F288339
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 187 | 146 | 374 | 552 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0153724|Ga0501034_0153724_679_2253 |
| Length | 524 |
| Sequence | VEYVWFNNVETRPGVGYPRGYEDQEKWGGGWVRTKRGRIKLRSGGRLAKLARIFSNPNLPGITDYYEPWTYDYDMLINAPRSAQTPVARPKSLLTGENMKISWSANWDDDLGGSLETMQQDPILTKMSEEVKAEFEKAFMFYLPRICEHCLNPSCVASCPSGAMYKRAEDGIVLVDQDQCRGWRMCVSGCPYKKVYFNHRTGKAEKCTFCYPRIEVGLPTVCSETCVGRLRYLGIVLYDADRVAEAASVEDDTALLQAQRDIILDPHDPAVIEAARAGDIPEDWIEAAQRSPIWKLMQYEVALPLHPEYRTMPMVWYIPPLSPVVDVVTGSGNDGEDARTLFAAIDKLRIPIGYLAELFTAGDVAPVDAALRRLAAMRSYMRGINIDDERDERIANAVGMSGAEIEEMYRLLAIAKYEERYVIPSAHTEQAHALEEMACSLDFEGGPGMGGAGPFGSSSGQSVPVAVENFHMLQNRQTADRPSSPGRMNLLNWDGNGTPEGLFPPSTMGEVRPTGRRKDGKDKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 14 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 15 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 16 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 17 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 19 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 20 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 21 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 22 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 23 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 24 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 25 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 56 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 58 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 59 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 60 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 61 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 62 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 63 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 64 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 65 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 66 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 67 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 68 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 69 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 70 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 71 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 72 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 73 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 74 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 75 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 76 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 77 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 78 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 79 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 80 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 89 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 90 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 91 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 92 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 93 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 94 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 96 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 97 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 98 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 99 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 100 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 101 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 102 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 103 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 104 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 105 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 106 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 120 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 126 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 128 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 129 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 130 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 131 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 132 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 133 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 134 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 135 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 136 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 137 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 138 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 139 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 140 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 141 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 142 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 143 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 144 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 145 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 146 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.7 |
| Metatranscriptomes | 1.6 |
| Isolates | 10.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.74 |
| Nodule | 0 |
| Rhizoplane | 14.97 |
| Rhizosphere | 68.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0153724 | 3300049571 | Bacteria | 2276 |
| 2 | JGI24737J22298_10005848 | 3300001990 | Bacteria | 4235 |
| 3 | JGI24751J29686_10005746 | 3300002459 | Bacteria | 2529 |
| 4 | Ga0070658_10000934 | 3300005327 | Bacteria | 25019 |
| 5 | Ga0070683_100137779 | 3300005329 | Bacteria | 2312 |
| 6 | Ga0070680_100001855 | 3300005336 | Bacteria | 15493 |
| 7 | Ga0070680_100023827 | 3300005336 | Bacteria | 4885 |
| 8 | Ga0070667_100017047 | 3300005367 | Bacteria | 6015 |
| 9 | Ga0070710_10000803 | 3300005437 | Bacteria | 15077 |
| 10 | Ga0070663_100095912 | 3300005455 | Bacteria | 2205 |
| 11 | Ga0070681_10002068 | 3300005458 | Bacteria | 18207 |
| 12 | Ga0070679_100033812 | 3300005530 | Bacteria | 5063 |
| 13 | Ga0070679_100067210 | 3300005530 | Bacteria | 3574 |
| 14 | Ga0070665_100003664 | 3300005548 | Bacteria | 16277 |
| 15 | Ga0068856_100006857 | 3300005614 | Bacteria | 11140 |
| 16 | Ga0068864_100020533 | 3300005618 | Bacteria | 5526 |
| 17 | Ga0068858_100057679 | 3300005842 | Bacteria | 3589 |
| 18 | Ga0068862_100087876 | 3300005844 | Bacteria | 2703 |
| 19 | Ga0081455_10006357 | 3300005937 | Bacteria | 12682 |
| 20 | Ga0075365_10069695 | 3300006038 | Bacteria | 2364 |
| 21 | Ga0075364_10000205 | 3300006051 | Bacteria | 27728 |
| 22 | Ga0075364_10020696 | 3300006051 | Bacteria | 4140 |
| 23 | Ga0075369_10000076 | 3300006186 | Bacteria | 25607 |
| 24 | Ga0075428_100006458 | 3300006844 | Bacteria | 13039 |
| 25 | Ga0075430_100032250 | 3300006846 | Bacteria | 4448 |
| 26 | Ga0075431_100011627 | 3300006847 | Bacteria | 8876 |
| 27 | Ga0075431_100031051 | 3300006847 | Bacteria | 5503 |
| 28 | Ga0075431_100033186 | 3300006847 | Bacteria | 5321 |
| 29 | Ga0075429_100000719 | 3300006880 | Bacteria | 25935 |
| 30 | Ga0075429_100022197 | 3300006880 | Bacteria | 5506 |
| 31 | Ga0105240_10018342 | 3300009093 | Bacteria | 9402 |
| 32 | Ga0105245_10066343 | 3300009098 | Bacteria | 3266 |
| 33 | Ga0114129_10001401 | 3300009147 | Bacteria | 32515 |
| 34 | Ga0105248_10050147 | 3300009177 | Bacteria | 4681 |
| 35 | Ga0105237_10003844 | 3300009545 | Bacteria | 17655 |
| 36 | Ga0105238_10089375 | 3300009551 | Bacteria | 3067 |
| 37 | Ga0157370_10024239 | 3300013104 | Bacteria | 6011 |
| 38 | Ga0157369_10009702 | 3300013105 | Bacteria | 11009 |
| 39 | Ga0157372_10196740 | 3300013307 | Bacteria | 2335 |
| 40 | Ga0163163_10006207 | 3300014325 | Bacteria | 10424 |
| 41 | Ga0163163_10013370 | 3300014325 | Bacteria | 7513 |
| 42 | Ga0157380_10151659 | 3300014326 | Bacteria | 2004 |
| 43 | Ga0157376_10009216 | 3300014969 | Bacteria | 7161 |
| 44 | Ga0206354_10325387 | 3300020081 | Bacteria | 2871 |
| 45 | Ga0206353_10056960 | 3300020082 | Bacteria | 15189 |
| 46 | Ga0206353_11325379 | 3300020082 | Bacteria | 13222 |
| 47 | Ga0207692_10001483 | 3300025898 | Bacteria | 8801 |
| 48 | Ga0207647_10006214 | 3300025904 | Bacteria | 8706 |
| 49 | Ga0207647_10008929 | 3300025904 | Bacteria | 7149 |
| 50 | Ga0207705_10014984 | 3300025909 | Bacteria | 5573 |
| 51 | Ga0207707_10015814 | 3300025912 | Bacteria | 6579 |
| 52 | Ga0207695_10043068 | 3300025913 | Bacteria | 4814 |
| 53 | Ga0207671_10011207 | 3300025914 | Bacteria | 7317 |
| 54 | Ga0207660_10006337 | 3300025917 | Bacteria | 7672 |
| 55 | Ga0207660_10019767 | 3300025917 | Bacteria | 4509 |
| 56 | Ga0207652_10005923 | 3300025921 | Bacteria | 9888 |
| 57 | Ga0207689_10052009 | 3300025942 | Bacteria | 3376 |
| 58 | Ga0207668_10096831 | 3300025972 | Bacteria | 2182 |
| 59 | Ga0207640_10053341 | 3300025981 | Bacteria | 2639 |
| 60 | Ga0207658_10037956 | 3300025986 | Bacteria | 3466 |
| 61 | Ga0207658_10047486 | 3300025986 | Bacteria | 3142 |
| 62 | Ga0207678_10031752 | 3300026067 | Bacteria | 4605 |
| 63 | Ga0207702_10014707 | 3300026078 | Bacteria | 6493 |
| 64 | Ga0207641_10012532 | 3300026088 | Bacteria | 6950 |
| 65 | Ga0207683_10108418 | 3300026121 | Bacteria | 2485 |
| 66 | Ga0207428_10005689 | 3300027907 | Bacteria | 11584 |
| 67 | Ga0268266_10003977 | 3300028379 | Bacteria | 14336 |
| 68 | Ga0307515_10000741 | 3300028794 | Bacteria | 75546 |
| 69 | Ga0307509_10092331 | 3300031507 | Bacteria | 3095 |
| 70 | Ga0307516_10001822 | 3300031730 | Bacteria | 29271 |
| 71 | Ga0307413_10031486 | 3300031824 | Bacteria | 2994 |
| 72 | Ga0307518_10021152 | 3300031838 | Bacteria | 4677 |
| 73 | Ga0307410_10007301 | 3300031852 | Bacteria | 6038 |
| 74 | Ga0307406_10020504 | 3300031901 | Bacteria | 3894 |
| 75 | Ga0307407_10023480 | 3300031903 | Bacteria | 3219 |
| 76 | Ga0307409_100007230 | 3300031995 | Bacteria | 6621 |
| 77 | Ga0307409_100011592 | 3300031995 | Bacteria | 5570 |
| 78 | Ga0307416_100037205 | 3300032002 | Bacteria | 3742 |
| 79 | Ga0307414_10030359 | 3300032004 | Bacteria | 3530 |
| 80 | Ga0307415_100004837 | 3300032126 | Bacteria | 7062 |
| 81 | Ga0373936_0002284 | 3300035113 | Bacteria | 7176 |
| 82 | Ga0395898_0002239 | 3300037466 | Bacteria | 23529 |
| 83 | Ga0395901_0019050 | 3300038443 | Bacteria | 7017 |
| 84 | Ga0395901_0032777 | 3300038443 | Bacteria | 5360 |
| 85 | Ga0395901_0075179 | 3300038443 | Bacteria | 3524 |
| 86 | Ga0451793_0571048 | 3300041452 | Bacteria | 6262 |
| 87 | Ga0439434_0009850 | 3300042435 | Bacteria | 2812 |
| 88 | Ga0466961_0015269 | 3300044693 | Bacteria | 4932 |
| 89 | Ga0466957_0016942 | 3300044842 | Bacteria | 4264 |
| 90 | Ga0466960_0003620 | 3300044901 | Bacteria | 5960 |
| 91 | Ga0466959_0033232 | 3300045049 | Bacteria | 3816 |
| 92 | Ga0466958_0013325 | 3300045836 | Bacteria | 4679 |
| 93 | Ga0466967_0159464 | 3300045976 | Bacteria | 2116 |
| 94 | Ga0495651_0034949 | 3300046462 | Bacteria | 3916 |
| 95 | Ga0495608_0030671 | 3300046511 | Bacteria | 3639 |
| 96 | Ga0495628_0071603 | 3300046516 | Bacteria | 2702 |
| 97 | Ga0495657_0011594 | 3300046675 | Bacteria | 6587 |
| 98 | Ga0495657_0038664 | 3300046675 | Bacteria | 3282 |
| 99 | Ga0495599_0037711 | 3300046678 | Bacteria | 3036 |
| 100 | Ga0495581_0042635 | 3300047315 | Bacteria | 2626 |
| 101 | Ga0495680_0004522 | 3300047322 | Bacteria | 13286 |
| 102 | Ga0495602_0028161 | 3300048088 | Bacteria | 5382 |
| 103 | Ga0496101_0017604 | 3300048904 | Bacteria | 4848 |
| 104 | Ga0496102_0007855 | 3300048905 | Bacteria | 9116 |
| 105 | Ga0496102_0132569 | 3300048905 | Bacteria | 2333 |
| 106 | Ga0496103_0012738 | 3300048906 | Bacteria | 4988 |
| 107 | Ga0496103_0037044 | 3300048906 | Bacteria | 2989 |
| 108 | Ga0496104_0025264 | 3300048907 | Bacteria | 5475 |
| 109 | Ga0496104_0135986 | 3300048907 | Bacteria | 2361 |
| 110 | Ga0496105_0009339 | 3300048908 | Bacteria | 7665 |
| 111 | Ga0496105_0087424 | 3300048908 | Bacteria | 2575 |
| 112 | Ga0496107_0039569 | 3300048910 | Bacteria | 3382 |
| 113 | Ga0496108_0000015 | 3300048911 | Bacteria | 243282 |
| 114 | Ga0496108_0015240 | 3300048911 | Bacteria | 6272 |
| 115 | Ga0496108_0053353 | 3300048911 | Bacteria | 3390 |
| 116 | Ga0496109_0003825 | 3300048912 | Bacteria | 12574 |
| 117 | Ga0496109_0035996 | 3300048912 | Bacteria | 4468 |
| 118 | Ga0496109_0045858 | 3300048912 | Bacteria | 3968 |
| 119 | Ga0496110_0021260 | 3300048913 | Bacteria | 5490 |
| 120 | Ga0496110_0059742 | 3300048913 | Bacteria | 3361 |
| 121 | Ga0496111_0010110 | 3300048914 | Bacteria | 6317 |
| 122 | Ga0496111_0010135 | 3300048914 | Bacteria | 6309 |
| 123 | Ga0496111_0078606 | 3300048914 | Bacteria | 2406 |
| 124 | Ga0496112_0021183 | 3300048915 | Bacteria | 6178 |
| 125 | Ga0496112_0057156 | 3300048915 | Bacteria | 3840 |
| 126 | Ga0496113_0022825 | 3300048916 | Bacteria | 4432 |
| 127 | Ga0496114_0002462 | 3300048917 | Bacteria | 14131 |
| 128 | Ga0496114_0007515 | 3300048917 | Bacteria | 8620 |
| 129 | Ga0496115_0129484 | 3300048918 | Bacteria | 2080 |
| 130 | Ga0496117_0037995 | 3300048920 | Bacteria | 3578 |
| 131 | Ga0496119_0000715 | 3300048922 | Bacteria | 44620 |
| 132 | Ga0496119_0018401 | 3300048922 | Bacteria | 5201 |
| 133 | Ga0496122_0001549 | 3300048925 | Bacteria | 36461 |
| 134 | Ga0496125_0000025 | 3300048928 | Bacteria | 440074 |
| 135 | Ga0501032_0001429 | 3300049569 | Bacteria | 18968 |
| 136 | Ga0501034_0037361 | 3300049571 | Bacteria | 4917 |
| 137 | Ga0501034_0065080 | 3300049571 | Bacteria | 3658 |
| 138 | Ga0501036_0025327 | 3300049572 | Bacteria | 5005 |
| 139 | Ga0501038_0013811 | 3300049574 | Bacteria | 7359 |
| 140 | Ga0501039_0009915 | 3300049575 | Bacteria | 7263 |
| 141 | Ga0501043_0000927 | 3300049579 | Bacteria | 25968 |
| 142 | Ga0501043_0076753 | 3300049579 | Bacteria | 2625 |
| 143 | Ga0501046_0003372 | 3300049580 | Bacteria | 14666 |
| 144 | Ga0501070_0002157 | 3300049586 | Bacteria | 17300 |
| 145 | Ga0501070_0003468 | 3300049586 | Bacteria | 13673 |
| 146 | Ga0501072_0057996 | 3300049588 | Bacteria | 3052 |
| 147 | Ga0501073_0058233 | 3300049589 | Bacteria | 2700 |
| 148 | Ga0501073_0064225 | 3300049589 | Bacteria | 2560 |
| 149 | Ga0501074_0042144 | 3300049590 | Bacteria | 3303 |
| 150 | Ga0501077_0063731 | 3300049593 | Bacteria | 2338 |
| 151 | Ga0501080_0002388 | 3300049742 | Bacteria | 16380 |
| 152 | Ga0501044_0088807 | 3300049823 | Bacteria | 3120 |
| 153 | Ga0501044_0150911 | 3300049823 | Bacteria | 2306 |
| 154 | nmdc:mga00v17_5646_c1 | 3300050491 | Bacteria | 6600 |
| 155 | nmdc:mga05p37_5173_c1 | 3300050507 | Bacteria | 15299 |
| 156 | nmdc:mga05p37_68413_c1 | 3300050507 | Bacteria | 4367 |
| 157 | nmdc:mga09592_1336_c1 | 3300050508 | Bacteria | 19762 |
| 158 | nmdc:mga09592_90_c1 | 3300050508 | Bacteria | 54292 |
| 159 | nmdc:mga0qj67_22_c1 | 3300050509 | Bacteria | 28715 |
| 160 | nmdc:mga06r32_508_c1 | 3300050510 | Bacteria | 33514 |
| 161 | nmdc:mga06r32_667_c1 | 3300050510 | Bacteria | 29904 |
| 162 | nmdc:mga06r32_8213_c1 | 3300050510 | Bacteria | 9397 |
| 163 | nmdc:mga08y16_4997_c1 | 3300050511 | Bacteria | 13867 |
| 164 | nmdc:mga0sz30_3264_c1 | 3300050516 | Bacteria | 5119 |
| 165 | nmdc:mga0sz30_8607_c1 | 3300050516 | Bacteria | 3856 |
| 166 | Ga0495619_0051293 | 3300053085 | Bacteria | 2726 |
| 167 | Ga0530510_0116282 | 3300061734 | Bacteria | 1961 |
| 168 | 2644081128 | 2643221613 | Bacteria | 4622396 |
| 169 | 2644229422 | 2643221641 | Bacteria | 4490190 |
| 170 | 2644502584 | 2643221690 | Bacteria | 4654705 |
| 171 | 2644503515 | 2643221690 | Bacteria | 4654705 |
| 172 | 2644524969 | 2643221694 | Bacteria | 4392972 |
| 173 | 2644663560 | 2643221721 | Bacteria | 4486924 |
| 174 | 2644669055 | 2643221722 | Bacteria | 4247614 |
| 175 | 2739607052 | 2739367654 | Bacteria | 6049412 |
| 176 | 2760305046 | 2758568522 | Bacteria | 5953541 |
| 177 | 2808900515 | 2808606372 | Bacteria | 4649509 |
| 178 | 2809025925 | 2808606394 | Bacteria | 6248540 |
| 179 | 2812324249 | 2811994872 | Bacteria | 4121241 |
| 180 | 2812333056 | 2811994874 | Bacteria | 5367947 |
| 181 | 2812365295 | 2811994880 | Bacteria | 4147780 |
| 182 | 2883824723 | 2883821847 | Bacteria | 5121194 |
| 183 | 2884994851 | 2884994152 | Bacteria | 4492978 |
| 184 | 2891399267 | 2891395885 | Bacteria | 9251614 |
| 185 | 2919450220 | 2919446982 | Bacteria | 3994487 |
| 186 | 2932432581 | 2932431166 | Bacteria | 4215299 |
| 187 | 2935892706 | 2935890801 | Bacteria | 4593001 |
| 188 | Ga0501034_0153724 | |||
| 189 | JGI24737J22298_10005848 | |||
| 190 | JGI24751J29686_10005746 | |||
| 191 | Ga0070658_10000934 | |||
| 192 | Ga0070683_100137779 | |||
| 193 | Ga0070680_100001855 | |||
| 194 | Ga0070680_100023827 | |||
| 195 | Ga0070667_100017047 | |||
| 196 | Ga0070710_10000803 | |||
| 197 | Ga0070663_100095912 | |||
| 198 | Ga0070681_10002068 | |||
| 199 | Ga0070679_100033812 | |||
| 200 | Ga0070679_100067210 | |||
| 201 | Ga0070665_100003664 | |||
| 202 | Ga0068856_100006857 | |||
| 203 | Ga0068864_100020533 | |||
| 204 | Ga0068858_100057679 | |||
| 205 | Ga0068862_100087876 | |||
| 206 | Ga0081455_10006357 | |||
| 207 | Ga0075365_10069695 | |||
| 208 | Ga0075364_10000205 | |||
| 209 | Ga0075364_10020696 | |||
| 210 | Ga0075369_10000076 | |||
| 211 | Ga0075428_100006458 | |||
| 212 | Ga0075430_100032250 | |||
| 213 | Ga0075431_100011627 | |||
| 214 | Ga0075431_100031051 | |||
| 215 | Ga0075431_100033186 | |||
| 216 | Ga0075429_100000719 | |||
| 217 | Ga0075429_100022197 | |||
| 218 | Ga0105240_10018342 | |||
| 219 | Ga0105245_10066343 | |||
| 220 | Ga0114129_10001401 | |||
| 221 | Ga0105248_10050147 | |||
| 222 | Ga0105237_10003844 | |||
| 223 | Ga0105238_10089375 | |||
| 224 | Ga0157370_10024239 | |||
| 225 | Ga0157369_10009702 | |||
| 226 | Ga0157372_10196740 | |||
| 227 | Ga0163163_10006207 | |||
| 228 | Ga0163163_10013370 | |||
| 229 | Ga0157380_10151659 | |||
| 230 | Ga0157376_10009216 | |||
| 231 | Ga0206354_10325387 | |||
| 232 | Ga0206353_10056960 | |||
| 233 | Ga0206353_11325379 | |||
| 234 | Ga0207692_10001483 | |||
| 235 | Ga0207647_10006214 | |||
| 236 | Ga0207647_10008929 | |||
| 237 | Ga0207705_10014984 | |||
| 238 | Ga0207707_10015814 | |||
| 239 | Ga0207695_10043068 | |||
| 240 | Ga0207671_10011207 | |||
| 241 | Ga0207660_10006337 | |||
| 242 | Ga0207660_10019767 | |||
| 243 | Ga0207652_10005923 | |||
| 244 | Ga0207689_10052009 | |||
| 245 | Ga0207668_10096831 | |||
| 246 | Ga0207640_10053341 | |||
| 247 | Ga0207658_10037956 | |||
| 248 | Ga0207658_10047486 | |||
| 249 | Ga0207678_10031752 | |||
| 250 | Ga0207702_10014707 | |||
| 251 | Ga0207641_10012532 | |||
| 252 | Ga0207683_10108418 | |||
| 253 | Ga0207428_10005689 | |||
| 254 | Ga0268266_10003977 | |||
| 255 | Ga0307515_10000741 | |||
| 256 | Ga0307509_10092331 | |||
| 257 | Ga0307516_10001822 | |||
| 258 | Ga0307413_10031486 | |||
| 259 | Ga0307518_10021152 | |||
| 260 | Ga0307410_10007301 | |||
| 261 | Ga0307406_10020504 | |||
| 262 | Ga0307407_10023480 | |||
| 263 | Ga0307409_100007230 | |||
| 264 | Ga0307409_100011592 | |||
| 265 | Ga0307416_100037205 | |||
| 266 | Ga0307414_10030359 | |||
| 267 | Ga0307415_100004837 | |||
| 268 | Ga0373936_0002284 | |||
| 269 | Ga0395898_0002239 | |||
| 270 | Ga0395901_0019050 | |||
| 271 | Ga0395901_0032777 | |||
| 272 | Ga0395901_0075179 | |||
| 273 | Ga0451793_0571048 | |||
| 274 | Ga0439434_0009850 | |||
| 275 | Ga0466961_0015269 | |||
| 276 | Ga0466957_0016942 | |||
| 277 | Ga0466960_0003620 | |||
| 278 | Ga0466959_0033232 | |||
| 279 | Ga0466958_0013325 | |||
| 280 | Ga0466967_0159464 | |||
| 281 | Ga0495651_0034949 | |||
| 282 | Ga0495608_0030671 | |||
| 283 | Ga0495628_0071603 | |||
| 284 | Ga0495657_0011594 | |||
| 285 | Ga0495657_0038664 | |||
| 286 | Ga0495599_0037711 | |||
| 287 | Ga0495581_0042635 | |||
| 288 | Ga0495680_0004522 | |||
| 289 | Ga0495602_0028161 | |||
| 290 | Ga0496101_0017604 | |||
| 291 | Ga0496102_0007855 | |||
| 292 | Ga0496102_0132569 | |||
| 293 | Ga0496103_0012738 | |||
| 294 | Ga0496103_0037044 | |||
| 295 | Ga0496104_0025264 | |||
| 296 | Ga0496104_0135986 | |||
| 297 | Ga0496105_0009339 | |||
| 298 | Ga0496105_0087424 | |||
| 299 | Ga0496107_0039569 | |||
| 300 | Ga0496108_0000015 | |||
| 301 | Ga0496108_0015240 | |||
| 302 | Ga0496108_0053353 | |||
| 303 | Ga0496109_0003825 | |||
| 304 | Ga0496109_0035996 | |||
| 305 | Ga0496109_0045858 | |||
| 306 | Ga0496110_0021260 | |||
| 307 | Ga0496110_0059742 | |||
| 308 | Ga0496111_0010110 | |||
| 309 | Ga0496111_0010135 | |||
| 310 | Ga0496111_0078606 | |||
| 311 | Ga0496112_0021183 | |||
| 312 | Ga0496112_0057156 | |||
| 313 | Ga0496113_0022825 | |||
| 314 | Ga0496114_0002462 | |||
| 315 | Ga0496114_0007515 | |||
| 316 | Ga0496115_0129484 | |||
| 317 | Ga0496117_0037995 | |||
| 318 | Ga0496119_0000715 | |||
| 319 | Ga0496119_0018401 | |||
| 320 | Ga0496122_0001549 | |||
| 321 | Ga0496125_0000025 | |||
| 322 | Ga0501032_0001429 | |||
| 323 | Ga0501034_0037361 | |||
| 324 | Ga0501034_0065080 | |||
| 325 | Ga0501036_0025327 | |||
| 326 | Ga0501038_0013811 | |||
| 327 | Ga0501039_0009915 | |||
| 328 | Ga0501043_0000927 | |||
| 329 | Ga0501043_0076753 | |||
| 330 | Ga0501046_0003372 | |||
| 331 | Ga0501070_0002157 | |||
| 332 | Ga0501070_0003468 | |||
| 333 | Ga0501072_0057996 | |||
| 334 | Ga0501073_0058233 | |||
| 335 | Ga0501073_0064225 | |||
| 336 | Ga0501074_0042144 | |||
| 337 | Ga0501077_0063731 | |||
| 338 | Ga0501080_0002388 | |||
| 339 | Ga0501044_0088807 | |||
| 340 | Ga0501044_0150911 | |||
| 341 | nmdc:mga00v17_5646_c1 | |||
| 342 | nmdc:mga05p37_5173_c1 | |||
| 343 | nmdc:mga05p37_68413_c1 | |||
| 344 | nmdc:mga09592_1336_c1 | |||
| 345 | nmdc:mga09592_90_c1 | |||
| 346 | nmdc:mga0qj67_22_c1 | |||
| 347 | nmdc:mga06r32_508_c1 | |||
| 348 | nmdc:mga06r32_667_c1 | |||
| 349 | nmdc:mga06r32_8213_c1 | |||
| 350 | nmdc:mga08y16_4997_c1 | |||
| 351 | nmdc:mga0sz30_3264_c1 | |||
| 352 | nmdc:mga0sz30_8607_c1 | |||
| 353 | Ga0495619_0051293 | |||
| 354 | Ga0530510_0116282 | |||
| 355 | 2644081128 | |||
| 356 | 2644229422 | |||
| 357 | 2644502584 | |||
| 358 | 2644503515 | |||
| 359 | 2644524969 | |||
| 360 | 2644663560 | |||
| 361 | 2644669055 | |||
| 362 | 2739607052 | |||
| 363 | 2760305046 | |||
| 364 | 2808900515 | |||
| 365 | 2809025925 | |||
| 366 | 2812324249 | |||
| 367 | 2812333056 | |||
| 368 | 2812365295 | |||
| 369 | 2883824723 | |||
| 370 | 2884994851 | |||
| 371 | 2891399267 | |||
| 372 | 2919450220 | |||
| 373 | 2932432581 | |||
| 374 | 2935892706 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r27-assembly1.cif.gz_B | crystal structure of nargh complex | 0.7259 | 1 | 464 |
| 1r27-assembly1.cif.gz_B | crystal structure of nargh complex | 0.7232 | 1 | 464 |
| 1y4z-assembly1.cif.gz_B | the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol | 0.7133 | 1 | 488 |
| 3ir5-assembly1.cif.gz_B | crystal structure of narghi mutant narg-h49c | 0.7129 | 1 | 488 |
| 1y4z-assembly1.cif.gz_B | the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol | 0.6865 | 1 | 488 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1q16B03 | Mainly Alpha;Orthogonal Bundle;nitrate reductase domain fold;nitrate reductase domain like | 0.9182 | 381 | 435 | 1.10.3650.10 |
| af_P19318_241_361_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7489 | 240 | 359 | 3.30.70.20 |
| af_P19318_241_361_3.30.70.20 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7371 | 240 | 359 | 3.30.70.20 |
| af_I1JE37_3_93_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.7044 | 407 | 450 | 1.10.472.10 |
| 1q16B03 | Mainly Alpha;Orthogonal Bundle;nitrate reductase domain fold;nitrate reductase domain like | 0.6621 | 381 | 435 | 1.10.3650.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G5NC80-F1-model_v4 | Respiratory nitrate reductase alpha chain | 0.9637 | 266 | 331 |
GO:0009055
GO:0009061 GO:0016020 GO:0030313 GO:0046872 GO:0051539 |
| AF-A0A380DWX5-F1-model_v4 | Respiratory nitrate reductase beta chain (EC 1.7.99.4) | 0.9563 | 266 | 356 |
GO:0009055
GO:0009061 GO:0016020 GO:0016491 GO:0030313 GO:0046872 GO:0051539 |
| AF-A0A2S9GMJ6-F1-model_v4 | Nitrate reductase subunit beta | 0.9319 | 348 | 427 |
GO:0009055
GO:0009061 GO:0016020 GO:0030313 GO:0046872 GO:0051539 |
| AF-A0A4Q9VZ10-F1-model_v4 | Nitrate reductase subunit beta | 0.919 | 273 | 404 |
GO:0009055
GO:0009061 GO:0016020 GO:0030313 GO:0046872 GO:0051539 |
| AF-A0A2S9GMJ6-F1-model_v4 | Nitrate reductase subunit beta | 0.9104 | 348 | 427 |
GO:0009055
GO:0009061 GO:0016020 GO:0030313 GO:0046872 GO:0051539 |