F288871

General Info

Members Datasets Scaffolds Average Seq Length
188 141 376 115

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100675649|Ga0070675_1006756491
Length 130
Sequence MSNDECVKIGFADGLRRLPGPHGEHNVALFEHGSLVVKLSQPRGPDLQLPHSRDEIYVVARGTGEFVCGSARKTFSPHDLLFAAAGTEHRFENFSDDFAVWVFFYGPEGGEADRSQVTPGDRRPWLDSIQ

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
88 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
89 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
90 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
99 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.85
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 39.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100675649 3300005354 Unclassified 940
2 Ga0070676_10580206 3300005328 Unclassified 806
3 Ga0070692_10151979 3300005345 Unclassified 1319
4 Ga0070669_100140000 3300005353 Unclassified 1865
5 Ga0070669_100774355 3300005353 Unclassified 814
6 Ga0070671_100144603 3300005355 Unclassified 2007
7 Ga0070674_100155677 3300005356 Bacteria 1729
8 Ga0070673_100535262 3300005364 Unclassified 1063
9 Ga0070688_100357504 3300005365 Bacteria 1071
10 Ga0070703_10000184 3300005406 Bacteria 30635
11 Ga0070701_10515542 3300005438 Unclassified 779
12 Ga0070705_100297472 3300005440 Unclassified 1155
13 Ga0070705_100496876 3300005440 Unclassified 925
14 Ga0070705_100697921 3300005440 Unclassified 797
15 Ga0070700_100005551 3300005441 Bacteria 6687
16 Ga0070694_100001404 3300005444 Bacteria 14092
17 Ga0070694_100337158 3300005444 Bacteria 1165
18 Ga0070694_100490790 3300005444 Unclassified 976
19 Ga0070694_100617993 3300005444 Unclassified 874
20 Ga0070708_100109425 3300005445 Bacteria 2538
21 Ga0070708_100640052 3300005445 Unclassified 1002
22 Ga0070708_100796024 3300005445 Unclassified 889
23 Ga0070708_100877402 3300005445 Unclassified 843
24 Ga0070663_100235916 3300005455 Bacteria 1442
25 Ga0070706_100017579 3300005467 Bacteria 6599
26 Ga0070706_100277104 3300005467 Bacteria 1565
27 Ga0070707_100000026 3300005468 Bacteria 124537
28 Ga0070707_100014167 3300005468 Bacteria 7473
29 Ga0070707_100093409 3300005468 Bacteria 2912
30 Ga0070698_100003309 3300005471 Bacteria 17724
31 Ga0070698_101236124 3300005471 Unclassified 696
32 Ga0070699_100061823 3300005518 Unclassified 3245
33 Ga0070699_100472959 3300005518 Unclassified 1137
34 Ga0070699_101808640 3300005518 Unclassified 559
35 Ga0070679_101830022 3300005530 Unclassified 556
36 Ga0070697_100167662 3300005536 Bacteria 1857
37 Ga0070686_100057872 3300005544 Bacteria 2492
38 Ga0070695_100398302 3300005545 Unclassified 1043
39 Ga0070695_100456885 3300005545 Bacteria 980
40 Ga0070696_100645019 3300005546 Bacteria 858
41 Ga0070696_101215283 3300005546 Bacteria 637
42 Ga0070704_100074924 3300005549 Bacteria 2470
43 Ga0070704_100120295 3300005549 Bacteria 2016
44 Ga0070704_100691056 3300005549 Unclassified 904
45 Ga0068857_100442191 3300005577 Unclassified 1215
46 Ga0068856_101170017 3300005614 Bacteria 786
47 Ga0070702_100713533 3300005615 Unclassified 766
48 Ga0068859_100005958 3300005617 Bacteria 12378
49 Ga0068859_100362002 3300005617 Unclassified 1546
50 Ga0068864_100031724 3300005618 Bacteria 4485
51 Ga0068864_101058421 3300005618 Unclassified 806
52 Ga0068863_100293962 3300005841 Bacteria 1575
53 Ga0068863_102567275 3300005841 Unclassified 519
54 Ga0068860_100186923 3300005843 Bacteria 2004
55 Ga0068860_100418316 3300005843 Bacteria 1328
56 Ga0068862_100012806 3300005844 Bacteria 6940
57 Ga0068862_100288615 3300005844 Bacteria 1506
58 Ga0070716_100000028 3300006173 Bacteria 62646
59 Ga0070716_100026193 3300006173 Bacteria 3121
60 Ga0070716_100532924 3300006173 Bacteria 872
61 Ga0097621_100149414 3300006237 Unclassified 2003
62 Ga0097621_100552558 3300006237 Unclassified 1048
63 Ga0097621_101265601 3300006237 Unclassified 696
64 Ga0068871_101415577 3300006358 Unclassified 656
65 Ga0075428_100141734 3300006844 Unclassified 2613
66 Ga0075430_100559570 3300006846 Unclassified 943
67 Ga0075433_10211557 3300006852 Bacteria 1723
68 Ga0075434_100322977 3300006871 Bacteria 1564
69 Ga0075434_100407084 3300006871 Bacteria 1381
70 Ga0075429_100245413 3300006880 Bacteria 1568
71 Ga0068865_100692892 3300006881 Unclassified 870
72 Ga0075436_100000005 3300006914 Bacteria 360336
73 Ga0097620_100005958 3300006931 Bacteria 12378
74 Ga0097620_100361991 3300006931 Unclassified 1546
75 Ga0075435_100000470 3300007076 Bacteria 24508
76 Ga0075435_100524508 3300007076 Unclassified 1025
77 Ga0099794_10148126 3300007265 Bacteria 1191
78 Ga0099795_10295727 3300007788 Bacteria 711
79 Ga0111539_10010565 3300009094 Bacteria 11626
80 Ga0105243_10000039 3300009148 Bacteria 166207
81 Ga0105243_10124997 3300009148 Bacteria 2174
82 Ga0105242_10000013 3300009176 Bacteria 133981
83 Ga0105248_10041794 3300009177 Bacteria 5141
84 Ga0105237_10767179 3300009545 Bacteria 971
85 Ga0105249_10602403 3300009553 Bacteria 1153
86 Ga0105246_10386615 3300011119 Unclassified 1158
87 Ga0157374_11780682 3300013296 Bacteria 641
88 Ga0157378_10631716 3300013297 Unclassified 1085
89 Ga0163162_10776893 3300013306 Unclassified 1076
90 Ga0157372_10147136 3300013307 Unclassified 2717
91 Ga0157375_13310023 3300013308 Unclassified 537
92 Ga0157380_10861434 3300014326 Bacteria 929
93 Ga0157377_10200142 3300014745 Bacteria 1268
94 Ga0207653_10000191 3300025885 Bacteria 42182
95 Ga0207684_10001572 3300025910 Bacteria 24352
96 Ga0207695_11697554 3300025913 Unclassified 512
97 Ga0207662_10088589 3300025918 Unclassified 1901
98 Ga0207646_10002602 3300025922 Bacteria 21242
99 Ga0207646_10007868 3300025922 Bacteria 10764
100 Ga0207646_10022752 3300025922 Bacteria 5764
101 Ga0207681_10156555 3300025923 Unclassified 1713
102 Ga0207659_10059636 3300025926 Unclassified 2744
103 Ga0207686_10000006 3300025934 Bacteria 259583
104 Ga0207686_10398481 3300025934 Unclassified 1048
105 Ga0207709_10000037 3300025935 Bacteria 279771
106 Ga0207709_11387657 3300025935 Bacteria 582
107 Ga0207704_10918002 3300025938 Unclassified 737
108 Ga0207665_10000075 3300025939 Bacteria 63685
109 Ga0207665_10106791 3300025939 Bacteria 1962
110 Ga0207665_10694201 3300025939 Bacteria 800
111 Ga0207667_10292437 3300025949 Unclassified 1664
112 Ga0207651_10227420 3300025960 Bacteria 1512
113 Ga0207712_10206359 3300025961 Bacteria 1562
114 Ga0207712_11100734 3300025961 Unclassified 707
115 Ga0207677_11872023 3300026023 Bacteria 557
116 Ga0207703_10828005 3300026035 Bacteria 884
117 Ga0207708_10072494 3300026075 Unclassified 2639
118 Ga0207641_10189983 3300026088 Bacteria 1887
119 Ga0207676_10049132 3300026095 Bacteria 3279
120 Ga0207676_10901076 3300026095 Unclassified 867
121 Ga0207674_10343801 3300026116 Bacteria 1442
122 Ga0207675_101409029 3300026118 Unclassified 718
123 Ga0207428_10008852 3300027907 Bacteria 9073
124 Ga0268265_10052388 3300028380 Bacteria 3086
125 Ga0268265_10208924 3300028380 Bacteria 1700
126 Ga0307408_100255279 3300031548 Bacteria 1448
127 Ga0307406_10122782 3300031901 Bacteria 1809
128 Ga0373950_0000470 3300034818 Bacteria 4924
129 Ga0373928_0080586 3300035084 Unclassified 820
130 Ga0373951_0118745 3300035091 Unclassified 718
131 Ga0373941_0074765 3300035115 Bacteria 1132
132 Ga0373943_0042613 3300035170 Bacteria 2200
133 Ga0373931_0045899 3300035691 Bacteria 2308
134 Ga0373947_0493711 3300035725 Bacteria 831
135 Ga0373925_0027705 3300037068 Bacteria 4147
136 Ga0395900_0472822 3300037418 Unclassified 1207
137 Ga0395905_1486935 3300037471 Unclassified 582
138 Ga0436364_0467465 3300037853 Bacteria 724
139 Ga0242420_050796 3300038996 Bacteria 810
140 Ga0439459_0218747 3300042438 Unclassified 527
141 Ga0466963_1087402 3300044694 Unclassified 562
142 Ga0453684_1273232 3300044712 Unclassified 768
143 Ga0466971_0710617 3300044719 Unclassified 506
144 Ga0466958_0433325 3300045836 Bacteria 850
145 Ga0466967_1788617 3300045976 Unclassified 612
146 Ga0495580_0121354 3300046472 Bacteria 1814
147 Ga0495580_0169203 3300046472 Bacteria 1511
148 Ga0495585_0531448 3300046492 Unclassified 557
149 Ga0495598_0131159 3300046537 Unclassified 859
150 Ga0495667_0764269 3300046559 Bacteria 597
151 Ga0495656_0175875 3300046615 Unclassified 1049
152 Ga0495659_0018691 3300046664 Unclassified 2312
153 Ga0495670_0214331 3300046691 Unclassified 1022
154 Ga0496100_0060642 3300048903 Bacteria 2490
155 Ga0496102_0079698 3300048905 Bacteria 3016
156 Ga0496104_0026549 3300048907 Bacteria 5350
157 Ga0496105_0258940 3300048908 Unclassified 1407
158 Ga0496106_1255464 3300048909 Unclassified 576
159 Ga0496108_0023470 3300048911 Bacteria 5076
160 Ga0496109_0005988 3300048912 Bacteria 10215
161 Ga0496110_0006625 3300048913 Bacteria 9200
162 Ga0496111_0029154 3300048914 Bacteria 3918
163 Ga0496112_0002052 3300048915 Bacteria 15965
164 Ga0496113_0007331 3300048916 Bacteria 7082
165 Ga0501041_0028429 3300049577 Bacteria 3373
166 Ga0501042_0016204 3300049578 Bacteria 5113
167 Ga0501067_0000019 3300049583 Bacteria 100678
168 Ga0501067_0068528 3300049583 Bacteria 1964
169 Ga0501067_0314762 3300049583 Bacteria 872
170 Ga0501072_0057393 3300049588 Bacteria 3068
171 Ga0501073_0034335 3300049589 Bacteria 3611
172 Ga0501075_0481986 3300049591 Unclassified 946
173 Ga0501076_0807042 3300049592 Unclassified 774
174 Ga0501225_0245038 3300049705 Unclassified 587
175 Ga0501081_0173560 3300049743 Bacteria 1557
176 Ga0501045_0183259 3300049824 Unclassified 1560
177 nmdc:mga09592_248501_c1 3300050508 Bacteria 1542
178 nmdc:mga06r32_466520_c1 3300050510 Bacteria 1241
179 nmdc:mga08y16_2062554_c1 3300050511 Unclassified 519
180 nmdc:mga0n895_396473_c1 3300050512 Bacteria 1396
181 nmdc:mga0n895_715405_c1 3300050512 Bacteria 996
182 nmdc:mga0rr50_1511861_c1 3300050513 Bacteria 567
183 nmdc:mga0rr50_370_c2 3300050513 Bacteria 20890
184 nmdc:mga08x19_27_c1 3300050514 Bacteria 226652
185 nmdc:mga0a205_126942_c1 3300050515 Bacteria 2450
186 nmdc:mga0a205_46300_c1 3300050515 Bacteria 4194
187 Ga0501082_0340251 3300060353 Unclassified 1307
188 Ga0530510_0699472 3300061734 Bacteria 772
189 Ga0070675_100675649
190 Ga0070676_10580206
191 Ga0070692_10151979
192 Ga0070669_100140000
193 Ga0070669_100774355
194 Ga0070671_100144603
195 Ga0070674_100155677
196 Ga0070673_100535262
197 Ga0070688_100357504
198 Ga0070703_10000184
199 Ga0070701_10515542
200 Ga0070705_100297472
201 Ga0070705_100496876
202 Ga0070705_100697921
203 Ga0070700_100005551
204 Ga0070694_100001404
205 Ga0070694_100337158
206 Ga0070694_100490790
207 Ga0070694_100617993
208 Ga0070708_100109425
209 Ga0070708_100640052
210 Ga0070708_100796024
211 Ga0070708_100877402
212 Ga0070663_100235916
213 Ga0070706_100017579
214 Ga0070706_100277104
215 Ga0070707_100000026
216 Ga0070707_100014167
217 Ga0070707_100093409
218 Ga0070698_100003309
219 Ga0070698_101236124
220 Ga0070699_100061823
221 Ga0070699_100472959
222 Ga0070699_101808640
223 Ga0070679_101830022
224 Ga0070697_100167662
225 Ga0070686_100057872
226 Ga0070695_100398302
227 Ga0070695_100456885
228 Ga0070696_100645019
229 Ga0070696_101215283
230 Ga0070704_100074924
231 Ga0070704_100120295
232 Ga0070704_100691056
233 Ga0068857_100442191
234 Ga0068856_101170017
235 Ga0070702_100713533
236 Ga0068859_100005958
237 Ga0068859_100362002
238 Ga0068864_100031724
239 Ga0068864_101058421
240 Ga0068863_100293962
241 Ga0068863_102567275
242 Ga0068860_100186923
243 Ga0068860_100418316
244 Ga0068862_100012806
245 Ga0068862_100288615
246 Ga0070716_100000028
247 Ga0070716_100026193
248 Ga0070716_100532924
249 Ga0097621_100149414
250 Ga0097621_100552558
251 Ga0097621_101265601
252 Ga0068871_101415577
253 Ga0075428_100141734
254 Ga0075430_100559570
255 Ga0075433_10211557
256 Ga0075434_100322977
257 Ga0075434_100407084
258 Ga0075429_100245413
259 Ga0068865_100692892
260 Ga0075436_100000005
261 Ga0097620_100005958
262 Ga0097620_100361991
263 Ga0075435_100000470
264 Ga0075435_100524508
265 Ga0099794_10148126
266 Ga0099795_10295727
267 Ga0111539_10010565
268 Ga0105243_10000039
269 Ga0105243_10124997
270 Ga0105242_10000013
271 Ga0105248_10041794
272 Ga0105237_10767179
273 Ga0105249_10602403
274 Ga0105246_10386615
275 Ga0157374_11780682
276 Ga0157378_10631716
277 Ga0163162_10776893
278 Ga0157372_10147136
279 Ga0157375_13310023
280 Ga0157380_10861434
281 Ga0157377_10200142
282 Ga0207653_10000191
283 Ga0207684_10001572
284 Ga0207695_11697554
285 Ga0207662_10088589
286 Ga0207646_10002602
287 Ga0207646_10007868
288 Ga0207646_10022752
289 Ga0207681_10156555
290 Ga0207659_10059636
291 Ga0207686_10000006
292 Ga0207686_10398481
293 Ga0207709_10000037
294 Ga0207709_11387657
295 Ga0207704_10918002
296 Ga0207665_10000075
297 Ga0207665_10106791
298 Ga0207665_10694201
299 Ga0207667_10292437
300 Ga0207651_10227420
301 Ga0207712_10206359
302 Ga0207712_11100734
303 Ga0207677_11872023
304 Ga0207703_10828005
305 Ga0207708_10072494
306 Ga0207641_10189983
307 Ga0207676_10049132
308 Ga0207676_10901076
309 Ga0207674_10343801
310 Ga0207675_101409029
311 Ga0207428_10008852
312 Ga0268265_10052388
313 Ga0268265_10208924
314 Ga0307408_100255279
315 Ga0307406_10122782
316 Ga0373950_0000470
317 Ga0373928_0080586
318 Ga0373951_0118745
319 Ga0373941_0074765
320 Ga0373943_0042613
321 Ga0373931_0045899
322 Ga0373947_0493711
323 Ga0373925_0027705
324 Ga0395900_0472822
325 Ga0395905_1486935
326 Ga0436364_0467465
327 Ga0242420_050796
328 Ga0439459_0218747
329 Ga0466963_1087402
330 Ga0453684_1273232
331 Ga0466971_0710617
332 Ga0466958_0433325
333 Ga0466967_1788617
334 Ga0495580_0121354
335 Ga0495580_0169203
336 Ga0495585_0531448
337 Ga0495598_0131159
338 Ga0495667_0764269
339 Ga0495656_0175875
340 Ga0495659_0018691
341 Ga0495670_0214331
342 Ga0496100_0060642
343 Ga0496102_0079698
344 Ga0496104_0026549
345 Ga0496105_0258940
346 Ga0496106_1255464
347 Ga0496108_0023470
348 Ga0496109_0005988
349 Ga0496110_0006625
350 Ga0496111_0029154
351 Ga0496112_0002052
352 Ga0496113_0007331
353 Ga0501041_0028429
354 Ga0501042_0016204
355 Ga0501067_0000019
356 Ga0501067_0068528
357 Ga0501067_0314762
358 Ga0501072_0057393
359 Ga0501073_0034335
360 Ga0501075_0481986
361 Ga0501076_0807042
362 Ga0501225_0245038
363 Ga0501081_0173560
364 Ga0501045_0183259
365 nmdc:mga09592_248501_c1
366 nmdc:mga06r32_466520_c1
367 nmdc:mga08y16_2062554_c1
368 nmdc:mga0n895_396473_c1
369 nmdc:mga0n895_715405_c1
370 nmdc:mga0rr50_1511861_c1
371 nmdc:mga0rr50_370_c2
372 nmdc:mga08x19_27_c1
373 nmdc:mga0a205_126942_c1
374 nmdc:mga0a205_46300_c1
375 Ga0501082_0340251
376 Ga0530510_0699472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

37

105

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.8647 36 106
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.8555 30 110
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.8542 37 109
3h9a-assembly1.cif.gz_A crystal structure of bacb, an enzyme involved in bacilysin synthesis, in triclinic form 0.8491 32 110
2d40-assembly1.cif.gz_D crystal structure of z3393 from escherichia coli o157:h7 0.8471 36 106
ID Description Score Start End Superfamily
af_P09378_2_94_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8863 35 109 2.60.120.10
af_P09377_6_85_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8671 35 105 2.60.120.10
3es4B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.865 30 106 2.60.120.10
af_Q2G2J4_1_140_2.60.120.280 Mainly Beta;Sandwich;Jelly Rolls;Regulatory protein AraC 0.862 33 108 2.60.120.280
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8489 37 107 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W9RDJ7-F1-model_v4 deleted 0.9913 30 114
AF-A0A2N3KT56-F1-model_v4 Cupin 0.9846 30 115
AF-A0A3N5L1W4-F1-model_v4 Cupin domain-containing protein 0.9803 1 117
AF-A0A7Y4QRH1-F1-model_v4 Cupin domain-containing protein 0.9759 39 114
AF-A0A7V9TIN0-F1-model_v4 Cupin domain-containing protein 0.9709 30 116

Map