 0.4973 25 131
ID Description Score Start End Superfamily
af_Q4CNA7_302_447_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7309 56 74 3.40.50.300
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6865 17 128 3.90.1150.200
af_B8JI86_13_105_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6172 57 74 3.30.40.10
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6168 17 128 3.90.1150.200
af_Q8N475_63_132_3.30.60.30 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; 0.5892 56 74 3.30.60.30
ID Description Score Start End GO Terms
AF-C7DAU8-F1-model_v4 DUF1801 domain-containing protein 0.9793 5 60
AF-A0A4Q3RCU9-F1-model_v4 DUF1801 domain-containing protein 0.9623 8 56
AF-A0A2S7T1N6-F1-model_v4 DUF1801 domain-containing protein 0.9611 40 132
AF-A0A7T8YSV3-F1-model_v4 deleted 0.959 5 132
AF-A0A543K6R5-F1-model_v4 Uncharacterized protein DUF1801 0.9586 8 132

Map