F289116

General Info

Members Datasets Scaffolds Average Seq Length
188 148 177 329

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10032094|Ga0081539_100320942
Length 353
Sequence MDGRKIVLLVAAAFMARSLMQGAATPVAAANNVAPNADGPQVLVATRALPVGTIIDESSMKFQPWPKELVEGAYYLKDKTPDLKALQGTVVRFAIPAGQPITQGALVKPGDRGFLAAALAPGMRAVTVPVSAQTSVAGFIFPGDRVDLILTQSVAGGGDGAPLKTSETVLRNLRVLATDQKTDKNVDDKGNTVVSTYSMVTIEATPSIAEKIAVAQTVGSLSLSLRSIADNAGELEEAIASGEVNVPDGDKAEKAMLASVAARPIDGKGSFSTGADVSRFQRSTVPGKPAEAGGAGGAPQVLAAPSGPMVRVVRGNNVQDVVIGSRVTPAAVPVPVSAXXPVHAGGTPSGGTN

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
4 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
5 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
6 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
7 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
8 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
9 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
10 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
11 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
87 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
88 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
91 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
113 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
114 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
115 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
116 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
123 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
124 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
125 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
126 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
127 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
128 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
129 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
130 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
131 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
132 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
133 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
134 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
138 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
145 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
148 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.49
Metatranscriptomes 2.66
Isolates 5.85

Biome Distribution

Category Percentage (%)
Aerial Root 1.06
Bulb 0
Endosphere 11.17
Nodule 0
Rhizoplane 1.6
Rhizosphere 75.53
Stem 0
Stem Tuber 0
Unclassified 10.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000021 3300003214 Bacteria 359288
2 Ga0065165_1001326 3300005262 Bacteria 27536
3 Ga0065707_10081862 3300005295 Bacteria 33026
4 Ga0070658_10146698 3300005327 Bacteria 1973
5 Ga0068868_100000076 3300005338 Bacteria 58193
6 Ga0070660_100000090 3300005339 Bacteria 54649
7 Ga0070661_100064478 3300005344 Bacteria 2692
8 Ga0070692_10107367 3300005345 Bacteria 1539
9 Ga0070668_100333722 3300005347 Bacteria 1279
10 Ga0070675_100041603 3300005354 Bacteria 3754
11 Ga0070659_100000122 3300005366 Bacteria 58682
12 Ga0070659_100243502 3300005366 Bacteria 1489
13 Ga0070663_100002178 3300005455 Bacteria 10952
14 Ga0068867_100307321 3300005459 Bacteria 1309
15 Ga0070679_100266701 3300005530 Bacteria 1667
16 Ga0068853_100089627 3300005539 Bacteria 2702
17 Ga0070665_100003840 3300005548 Bacteria 15896
18 Ga0070665_100184197 3300005548 Bacteria 2089
19 Ga0068857_100005655 3300005577 Bacteria 10688
20 Ga0068857_100053709 3300005577 Bacteria 3574
21 Ga0068854_100000419 3300005578 Bacteria 26489
22 Ga0068854_100151632 3300005578 Bacteria 1788
23 Ga0068854_100263890 3300005578 Bacteria 1380
24 Ga0068852_100000782 3300005616 Bacteria 20878
25 Ga0068859_100000597 3300005617 Bacteria 36010
26 Ga0068864_100001277 3300005618 Bacteria 20922
27 Ga0068861_100000061 3300005719 Bacteria 51630
28 Ga0068861_100127218 3300005719 Bacteria 2063
29 Ga0068858_100000414 3300005842 Bacteria 44330
30 Ga0068858_100003008 3300005842 Bacteria 16905
31 Ga0068860_100023172 3300005843 Bacteria 6003
32 Ga0081539_10032094 3300005985 Bacteria 3222
33 Ga0097620_100000597 3300006931 Bacteria 36010
34 Ga0105243_10367838 3300009148 Bacteria 1326
35 Ga0105248_10001933 3300009177 Bacteria 23011
36 Ga0105248_10006249 3300009177 Bacteria 13060
37 Ga0105248_10071855 3300009177 Bacteria 3888
38 Ga0105237_10003492 3300009545 Bacteria 18652
39 Ga0105238_10069022 3300009551 Bacteria 3535
40 Ga0163162_10001705 3300013306 Bacteria 20605
41 Ga0163162_10037083 3300013306 Bacteria 4862
42 Ga0163162_10184849 3300013306 Bacteria 2211
43 Ga0163162_10558561 3300013306 Bacteria 1272
44 Ga0157372_10043727 3300013307 Bacteria 4961
45 Ga0157372_10145872 3300013307 Bacteria 2729
46 Ga0157380_10002611 3300014326 Bacteria 12192
47 Ga0157379_10203088 3300014968 Bacteria 1792
48 Ga0183363_1007 3300015690 Bacteria 315687
49 Ga0206354_11368877 3300020081 Bacteria 4175
50 Ga0206353_10288558 3300020082 Bacteria 8582
51 Ga0209233_1000065 3300025261 Bacteria 387195
52 Ga0209455_1019502 3300025272 Bacteria 1368
53 Ga0207656_10014086 3300025321 Bacteria 3072
54 Ga0207645_10095703 3300025907 Bacteria 1912
55 Ga0207671_10036164 3300025914 Bacteria 3661
56 Ga0207657_10000445 3300025919 Bacteria 43853
57 Ga0207657_10169591 3300025919 Bacteria 1769
58 Ga0207649_10043953 3300025920 Bacteria 2734
59 Ga0207652_10280888 3300025921 Bacteria 1502
60 Ga0207694_10046018 3300025924 Bacteria 3372
61 Ga0207694_10062998 3300025924 Bacteria 2888
62 Ga0207659_10029112 3300025926 Bacteria 3761
63 Ga0207687_10014103 3300025927 Bacteria 5226
64 Ga0207690_10000001 3300025932 Bacteria 807539
65 Ga0207706_10034722 3300025933 Bacteria 4487
66 Ga0207709_10250832 3300025935 Bacteria 1292
67 Ga0207711_10008883 3300025941 Bacteria 8403
68 Ga0207711_10015226 3300025941 Bacteria 6384
69 Ga0207651_10139891 3300025960 Bacteria 1868
70 Ga0207640_10000031 3300025981 Bacteria 120815
71 Ga0207640_10028453 3300025981 Bacteria 3418
72 Ga0207640_10205110 3300025981 Bacteria 1497
73 Ga0207677_10000144 3300026023 Bacteria 58198
74 Ga0207703_10000634 3300026035 Bacteria 35367
75 Ga0207703_10000927 3300026035 Bacteria 28560
76 Ga0207639_10052493 3300026041 Bacteria 3107
77 Ga0207678_10003572 3300026067 Bacteria 13981
78 Ga0207702_10291856 3300026078 Bacteria 1545
79 Ga0207676_10004229 3300026095 Bacteria 10138
80 Ga0207675_100000011 3300026118 Bacteria 143162
81 Ga0207698_10000287 3300026142 Bacteria 30576
82 Ga0268264_10011652 3300028381 Bacteria 7252
83 Ga0314311_1146780 3300030733 Bacteria 1326
84 Ga0307509_10088571 3300031507 Bacteria 3177
85 Ga0307508_10000810 3300031616 Bacteria 36605
86 Ga0307413_10058837 3300031824 Bacteria 2358
87 Ga0307412_10000306 3300031911 Bacteria 30998
88 Ga0307412_10000394 3300031911 Bacteria 26964
89 Ga0307412_10035680 3300031911 Bacteria 3179
90 Ga0307412_10068015 3300031911 Bacteria 2421
91 Ga0307414_10000147 3300032004 Bacteria 47511
92 Ga0307414_10429893 3300032004 Bacteria 1153
93 Ga0307510_10026545 3300033180 Bacteria 6654
94 Ga0373937_0160867 3300036401 Bacteria 2105
95 Ga0395905_0091690 3300037471 Bacteria 2849
96 Ga0436364_0002779 3300037853 Bacteria 3453
97 Ga0436365_0240258 3300039437 Bacteria 10372
98 Ga0439436_0004013 3300041404 Bacteria 4509
99 Ga0439461_0004928 3300041410 Bacteria 2254
100 Ga0439465_0001603 3300041413 Bacteria 7361
101 Ga0439457_009668 3300042014 Bacteria 2239
102 Ga0450920_015278 3300042122 Bacteria 1460
103 Ga0439434_0006127 3300042435 Bacteria 3506
104 Ga0495638_0000481 3300046460 Bacteria 47890
105 Ga0495583_0006666 3300046506 Bacteria 7486
106 Ga0495606_0004121 3300046507 Bacteria 14762
107 Ga0495616_0074108 3300046513 Bacteria 1641
108 Ga0495648_0077018 3300046524 Bacteria 1913
109 Ga0495652_0076295 3300046529 Bacteria 2781
110 Ga0495597_0057635 3300046542 Bacteria 1699
111 Ga0495668_0054685 3300046616 Bacteria 2205
112 Ga0495668_0125930 3300046616 Bacteria 1402
113 Ga0495625_0000112 3300046660 Bacteria 124365
114 Ga0495625_0011114 3300046660 Bacteria 7374
115 Ga0495625_0104642 3300046660 Bacteria 1940
116 Ga0495670_0001636 3300046691 Bacteria 10969
117 Ga0495677_0042421 3300047445 Bacteria 1666
118 Ga0495686_0000057 3300047472 Bacteria 250088
119 Ga0495686_0003084 3300047472 Bacteria 14727
120 Ga0495686_0005131 3300047472 Bacteria 10460
121 Ga0496103_0132258 3300048906 Bacteria 1594
122 Ga0496117_0010519 3300048920 Bacteria 8413
123 Ga0496118_0053991 3300048921 Bacteria 3048
124 Ga0496121_0000580 3300048924 Bacteria 68713
125 Ga0496121_0015897 3300048924 Bacteria 7819
126 Ga0496122_0015584 3300048925 Bacteria 7255
127 Ga0496122_0064053 3300048925 Bacteria 2677
128 Ga0496123_0038208 3300048926 Bacteria 3378
129 Ga0496124_0000874 3300048927 Bacteria 49185
130 Ga0496124_0005202 3300048927 Bacteria 14776
131 Ga0496124_0241963 3300048927 Bacteria 1341
132 Ga0496126_0086383 3300048929 Bacteria 2765
133 Ga0501290_000014 3300049513 Bacteria 26259
134 Ga0501290_001869 3300049513 Bacteria 2785
135 Ga0501292_000015 3300049515 Bacteria 64087
136 Ga0501294_000034 3300049517 Bacteria 13717
137 Ga0501300_002011 3300049523 Bacteria 3035
138 Ga0501314_000041 3300049530 Bacteria 5663
139 Ga0501315_005309 3300049531 Bacteria 1390
140 Ga0501317_005326 3300049533 Bacteria 1373
141 Ga0501034_0077867 3300049571 Bacteria 3321
142 Ga0501047_0081570 3300049581 Bacteria 3109
143 Ga0501071_0071765 3300049587 Bacteria 2525
144 Ga0501206_000172 3300049653 Bacteria 7112
145 Ga0501223_000731 3300049663 Bacteria 7816
146 Ga0501223_007742 3300049663 Bacteria 2193
147 Ga0501224_000034 3300049664 Bacteria 37769
148 Ga0501224_002713 3300049664 Bacteria 2436
149 Ga0501227_004491 3300049665 Bacteria 2997
150 Ga0501233_001308 3300049668 Bacteria 4258
151 Ga0501257_000133 3300049686 Bacteria 16944
152 Ga0501257_003104 3300049686 Bacteria 3540
153 Ga0501261_000610 3300049690 Bacteria 4527
154 Ga0501225_0000105 3300049705 Bacteria 26429
155 Ga0501279_000015 3300049775 Bacteria 64426
156 Ga0501280_000226 3300049776 Bacteria 14226
157 Ga0501280_001332 3300049776 Bacteria 4689
158 Ga0501281_00176 3300049777 Bacteria 7350
159 Ga0501282_000128 3300049778 Bacteria 9060
160 Ga0501226_000038 3300049853 Bacteria 64184
161 Ga0500643_001128 3300053087 Bacteria 15935
162 Ga0500643_001221 3300053087 Bacteria 15319
163 Ga0500651_0084636 3300053093 Bacteria 1961
164 Ga0500566_0013057 3300053094 Bacteria 4895
165 Ga0500592_002551 3300053116 Bacteria 2922
166 Ga0500595_001121 3300053119 Bacteria 14857
167 Ga0500658_0000996 3300053134 Bacteria 11588
168 Ga0500559_0010123 3300053136 Bacteria 4058
169 Ga0500559_0030109 3300053136 Bacteria 2326
170 Ga0500568_0014341 3300053139 Bacteria 3582
171 Ga0500573_0000086 3300053140 Bacteria 42361
172 Ga0500577_0013794 3300053142 Bacteria 2479
173 Ga0500604_0014348 3300053151 Bacteria 2157
174 Ga0500616_0001309 3300053153 Bacteria 24602
175 Ga0500616_0011124 3300053153 Bacteria 5341
176 Ga0500624_000038 3300053157 Bacteria 93803
177 Ga0500637_0000294 3300053178 Bacteria 18781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100005655 Ga0068857_1000056558 266
2 3300026078 Ga0207702_10291856 Ga0207702_102918562 266
3 3300005616 Ga0068852_100000782 Ga0068852_10000078219 268
4 3300026142 Ga0207698_10000287 Ga0207698_100002872 268
5 3300037471 Ga0395905_0091690 Ga0395905_0091690_936_1967 268
6 3300046616 Ga0495668_0054685 Ga0495668_0054685_1332_2165 269
7 3300053116 Ga0500592_002551 Ga0500592_002551_2060_2893 269
8 3300046513 Ga0495616_0074108 Ga0495616_0074108_707_1564 270
9 3300013307 Ga0157372_10043727 Ga0157372_100437274 276
10 3300005344 Ga0070661_100064478 Ga0070661_1000644782 281
11 3300005455 Ga0070663_100002178 Ga0070663_1000021785 281
12 3300005539 Ga0068853_100089627 Ga0068853_1000896272 281
13 3300005578 Ga0068854_100000419 Ga0068854_10000041912 281
14 3300025321 Ga0207656_10014086 Ga0207656_100140862 281
15 3300025907 Ga0207645_10095703 Ga0207645_100957032 281
16 3300025919 Ga0207657_10169591 Ga0207657_101695912 281
17 3300025920 Ga0207649_10043953 Ga0207649_100439532 281
18 3300025924 Ga0207694_10062998 Ga0207694_100629982 281
19 3300025933 Ga0207706_10034722 Ga0207706_100347223 281
20 3300025981 Ga0207640_10000031 Ga0207640_1000003125 281
21 3300026041 Ga0207639_10052493 Ga0207639_100524933 281
22 3300026067 Ga0207678_10003572 Ga0207678_1000357214 281
23 3300053142 Ga0500577_0013794 Ga0500577_0013794_922_1929 281
24 3300036401 Ga0373937_0160867 Ga0373937_0160867_461_1450 282
25 3300048929 Ga0496126_0086383 Ga0496126_0086383_940_1920 282
26 3300013307 Ga0157372_10145872 Ga0157372_101458723 284
27 3300053136 Ga0500559_0030109 Ga0500559_0030109_1226_2260 287
28 3300053157 Ga0500624_000038 Ga0500624_000038_17741_18769 287
29 3300053178 Ga0500637_0000294 Ga0500637_0000294_9615_10643 287
30 3300048924 Ga0496121_0000580 Ga0496121_0000580_18149_19141 288
31 3300048927 Ga0496124_0241963 Ga0496124_0241963_121_1140 288
32 3300053134 Ga0500658_0000996 Ga0500658_0000996_5555_6583 288
33 3300009545 Ga0105237_10003492 Ga0105237_1000349212 289
34 3300048925 Ga0496122_0064053 Ga0496122_0064053_696_1712 289
35 3300048927 Ga0496124_0000874 Ga0496124_0000874_32697_33698 289
36 3300048927 Ga0496124_0005202 Ga0496124_0005202_10117_11133 289
37 3300053139 Ga0500568_0014341 Ga0500568_0014341_372_1355 289
38 3300053153 Ga0500616_0011124 Ga0500616_0011124_2488_3471 289
39 3300030733 Ga0314311_1146780 Ga0314311_11467802 290
40 3300039437 Ga0436365_0240258 Ga0436365_0240258_6116_7144 290
41 3300041404 Ga0439436_0004013 Ga0439436_0004013_3057_4079 290
42 3300041410 Ga0439461_0004928 Ga0439461_0004928_572_1594 290
43 3300041413 Ga0439465_0001603 Ga0439465_0001603_348_1370 290
44 3300042014 Ga0439457_009668 Ga0439457_009668_434_1456 290
45 3300042122 Ga0450920_015278 Ga0450920_015278_309_1331 290
46 3300042435 Ga0439434_0006127 Ga0439434_0006127_2304_3326 290
47 3300053094 Ga0500566_0013057 Ga0500566_0013057_144_1160 290
48 3300053140 Ga0500573_0000086 Ga0500573_0000086_10032_11066 290
49 3300005295 Ga0065707_10081862 Ga0065707_1008186221 291
50 3300005366 Ga0070659_100243502 Ga0070659_1002435022 291
51 3300014326 Ga0157380_10002611 Ga0157380_100026118 291
52 3300049581 Ga0501047_0081570 Ga0501047_0081570_1858_2847 291
53 iso_pu_bacteria 2599185359 2600225514 291
54 iso_pu_bacteria 2818991466 2819713951 291
55 iso_pu_bacteria 2928526807 2928528514 291
56 iso_pu_bacteria 2928968154 2928970059 291
57 3300005578 Ga0068854_100263890 Ga0068854_1002638902 292
58 3300015690 Ga0183363_1007 Ga0183363_1007189 292
59 3300025981 Ga0207640_10205110 Ga0207640_102051102 292
60 3300053087 Ga0500643_001221 Ga0500643_001221_8590_9576 292
61 3300053136 Ga0500559_0010123 Ga0500559_0010123_795_1826 292
62 3300005262 Ga0065165_1001326 Ga0065165_100132622 293
63 3300025927 Ga0207687_10014103 Ga0207687_100141035 293
64 3300032004 Ga0307414_10429893 Ga0307414_104298931 293
65 3300046507 Ga0495606_0004121 Ga0495606_0004121_1201_2211 293
66 iso_pu_bacteria 2599185354 2600200370 293
67 iso_pu_bacteria 2751185897 2753763818 293
68 iso_pu_bacteria 2830075706 2830078976 293
69 3300005338 Ga0068868_100000076 Ga0068868_10000007627 294
70 3300005339 Ga0070660_100000090 Ga0070660_10000009027 294
71 3300005345 Ga0070692_10107367 Ga0070692_101073671 294
72 3300005354 Ga0070675_100041603 Ga0070675_1000416033 294
73 3300005366 Ga0070659_100000122 Ga0070659_10000012227 294
74 3300005719 Ga0068861_100127218 Ga0068861_1001272182 294
75 3300013306 Ga0163162_10558561 Ga0163162_105585612 294
76 3300025919 Ga0207657_10000445 Ga0207657_1000044526 294
77 3300025926 Ga0207659_10029112 Ga0207659_100291123 294
78 3300025932 Ga0207690_10000001 Ga0207690_10000001672 294
79 3300026023 Ga0207677_10000144 Ga0207677_1000014429 294
80 3300031911 Ga0307412_10000306 Ga0307412_1000030612 294
81 3300046460 Ga0495638_0000481 Ga0495638_0000481_10361_11389 294
82 3300046660 Ga0495625_0104642 Ga0495625_0104642_721_1737 294
83 3300047472 Ga0495686_0000057 Ga0495686_0000057_211372_212346 294
84 3300053153 Ga0500616_0001309 Ga0500616_0001309_6958_7965 294
85 iso_pu_bacteria 2643221622 2644128346 294
86 3300005577 Ga0068857_100053709 Ga0068857_1000537092 295
87 3300005578 Ga0068854_100151632 Ga0068854_1001516322 295
88 3300005985 Ga0081539_10032094 Ga0081539_100320942 295
89 3300009177 Ga0105248_10071855 Ga0105248_100718553 295
90 3300025914 Ga0207671_10036164 Ga0207671_100361643 295
91 3300025981 Ga0207640_10028453 Ga0207640_100284533 295
92 3300031824 Ga0307413_10058837 Ga0307413_100588372 295
93 3300031911 Ga0307412_10000394 Ga0307412_1000039416 295
94 3300031911 Ga0307412_10068015 Ga0307412_100680151 295
95 3300032004 Ga0307414_10000147 Ga0307414_1000014727 295
96 3300046524 Ga0495648_0077018 Ga0495648_0077018_271_1284 295
97 3300049513 Ga0501290_000014 Ga0501290_000014_21108_22115 295
98 3300049513 Ga0501290_001869 Ga0501290_001869_1207_2214 295
99 3300049515 Ga0501292_000015 Ga0501292_000015_56685_57692 295
100 3300049517 Ga0501294_000034 Ga0501294_000034_6943_7950 295
101 3300049523 Ga0501300_002011 Ga0501300_002011_33_1040 295
102 3300049530 Ga0501314_000041 Ga0501314_000041_250_1227 295
103 3300049531 Ga0501315_005309 Ga0501315_005309_51_1058 295
104 3300049533 Ga0501317_005326 Ga0501317_005326_28_1035 295
105 3300049571 Ga0501034_0077867 Ga0501034_0077867_1012_1989 295
106 3300049653 Ga0501206_000172 Ga0501206_000172_1077_2084 295
107 3300049663 Ga0501223_000731 Ga0501223_000731_2759_3736 295
108 3300049663 Ga0501223_007742 Ga0501223_007742_753_1760 295
109 3300049664 Ga0501224_000034 Ga0501224_000034_18421_19398 295
110 3300049664 Ga0501224_002713 Ga0501224_002713_1211_2218 295
111 3300049665 Ga0501227_004491 Ga0501227_004491_1658_2665 295
112 3300049668 Ga0501233_001308 Ga0501233_001308_134_1111 295
113 3300049686 Ga0501257_000133 Ga0501257_000133_6745_7752 295
114 3300049686 Ga0501257_003104 Ga0501257_003104_2213_3220 295
115 3300049690 Ga0501261_000610 Ga0501261_000610_15_1022 295
116 3300049705 Ga0501225_0000105 Ga0501225_0000105_18158_19135 295
117 3300049775 Ga0501279_000015 Ga0501279_000015_56741_57748 295
118 3300049776 Ga0501280_000226 Ga0501280_000226_6223_7230 295
119 3300049776 Ga0501280_001332 Ga0501280_001332_1597_2604 295
120 3300049777 Ga0501281_00176 Ga0501281_00176_6184_7191 295
121 3300049778 Ga0501282_000128 Ga0501282_000128_4426_5433 295
122 3300049853 Ga0501226_000038 Ga0501226_000038_18421_19398 295
123 3300005548 Ga0070665_100184197 Ga0070665_1001841972 296
124 3300005843 Ga0068860_100023172 Ga0068860_1000231727 296
125 3300009551 Ga0105238_10069022 Ga0105238_100690223 296
126 3300025924 Ga0207694_10046018 Ga0207694_100460183 296
127 3300028381 Ga0268264_10011652 Ga0268264_100116526 296
128 3300033180 Ga0307510_10026545 Ga0307510_100265452 296
129 3300046506 Ga0495583_0006666 Ga0495583_0006666_407_1441 296
130 3300046616 Ga0495668_0125930 Ga0495668_0125930_25_1059 296
131 3300046660 Ga0495625_0011114 Ga0495625_0011114_3944_4978 296
132 3300047445 Ga0495677_0042421 Ga0495677_0042421_130_1164 296
133 3300048906 Ga0496103_0132258 Ga0496103_0132258_246_1286 296
134 3300048920 Ga0496117_0010519 Ga0496117_0010519_5922_6941 296
135 3300048921 Ga0496118_0053991 Ga0496118_0053991_1974_3002 296
136 3300048924 Ga0496121_0015897 Ga0496121_0015897_5869_6888 296
137 3300048925 Ga0496122_0015584 Ga0496122_0015584_5888_6916 296
138 3300048926 Ga0496123_0038208 Ga0496123_0038208_1088_2116 296
139 3300053087 Ga0500643_001128 Ga0500643_001128_5432_6466 296
140 3300053093 Ga0500651_0084636 Ga0500651_0084636_622_1650 296
141 3300053151 Ga0500604_0014348 Ga0500604_0014348_677_1690 296
142 3300005548 Ga0070665_100003840 Ga0070665_1000038409 297
143 3300005618 Ga0068864_100001277 Ga0068864_10000127711 297
144 3300005842 Ga0068858_100000414 Ga0068858_10000041427 297
145 3300009177 Ga0105248_10006249 Ga0105248_100062493 297
146 3300013306 Ga0163162_10001705 Ga0163162_1000170515 297
147 3300013306 Ga0163162_10037083 Ga0163162_100370833 297
148 3300025935 Ga0207709_10250832 Ga0207709_102508321 297
149 3300025941 Ga0207711_10015226 Ga0207711_100152263 297
150 3300026035 Ga0207703_10000634 Ga0207703_1000063418 297
151 3300026095 Ga0207676_10004229 Ga0207676_100042295 297
152 3300031911 Ga0307412_10035680 Ga0307412_100356802 297
153 3300047472 Ga0495686_0003084 Ga0495686_0003084_13147_14163 297
154 iso_pu_bacteria 2990265787 2990267168 297
155 iso_pu_bacteria 2993693658 2993694121 297
156 3300005459 Ga0068867_100307321 Ga0068867_1003073211 298
157 3300009148 Ga0105243_10367838 Ga0105243_103678381 298
158 3300025272 Ga0209455_1019502 Ga0209455_10195022 298
159 3300025960 Ga0207651_10139891 Ga0207651_101398912 298
160 3300005617 Ga0068859_100000597 Ga0068859_10000059711 299
161 3300005719 Ga0068861_100000061 Ga0068861_10000006149 299
162 3300006931 Ga0097620_100000597 Ga0097620_10000059716 299
163 3300009177 Ga0105248_10001933 Ga0105248_1000193312 299
164 3300014968 Ga0157379_10203088 Ga0157379_102030882 299
165 3300025941 Ga0207711_10008883 Ga0207711_100088838 299
166 3300026118 Ga0207675_100000011 Ga0207675_100000011146 299
167 3300047472 Ga0495686_0005131 Ga0495686_0005131_5294_6316 299
168 3300049587 Ga0501071_0071765 Ga0501071_0071765_1417_2436 299
169 3300053119 Ga0500595_001121 Ga0500595_001121_4782_5813 299
170 iso_pu_bacteria 2885429604 2885430267 300
171 3300020081 Ga0206354_11368877 Ga0206354_113688775 301
172 3300020082 Ga0206353_10288558 Ga0206353_1028855810 301
173 3300005347 Ga0070668_100333722 Ga0070668_1003337222 303
174 3300003214 JGI25165J46597_1000021 JGI25165J46597_100002115 304
175 3300005327 Ga0070658_10146698 Ga0070658_101466982 304
176 3300005530 Ga0070679_100266701 Ga0070679_1002667012 304
177 3300005842 Ga0068858_100003008 Ga0068858_1000030089 304
178 3300013306 Ga0163162_10184849 Ga0163162_101848492 304
179 3300025261 Ga0209233_1000065 Ga0209233_100006514 304
180 3300025921 Ga0207652_10280888 Ga0207652_102808882 304
181 3300026035 Ga0207703_10000927 Ga0207703_100009279 304
182 3300031507 Ga0307509_10088571 Ga0307509_100885711 304
183 3300031616 Ga0307508_10000810 Ga0307508_1000081012 304
184 3300037853 Ga0436364_0002779 Ga0436364_0002779_38_1078 304
185 3300046529 Ga0495652_0076295 Ga0495652_0076295_330_1355 304
186 3300046542 Ga0495597_0057635 Ga0495597_0057635_487_1509 304
187 3300046660 Ga0495625_0000112 Ga0495625_0000112_8570_9592 304
188 3300046691 Ga0495670_0001636 Ga0495670_0001636_8181_9221 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16976

RcpC

Flp pilus assembly protein RcpC/CpaB

113

226

0.96

PF08666

SAF

SAF domain

40

107

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ur4-assembly1.cif.gz_A structure of the type iii fish antifreeze protein from zoarces viviparus zvafp13 0.8695 18 83
7ame-assembly1.cif.gz_A type iii antifreeze protein isoform hplc 12 t15a 0.8662 18 83
1ucs-assembly1.cif.gz_A type iii antifreeze protein rd1 from an antarctic eel pout 0.8602 17 83
4ipj-assembly1.cif.gz_A-2 crystal structure of r314k n-acetyl neuraminic acid synthase from neiserria meningitidis with malate bound 0.8595 18 84
6ppw-assembly1.cif.gz_A crystal structure of neub, an n-acetylneuraminate synthase from neisseria meningitidis, in complex with magnesium and malate 0.8589 18 84
ID Description Score Start End Superfamily
af_P75933_96_158_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8885 20 85 3.90.1210.10
af_A0A0G2L5X9_296_357_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8716 18 85 3.90.1210.10
af_P75933_96_158_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8632 20 85 3.90.1210.10
3frnA02 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8624 18 86 3.90.1210.10
af_Q9VG74_312_372_3.90.1210.10 Alpha Beta;Alpha-Beta Complex;Type Iii Antifreeze Protein Isoform Hplc 12;Antifreeze-like/N-acetylneuraminic acid synthase C-terminal domain 0.8559 19 85 3.90.1210.10
ID Description Score Start End GO Terms
AF-A0A259GVM3-F1-model_v4 Flp pilus assembly protein CpaB 0.8278 1 204
AF-A0A1F9ZJI0-F1-model_v4 deleted 0.8196 1 91
AF-A0A1I1LP47-F1-model_v4 Flp pilus assembly protein CpaB 0.8046 18 214 GO:0016020
AF-A0A4V2A070-F1-model_v4 Flp pilus assembly protein CpaB 0.7966 1 265
AF-A0A2H0QE46-F1-model_v4 Flp pilus assembly protein CpaB 0.7905 4 203

Feature Viewer

pLDDT pTM Quality
70.15 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map