F288339

General Info

Members Datasets Scaffolds Average Seq Length
187 146 374 552

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0153724|Ga0501034_0153724_679_2253
Length 524
Sequence VEYVWFNNVETRPGVGYPRGYEDQEKWGGGWVRTKRGRIKLRSGGRLAKLARIFSNPNLPGITDYYEPWTYDYDMLINAPRSAQTPVARPKSLLTGENMKISWSANWDDDLGGSLETMQQDPILTKMSEEVKAEFEKAFMFYLPRICEHCLNPSCVASCPSGAMYKRAEDGIVLVDQDQCRGWRMCVSGCPYKKVYFNHRTGKAEKCTFCYPRIEVGLPTVCSETCVGRLRYLGIVLYDADRVAEAASVEDDTALLQAQRDIILDPHDPAVIEAARAGDIPEDWIEAAQRSPIWKLMQYEVALPLHPEYRTMPMVWYIPPLSPVVDVVTGSGNDGEDARTLFAAIDKLRIPIGYLAELFTAGDVAPVDAALRRLAAMRSYMRGINIDDERDERIANAVGMSGAEIEEMYRLLAIAKYEERYVIPSAHTEQAHALEEMACSLDFEGGPGMGGAGPFGSSSGQSVPVAVENFHMLQNRQTADRPSSPGRMNLLNWDGNGTPEGLFPPSTMGEVRPTGRRKDGKDKE

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
87 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
114 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
128 2643221613 Oerskovia sp. Root22 Isolate Unclassified
129 2643221641 Nocardioides sp. Root122 Isolate Unclassified
130 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
131 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
132 2643221721 Oerskovia sp. Root918 Isolate Unclassified
133 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
134 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
135 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
136 2808606372 Agromyces sp. 23-23 Isolate Unclassified
137 2808606394 Promicromonospora sp. C35 Isolate Unclassified
138 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
139 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
140 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
141 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
142 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
143 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
144 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
145 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
146 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.7
Metatranscriptomes 1.6
Isolates 10.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 14.97
Rhizosphere 68.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0153724 3300049571 Bacteria 2276
2 JGI24737J22298_10005848 3300001990 Bacteria 4235
3 JGI24751J29686_10005746 3300002459 Bacteria 2529
4 Ga0070658_10000934 3300005327 Bacteria 25019
5 Ga0070683_100137779 3300005329 Bacteria 2312
6 Ga0070680_100001855 3300005336 Bacteria 15493
7 Ga0070680_100023827 3300005336 Bacteria 4885
8 Ga0070667_100017047 3300005367 Bacteria 6015
9 Ga0070710_10000803 3300005437 Bacteria 15077
10 Ga0070663_100095912 3300005455 Bacteria 2205
11 Ga0070681_10002068 3300005458 Bacteria 18207
12 Ga0070679_100033812 3300005530 Bacteria 5063
13 Ga0070679_100067210 3300005530 Bacteria 3574
14 Ga0070665_100003664 3300005548 Bacteria 16277
15 Ga0068856_100006857 3300005614 Bacteria 11140
16 Ga0068864_100020533 3300005618 Bacteria 5526
17 Ga0068858_100057679 3300005842 Bacteria 3589
18 Ga0068862_100087876 3300005844 Bacteria 2703
19 Ga0081455_10006357 3300005937 Bacteria 12682
20 Ga0075365_10069695 3300006038 Bacteria 2364
21 Ga0075364_10000205 3300006051 Bacteria 27728
22 Ga0075364_10020696 3300006051 Bacteria 4140
23 Ga0075369_10000076 3300006186 Bacteria 25607
24 Ga0075428_100006458 3300006844 Bacteria 13039
25 Ga0075430_100032250 3300006846 Bacteria 4448
26 Ga0075431_100011627 3300006847 Bacteria 8876
27 Ga0075431_100031051 3300006847 Bacteria 5503
28 Ga0075431_100033186 3300006847 Bacteria 5321
29 Ga0075429_100000719 3300006880 Bacteria 25935
30 Ga0075429_100022197 3300006880 Bacteria 5506
31 Ga0105240_10018342 3300009093 Bacteria 9402
32 Ga0105245_10066343 3300009098 Bacteria 3266
33 Ga0114129_10001401 3300009147 Bacteria 32515
34 Ga0105248_10050147 3300009177 Bacteria 4681
35 Ga0105237_10003844 3300009545 Bacteria 17655
36 Ga0105238_10089375 3300009551 Bacteria 3067
37 Ga0157370_10024239 3300013104 Bacteria 6011
38 Ga0157369_10009702 3300013105 Bacteria 11009
39 Ga0157372_10196740 3300013307 Bacteria 2335
40 Ga0163163_10006207 3300014325 Bacteria 10424
41 Ga0163163_10013370 3300014325 Bacteria 7513
42 Ga0157380_10151659 3300014326 Bacteria 2004
43 Ga0157376_10009216 3300014969 Bacteria 7161
44 Ga0206354_10325387 3300020081 Bacteria 2871
45 Ga0206353_10056960 3300020082 Bacteria 15189
46 Ga0206353_11325379 3300020082 Bacteria 13222
47 Ga0207692_10001483 3300025898 Bacteria 8801
48 Ga0207647_10006214 3300025904 Bacteria 8706
49 Ga0207647_10008929 3300025904 Bacteria 7149
50 Ga0207705_10014984 3300025909 Bacteria 5573
51 Ga0207707_10015814 3300025912 Bacteria 6579
52 Ga0207695_10043068 3300025913 Bacteria 4814
53 Ga0207671_10011207 3300025914 Bacteria 7317
54 Ga0207660_10006337 3300025917 Bacteria 7672
55 Ga0207660_10019767 3300025917 Bacteria 4509
56 Ga0207652_10005923 3300025921 Bacteria 9888
57 Ga0207689_10052009 3300025942 Bacteria 3376
58 Ga0207668_10096831 3300025972 Bacteria 2182
59 Ga0207640_10053341 3300025981 Bacteria 2639
60 Ga0207658_10037956 3300025986 Bacteria 3466
61 Ga0207658_10047486 3300025986 Bacteria 3142
62 Ga0207678_10031752 3300026067 Bacteria 4605
63 Ga0207702_10014707 3300026078 Bacteria 6493
64 Ga0207641_10012532 3300026088 Bacteria 6950
65 Ga0207683_10108418 3300026121 Bacteria 2485
66 Ga0207428_10005689 3300027907 Bacteria 11584
67 Ga0268266_10003977 3300028379 Bacteria 14336
68 Ga0307515_10000741 3300028794 Bacteria 75546
69 Ga0307509_10092331 3300031507 Bacteria 3095
70 Ga0307516_10001822 3300031730 Bacteria 29271
71 Ga0307413_10031486 3300031824 Bacteria 2994
72 Ga0307518_10021152 3300031838 Bacteria 4677
73 Ga0307410_10007301 3300031852 Bacteria 6038
74 Ga0307406_10020504 3300031901 Bacteria 3894
75 Ga0307407_10023480 3300031903 Bacteria 3219
76 Ga0307409_100007230 3300031995 Bacteria 6621
77 Ga0307409_100011592 3300031995 Bacteria 5570
78 Ga0307416_100037205 3300032002 Bacteria 3742
79 Ga0307414_10030359 3300032004 Bacteria 3530
80 Ga0307415_100004837 3300032126 Bacteria 7062
81 Ga0373936_0002284 3300035113 Bacteria 7176
82 Ga0395898_0002239 3300037466 Bacteria 23529
83 Ga0395901_0019050 3300038443 Bacteria 7017
84 Ga0395901_0032777 3300038443 Bacteria 5360
85 Ga0395901_0075179 3300038443 Bacteria 3524
86 Ga0451793_0571048 3300041452 Bacteria 6262
87 Ga0439434_0009850 3300042435 Bacteria 2812
88 Ga0466961_0015269 3300044693 Bacteria 4932
89 Ga0466957_0016942 3300044842 Bacteria 4264
90 Ga0466960_0003620 3300044901 Bacteria 5960
91 Ga0466959_0033232 3300045049 Bacteria 3816
92 Ga0466958_0013325 3300045836 Bacteria 4679
93 Ga0466967_0159464 3300045976 Bacteria 2116
94 Ga0495651_0034949 3300046462 Bacteria 3916
95 Ga0495608_0030671 3300046511 Bacteria 3639
96 Ga0495628_0071603 3300046516 Bacteria 2702
97 Ga0495657_0011594 3300046675 Bacteria 6587
98 Ga0495657_0038664 3300046675 Bacteria 3282
99 Ga0495599_0037711 3300046678 Bacteria 3036
100 Ga0495581_0042635 3300047315 Bacteria 2626
101 Ga0495680_0004522 3300047322 Bacteria 13286
102 Ga0495602_0028161 3300048088 Bacteria 5382
103 Ga0496101_0017604 3300048904 Bacteria 4848
104 Ga0496102_0007855 3300048905 Bacteria 9116
105 Ga0496102_0132569 3300048905 Bacteria 2333
106 Ga0496103_0012738 3300048906 Bacteria 4988
107 Ga0496103_0037044 3300048906 Bacteria 2989
108 Ga0496104_0025264 3300048907 Bacteria 5475
109 Ga0496104_0135986 3300048907 Bacteria 2361
110 Ga0496105_0009339 3300048908 Bacteria 7665
111 Ga0496105_0087424 3300048908 Bacteria 2575
112 Ga0496107_0039569 3300048910 Bacteria 3382
113 Ga0496108_0000015 3300048911 Bacteria 243282
114 Ga0496108_0015240 3300048911 Bacteria 6272
115 Ga0496108_0053353 3300048911 Bacteria 3390
116 Ga0496109_0003825 3300048912 Bacteria 12574
117 Ga0496109_0035996 3300048912 Bacteria 4468
118 Ga0496109_0045858 3300048912 Bacteria 3968
119 Ga0496110_0021260 3300048913 Bacteria 5490
120 Ga0496110_0059742 3300048913 Bacteria 3361
121 Ga0496111_0010110 3300048914 Bacteria 6317
122 Ga0496111_0010135 3300048914 Bacteria 6309
123 Ga0496111_0078606 3300048914 Bacteria 2406
124 Ga0496112_0021183 3300048915 Bacteria 6178
125 Ga0496112_0057156 3300048915 Bacteria 3840
126 Ga0496113_0022825 3300048916 Bacteria 4432
127 Ga0496114_0002462 3300048917 Bacteria 14131
128 Ga0496114_0007515 3300048917 Bacteria 8620
129 Ga0496115_0129484 3300048918 Bacteria 2080
130 Ga0496117_0037995 3300048920 Bacteria 3578
131 Ga0496119_0000715 3300048922 Bacteria 44620
132 Ga0496119_0018401 3300048922 Bacteria 5201
133 Ga0496122_0001549 3300048925 Bacteria 36461
134 Ga0496125_0000025 3300048928 Bacteria 440074
135 Ga0501032_0001429 3300049569 Bacteria 18968
136 Ga0501034_0037361 3300049571 Bacteria 4917
137 Ga0501034_0065080 3300049571 Bacteria 3658
138 Ga0501036_0025327 3300049572 Bacteria 5005
139 Ga0501038_0013811 3300049574 Bacteria 7359
140 Ga0501039_0009915 3300049575 Bacteria 7263
141 Ga0501043_0000927 3300049579 Bacteria 25968
142 Ga0501043_0076753 3300049579 Bacteria 2625
143 Ga0501046_0003372 3300049580 Bacteria 14666
144 Ga0501070_0002157 3300049586 Bacteria 17300
145 Ga0501070_0003468 3300049586 Bacteria 13673
146 Ga0501072_0057996 3300049588 Bacteria 3052
147 Ga0501073_0058233 3300049589 Bacteria 2700
148 Ga0501073_0064225 3300049589 Bacteria 2560
149 Ga0501074_0042144 3300049590 Bacteria 3303
150 Ga0501077_0063731 3300049593 Bacteria 2338
151 Ga0501080_0002388 3300049742 Bacteria 16380
152 Ga0501044_0088807 3300049823 Bacteria 3120
153 Ga0501044_0150911 3300049823 Bacteria 2306
154 nmdc:mga00v17_5646_c1 3300050491 Bacteria 6600
155 nmdc:mga05p37_5173_c1 3300050507 Bacteria 15299
156 nmdc:mga05p37_68413_c1 3300050507 Bacteria 4367
157 nmdc:mga09592_1336_c1 3300050508 Bacteria 19762
158 nmdc:mga09592_90_c1 3300050508 Bacteria 54292
159 nmdc:mga0qj67_22_c1 3300050509 Bacteria 28715
160 nmdc:mga06r32_508_c1 3300050510 Bacteria 33514
161 nmdc:mga06r32_667_c1 3300050510 Bacteria 29904
162 nmdc:mga06r32_8213_c1 3300050510 Bacteria 9397
163 nmdc:mga08y16_4997_c1 3300050511 Bacteria 13867
164 nmdc:mga0sz30_3264_c1 3300050516 Bacteria 5119
165 nmdc:mga0sz30_8607_c1 3300050516 Bacteria 3856
166 Ga0495619_0051293 3300053085 Bacteria 2726
167 Ga0530510_0116282 3300061734 Bacteria 1961
168 2644081128 2643221613 Bacteria 4622396
169 2644229422 2643221641 Bacteria 4490190
170 2644502584 2643221690 Bacteria 4654705
171 2644503515 2643221690 Bacteria 4654705
172 2644524969 2643221694 Bacteria 4392972
173 2644663560 2643221721 Bacteria 4486924
174 2644669055 2643221722 Bacteria 4247614
175 2739607052 2739367654 Bacteria 6049412
176 2760305046 2758568522 Bacteria 5953541
177 2808900515 2808606372 Bacteria 4649509
178 2809025925 2808606394 Bacteria 6248540
179 2812324249 2811994872 Bacteria 4121241
180 2812333056 2811994874 Bacteria 5367947
181 2812365295 2811994880 Bacteria 4147780
182 2883824723 2883821847 Bacteria 5121194
183 2884994851 2884994152 Bacteria 4492978
184 2891399267 2891395885 Bacteria 9251614
185 2919450220 2919446982 Bacteria 3994487
186 2932432581 2932431166 Bacteria 4215299
187 2935892706 2935890801 Bacteria 4593001
188 Ga0501034_0153724
189 JGI24737J22298_10005848
190 JGI24751J29686_10005746
191 Ga0070658_10000934
192 Ga0070683_100137779
193 Ga0070680_100001855
194 Ga0070680_100023827
195 Ga0070667_100017047
196 Ga0070710_10000803
197 Ga0070663_100095912
198 Ga0070681_10002068
199 Ga0070679_100033812
200 Ga0070679_100067210
201 Ga0070665_100003664
202 Ga0068856_100006857
203 Ga0068864_100020533
204 Ga0068858_100057679
205 Ga0068862_100087876
206 Ga0081455_10006357
207 Ga0075365_10069695
208 Ga0075364_10000205
209 Ga0075364_10020696
210 Ga0075369_10000076
211 Ga0075428_100006458
212 Ga0075430_100032250
213 Ga0075431_100011627
214 Ga0075431_100031051
215 Ga0075431_100033186
216 Ga0075429_100000719
217 Ga0075429_100022197
218 Ga0105240_10018342
219 Ga0105245_10066343
220 Ga0114129_10001401
221 Ga0105248_10050147
222 Ga0105237_10003844
223 Ga0105238_10089375
224 Ga0157370_10024239
225 Ga0157369_10009702
226 Ga0157372_10196740
227 Ga0163163_10006207
228 Ga0163163_10013370
229 Ga0157380_10151659
230 Ga0157376_10009216
231 Ga0206354_10325387
232 Ga0206353_10056960
233 Ga0206353_11325379
234 Ga0207692_10001483
235 Ga0207647_10006214
236 Ga0207647_10008929
237 Ga0207705_10014984
238 Ga0207707_10015814
239 Ga0207695_10043068
240 Ga0207671_10011207
241 Ga0207660_10006337
242 Ga0207660_10019767
243 Ga0207652_10005923
244 Ga0207689_10052009
245 Ga0207668_10096831
246 Ga0207640_10053341
247 Ga0207658_10037956
248 Ga0207658_10047486
249 Ga0207678_10031752
250 Ga0207702_10014707
251 Ga0207641_10012532
252 Ga0207683_10108418
253 Ga0207428_10005689
254 Ga0268266_10003977
255 Ga0307515_10000741
256 Ga0307509_10092331
257 Ga0307516_10001822
258 Ga0307413_10031486
259 Ga0307518_10021152
260 Ga0307410_10007301
261 Ga0307406_10020504
262 Ga0307407_10023480
263 Ga0307409_100007230
264 Ga0307409_100011592
265 Ga0307416_100037205
266 Ga0307414_10030359
267 Ga0307415_100004837
268 Ga0373936_0002284
269 Ga0395898_0002239
270 Ga0395901_0019050
271 Ga0395901_0032777
272 Ga0395901_0075179
273 Ga0451793_0571048
274 Ga0439434_0009850
275 Ga0466961_0015269
276 Ga0466957_0016942
277 Ga0466960_0003620
278 Ga0466959_0033232
279 Ga0466958_0013325
280 Ga0466967_0159464
281 Ga0495651_0034949
282 Ga0495608_0030671
283 Ga0495628_0071603
284 Ga0495657_0011594
285 Ga0495657_0038664
286 Ga0495599_0037711
287 Ga0495581_0042635
288 Ga0495680_0004522
289 Ga0495602_0028161
290 Ga0496101_0017604
291 Ga0496102_0007855
292 Ga0496102_0132569
293 Ga0496103_0012738
294 Ga0496103_0037044
295 Ga0496104_0025264
296 Ga0496104_0135986
297 Ga0496105_0009339
298 Ga0496105_0087424
299 Ga0496107_0039569
300 Ga0496108_0000015
301 Ga0496108_0015240
302 Ga0496108_0053353
303 Ga0496109_0003825
304 Ga0496109_0035996
305 Ga0496109_0045858
306 Ga0496110_0021260
307 Ga0496110_0059742
308 Ga0496111_0010110
309 Ga0496111_0010135
310 Ga0496111_0078606
311 Ga0496112_0021183
312 Ga0496112_0057156
313 Ga0496113_0022825
314 Ga0496114_0002462
315 Ga0496114_0007515
316 Ga0496115_0129484
317 Ga0496117_0037995
318 Ga0496119_0000715
319 Ga0496119_0018401
320 Ga0496122_0001549
321 Ga0496125_0000025
322 Ga0501032_0001429
323 Ga0501034_0037361
324 Ga0501034_0065080
325 Ga0501036_0025327
326 Ga0501038_0013811
327 Ga0501039_0009915
328 Ga0501043_0000927
329 Ga0501043_0076753
330 Ga0501046_0003372
331 Ga0501070_0002157
332 Ga0501070_0003468
333 Ga0501072_0057996
334 Ga0501073_0058233
335 Ga0501073_0064225
336 Ga0501074_0042144
337 Ga0501077_0063731
338 Ga0501080_0002388
339 Ga0501044_0088807
340 Ga0501044_0150911
341 nmdc:mga00v17_5646_c1
342 nmdc:mga05p37_5173_c1
343 nmdc:mga05p37_68413_c1
344 nmdc:mga09592_1336_c1
345 nmdc:mga09592_90_c1
346 nmdc:mga0qj67_22_c1
347 nmdc:mga06r32_508_c1
348 nmdc:mga06r32_667_c1
349 nmdc:mga06r32_8213_c1
350 nmdc:mga08y16_4997_c1
351 nmdc:mga0sz30_3264_c1
352 nmdc:mga0sz30_8607_c1
353 Ga0495619_0051293
354 Ga0530510_0116282
355 2644081128
356 2644229422
357 2644502584
358 2644503515
359 2644524969
360 2644663560
361 2644669055
362 2739607052
363 2760305046
364 2808900515
365 2809025925
366 2812324249
367 2812333056
368 2812365295
369 2883824723
370 2884994851
371 2891399267
372 2919450220
373 2932432581
374 2935892706

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13247

Fer4_11

4Fe-4S dicluster domain

138

236

0.98

PF14711

Nitr_red_bet_C

Respiratory nitrate reductase beta C-terminal

321

402

0.98

PF13237

Fer4_10

4Fe-4S dicluster domain

139

191

0.95

PF12838

Fer4_7

4Fe-4S dicluster domain

129

194

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r27-assembly1.cif.gz_B crystal structure of nargh complex 0.7259 1 464
1r27-assembly1.cif.gz_B crystal structure of nargh complex 0.7232 1 464
1y4z-assembly1.cif.gz_B the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol 0.7133 1 488
3ir5-assembly1.cif.gz_B crystal structure of narghi mutant narg-h49c 0.7129 1 488
1y4z-assembly1.cif.gz_B the crystal structure of nitrate reductase a, narghi, in complex with the q-site inhibitor pentachlorophenol 0.6865 1 488
ID Description Score Start End Superfamily
1q16B03 Mainly Alpha;Orthogonal Bundle;nitrate reductase domain fold;nitrate reductase domain like 0.9182 381 435 1.10.3650.10
af_P19318_241_361_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7489 240 359 3.30.70.20
af_P19318_241_361_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7371 240 359 3.30.70.20
af_I1JE37_3_93_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.7044 407 450 1.10.472.10
1q16B03 Mainly Alpha;Orthogonal Bundle;nitrate reductase domain fold;nitrate reductase domain like 0.6621 381 435 1.10.3650.10
ID Description Score Start End GO Terms
AF-G5NC80-F1-model_v4 Respiratory nitrate reductase alpha chain 0.9637 266 331 GO:0009055
GO:0009061
GO:0016020
GO:0030313
GO:0046872
GO:0051539
AF-A0A380DWX5-F1-model_v4 Respiratory nitrate reductase beta chain (EC 1.7.99.4) 0.9563 266 356 GO:0009055
GO:0009061
GO:0016020
GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A2S9GMJ6-F1-model_v4 Nitrate reductase subunit beta 0.9319 348 427 GO:0009055
GO:0009061
GO:0016020
GO:0030313
GO:0046872
GO:0051539
AF-A0A4Q9VZ10-F1-model_v4 Nitrate reductase subunit beta 0.919 273 404 GO:0009055
GO:0009061
GO:0016020
GO:0030313
GO:0046872
GO:0051539
AF-A0A2S9GMJ6-F1-model_v4 Nitrate reductase subunit beta 0.9104 348 427 GO:0009055
GO:0009061
GO:0016020
GO:0030313
GO:0046872
GO:0051539

Map