F288249
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 187 | 157 | 374 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300047444|Ga0495675_0255229|Ga0495675_0255229_159_827 |
| Length | 222 |
| Sequence | MVVLGRFASARQNAESQGEERNLAQLDFWYDFASTYSYLAASRCSPLAEAAGVKLRWRPFLLGPIFAAQGWTTSPFNLFPAKGRNMWRDMERLCAARGLPLQQPKPFPQNSLLAARLALAVPDDLRPDFSLAVFRAEFGEGRSLSDEGVLSECLASLGLPAAEFLQKAKSDPVRVLLREETETAQKLGLFGAPSFVTPDGEIFWGDDRLEQALEWAKGAATR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 18 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 21 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 25 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 26 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 27 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 28 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 31 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 32 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 36 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 39 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 42 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 43 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 55 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 56 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 57 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 58 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 59 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 60 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 62 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 63 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 64 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 65 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 66 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 67 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 68 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 69 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 70 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 71 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 72 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 73 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 74 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 75 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 76 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 77 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 78 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 79 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 80 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 81 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 82 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 83 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 84 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 85 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 86 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 87 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 88 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 89 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 90 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 91 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 92 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 95 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 96 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 98 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 99 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 100 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 101 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 102 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 103 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 104 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 105 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 106 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 123 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 125 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 126 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 127 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 128 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 129 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 132 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 133 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 134 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 137 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 138 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 139 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 140 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 141 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 142 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 143 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 144 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 145 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 146 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 147 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 148 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 149 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 150 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 151 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 152 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 153 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 154 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 155 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 156 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 157 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.24 |
| Metatranscriptomes | 0.53 |
| Isolates | 11.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.04 |
| Nodule | 3.21 |
| Rhizoplane | 6.95 |
| Rhizosphere | 62.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495675_0255229 | 3300047444 | Bacteria | 1052 |
| 2 | JGI25151J46595_10000090 | 3300003187 | Bacteria | 123141 |
| 3 | JGI25151J46595_10000701 | 3300003187 | Bacteria | 28057 |
| 4 | JGI25151J46595_10053809 | 3300003187 | Bacteria | 1341 |
| 5 | Ga0006562J51391_1039108 | 3300003578 | Bacteria | 1462 |
| 6 | Ga0055526_1009412 | 3300003771 | Bacteria | 4702 |
| 7 | Ga0055524_1000011 | 3300003775 | Bacteria | 261442 |
| 8 | Ga0065165_1000150 | 3300005262 | Bacteria | 121992 |
| 9 | Ga0070676_10105541 | 3300005328 | Bacteria | 1747 |
| 10 | Ga0070689_100316223 | 3300005340 | Bacteria | 1303 |
| 11 | Ga0070668_100233723 | 3300005347 | Bacteria | 1521 |
| 12 | Ga0070667_100124127 | 3300005367 | Bacteria | 2249 |
| 13 | Ga0070709_10083614 | 3300005434 | Bacteria | 2088 |
| 14 | Ga0070709_10240649 | 3300005434 | Bacteria | 1299 |
| 15 | Ga0070711_100121768 | 3300005439 | Bacteria | 1931 |
| 16 | Ga0070662_100112215 | 3300005457 | Bacteria | 2078 |
| 17 | Ga0068867_100704597 | 3300005459 | Bacteria | 891 |
| 18 | Ga0070707_100044727 | 3300005468 | Bacteria | 4238 |
| 19 | Ga0070696_100506874 | 3300005546 | Bacteria | 961 |
| 20 | Ga0068859_101080794 | 3300005617 | Bacteria | 882 |
| 21 | Ga0068861_100515269 | 3300005719 | Bacteria | 1084 |
| 22 | Ga0068861_100657478 | 3300005719 | Bacteria | 969 |
| 23 | Ga0068860_100011068 | 3300005843 | Bacteria | 8895 |
| 24 | Ga0068862_100856263 | 3300005844 | Bacteria | 891 |
| 25 | Ga0081455_10158826 | 3300005937 | Bacteria | 1735 |
| 26 | Ga0081539_10043141 | 3300005985 | Bacteria | 2618 |
| 27 | Ga0070712_100606173 | 3300006175 | Bacteria | 927 |
| 28 | Ga0075362_10013333 | 3300006177 | Bacteria | 3289 |
| 29 | Ga0075367_10026444 | 3300006178 | Bacteria | 3292 |
| 30 | Ga0075369_10096483 | 3300006186 | Bacteria | 1323 |
| 31 | Ga0075366_10063042 | 3300006195 | Bacteria | 2203 |
| 32 | Ga0075370_10107407 | 3300006353 | Bacteria | 1619 |
| 33 | Ga0075430_100160725 | 3300006846 | Bacteria | 1870 |
| 34 | Ga0075433_10066164 | 3300006852 | Bacteria | 3171 |
| 35 | Ga0068865_100823619 | 3300006881 | Bacteria | 802 |
| 36 | Ga0097620_101080893 | 3300006931 | Bacteria | 882 |
| 37 | Ga0099795_10101728 | 3300007788 | Bacteria | 1128 |
| 38 | Ga0111539_10128388 | 3300009094 | Bacteria | 2970 |
| 39 | Ga0171462_1015 | 3300013250 | Bacteria | 169578 |
| 40 | Ga0163162_10350851 | 3300013306 | Bacteria | 1608 |
| 41 | Ga0209130_1000187 | 3300025284 | Bacteria | 87082 |
| 42 | Ga0209675_1000438 | 3300025291 | Bacteria | 32911 |
| 43 | Ga0209676_1021077 | 3300025292 | Bacteria | 2197 |
| 44 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 45 | Ga0209025_1002910 | 3300025294 | Bacteria | 17082 |
| 46 | Ga0209025_1018393 | 3300025294 | Bacteria | 3963 |
| 47 | Ga0209564_1000019 | 3300025295 | Bacteria | 573686 |
| 48 | Ga0209564_1000143 | 3300025295 | Bacteria | 177136 |
| 49 | Ga0209256_1000111 | 3300025299 | Bacteria | 178442 |
| 50 | Ga0207426_1011956 | 3300025302 | Bacteria | 3281 |
| 51 | Ga0207645_10040768 | 3300025907 | Bacteria | 2973 |
| 52 | Ga0207705_10018155 | 3300025909 | Bacteria | 5029 |
| 53 | Ga0207693_10236058 | 3300025915 | Bacteria | 1436 |
| 54 | Ga0207693_10425864 | 3300025915 | Bacteria | 1037 |
| 55 | Ga0207646_10035277 | 3300025922 | Bacteria | 4518 |
| 56 | Ga0207706_10051812 | 3300025933 | Bacteria | 3624 |
| 57 | Ga0207667_10011334 | 3300025949 | Bacteria | 10367 |
| 58 | Ga0207668_10152759 | 3300025972 | Bacteria | 1789 |
| 59 | Ga0207702_10079838 | 3300026078 | Bacteria | 2837 |
| 60 | Ga0207674_10233287 | 3300026116 | Bacteria | 1788 |
| 61 | Ga0268264_10006189 | 3300028381 | Bacteria | 10110 |
| 62 | Ga0268264_10269653 | 3300028381 | Bacteria | 1590 |
| 63 | Ga0265332_10001254 | 3300031238 | Bacteria | 14610 |
| 64 | Ga0265325_10171739 | 3300031241 | Bacteria | 1014 |
| 65 | Ga0265329_10028541 | 3300031242 | Bacteria | 1829 |
| 66 | Ga0265340_10013373 | 3300031247 | Bacteria | 4309 |
| 67 | Ga0265339_10003862 | 3300031249 | Bacteria | 10402 |
| 68 | Ga0265331_10130894 | 3300031250 | Bacteria | 1144 |
| 69 | Ga0265313_10128064 | 3300031595 | Bacteria | 1102 |
| 70 | Ga0316575_10054549 | 3300031665 | Bacteria | 1592 |
| 71 | Ga0316579_10218173 | 3300031691 | Bacteria | 922 |
| 72 | Ga0265314_10134140 | 3300031711 | Bacteria | 1540 |
| 73 | Ga0265342_10004862 | 3300031712 | Bacteria | 10406 |
| 74 | Ga0316576_10048486 | 3300031727 | Bacteria | 3081 |
| 75 | Ga0316578_10171091 | 3300031728 | Bacteria | 1309 |
| 76 | Ga0373961_0168617 | 3300035241 | Bacteria | 756 |
| 77 | Ga0316574_0000639 | 3300035398 | Bacteria | 14688 |
| 78 | Ga0373927_0222277 | 3300035695 | Bacteria | 1240 |
| 79 | Ga0316582_0244721 | 3300036647 | Bacteria | 1229 |
| 80 | Ga0316584_0088943 | 3300036712 | Bacteria | 2312 |
| 81 | Ga0373925_0073612 | 3300037068 | Bacteria | 2586 |
| 82 | Ga0395899_0026347 | 3300037312 | Bacteria | 4387 |
| 83 | Ga0395899_0047092 | 3300037312 | Bacteria | 3210 |
| 84 | Ga0395900_0014309 | 3300037418 | Bacteria | 8098 |
| 85 | Ga0395900_0066998 | 3300037418 | Bacteria | 3689 |
| 86 | Ga0395898_0020681 | 3300037466 | Bacteria | 6681 |
| 87 | Ga0395898_0227178 | 3300037466 | Bacteria | 1780 |
| 88 | Ga0436364_0297114 | 3300037853 | Bacteria | 2767 |
| 89 | Ga0395901_0024876 | 3300038443 | Bacteria | 6146 |
| 90 | Ga0436360_1248842 | 3300039438 | Bacteria | 1014 |
| 91 | Ga0436363_0935528 | 3300039450 | Bacteria | 1713 |
| 92 | Ga0436363_1413887 | 3300039450 | Bacteria | 780 |
| 93 | Ga0451797_1002739 | 3300041453 | Bacteria | 876 |
| 94 | Ga0466969_0056257 | 3300044656 | Bacteria | 1921 |
| 95 | Ga0466966_0012147 | 3300044684 | Bacteria | 5705 |
| 96 | Ga0466963_0039501 | 3300044694 | Bacteria | 3090 |
| 97 | Ga0466968_0012822 | 3300044735 | Bacteria | 3288 |
| 98 | Ga0466970_0420220 | 3300044765 | Bacteria | 764 |
| 99 | Ga0466957_0416963 | 3300044842 | Bacteria | 920 |
| 100 | Ga0466960_0099946 | 3300044901 | Bacteria | 1492 |
| 101 | Ga0466960_0443748 | 3300044901 | Bacteria | 753 |
| 102 | Ga0466959_0002839 | 3300045049 | Bacteria | 11158 |
| 103 | Ga0451576_0017719 | 3300045051 | Bacteria | 7826 |
| 104 | Ga0466958_0053666 | 3300045836 | Bacteria | 2444 |
| 105 | Ga0466967_0003202 | 3300045976 | Bacteria | 10566 |
| 106 | Ga0466967_0037348 | 3300045976 | Bacteria | 4155 |
| 107 | Ga0495667_0193807 | 3300046559 | Bacteria | 1302 |
| 108 | Ga0495670_0077243 | 3300046691 | Bacteria | 1693 |
| 109 | Ga0496104_0000042 | 3300048907 | Bacteria | 155859 |
| 110 | Ga0496104_0011008 | 3300048907 | Bacteria | 8092 |
| 111 | Ga0496104_0115079 | 3300048907 | Bacteria | 2580 |
| 112 | Ga0496105_0000076 | 3300048908 | Bacteria | 74954 |
| 113 | Ga0496105_0000543 | 3300048908 | Bacteria | 24893 |
| 114 | Ga0496105_0008504 | 3300048908 | Bacteria | 7973 |
| 115 | Ga0496108_0201147 | 3300048911 | Bacteria | 1729 |
| 116 | Ga0496109_1005053 | 3300048912 | Bacteria | 772 |
| 117 | Ga0496110_0022870 | 3300048913 | Bacteria | 5312 |
| 118 | Ga0496112_0006353 | 3300048915 | Bacteria | 10371 |
| 119 | Ga0496113_0224163 | 3300048916 | Bacteria | 1498 |
| 120 | Ga0496115_0121839 | 3300048918 | Bacteria | 2146 |
| 121 | Ga0496119_0083090 | 3300048922 | Bacteria | 1840 |
| 122 | Ga0496122_0087176 | 3300048925 | Bacteria | 2145 |
| 123 | Ga0496122_0394516 | 3300048925 | Bacteria | 705 |
| 124 | Ga0496124_0042107 | 3300048927 | Bacteria | 3934 |
| 125 | Ga0496125_0047880 | 3300048928 | Bacteria | 3570 |
| 126 | Ga0496125_0057192 | 3300048928 | Bacteria | 3161 |
| 127 | Ga0501033_0051111 | 3300049570 | Bacteria | 3064 |
| 128 | Ga0501033_0603625 | 3300049570 | Bacteria | 752 |
| 129 | Ga0501034_0374117 | 3300049571 | Bacteria | 1350 |
| 130 | Ga0501036_0160727 | 3300049572 | Bacteria | 1894 |
| 131 | Ga0501037_0086639 | 3300049573 | Bacteria | 2267 |
| 132 | Ga0501040_0099768 | 3300049576 | Bacteria | 2024 |
| 133 | Ga0501042_0257903 | 3300049578 | Unclassified | 1258 |
| 134 | Ga0501046_0157647 | 3300049580 | Unclassified | 1709 |
| 135 | Ga0501048_0303701 | 3300049582 | Bacteria | 1136 |
| 136 | Ga0501067_0077674 | 3300049583 | Bacteria | 1840 |
| 137 | Ga0501070_0135558 | 3300049586 | Bacteria | 2033 |
| 138 | Ga0501072_0107069 | 3300049588 | Bacteria | 2224 |
| 139 | Ga0501072_0768105 | 3300049588 | Bacteria | 756 |
| 140 | Ga0501074_0151494 | 3300049590 | Bacteria | 1657 |
| 141 | Ga0501074_0244344 | 3300049590 | Bacteria | 1276 |
| 142 | Ga0501076_0026352 | 3300049592 | Bacteria | 4502 |
| 143 | Ga0501076_0199956 | 3300049592 | Bacteria | 1632 |
| 144 | Ga0501077_0034333 | 3300049593 | Bacteria | 3228 |
| 145 | Ga0501079_0024568 | 3300049741 | Bacteria | 4624 |
| 146 | Ga0501080_0028860 | 3300049742 | Bacteria | 5165 |
| 147 | Ga0501080_0460417 | 3300049742 | Bacteria | 1139 |
| 148 | Ga0501080_0867103 | 3300049742 | Bacteria | 788 |
| 149 | Ga0501081_0236045 | 3300049743 | Bacteria | 1333 |
| 150 | Ga0501035_0359478 | 3300049822 | Bacteria | 1217 |
| 151 | nmdc:mga03683_58530_c2 | 3300050489 | Bacteria | 1159 |
| 152 | nmdc:mga03n38_13381_c1 | 3300050490 | Bacteria | 3115 |
| 153 | nmdc:mga00v17_130597_c1 | 3300050491 | Bacteria | 1605 |
| 154 | nmdc:mga0k408_24948_c1 | 3300050493 | Bacteria | 3383 |
| 155 | nmdc:mga07m45_375730_c1 | 3300050496 | Bacteria | 825 |
| 156 | nmdc:mga06r32_326610_c1 | 3300050510 | Bacteria | 1519 |
| 157 | nmdc:mga06r32_79886_c1 | 3300050510 | Bacteria | 3182 |
| 158 | nmdc:mga08y16_1091510_c1 | 3300050511 | Bacteria | 773 |
| 159 | nmdc:mga0sz30_104335_c1 | 3300050516 | Bacteria | 1239 |
| 160 | nmdc:mga0sz30_277904_c1 | 3300050516 | Bacteria | 746 |
| 161 | Ga0500627_0268507 | 3300053158 | Bacteria | 751 |
| 162 | Ga0500636_0017160 | 3300053177 | Bacteria | 4271 |
| 163 | Ga0501084_0049157 | 3300054114 | Bacteria | 3530 |
| 164 | Ga0501082_0100299 | 3300060353 | Bacteria | 2504 |
| 165 | Ga0501082_1243244 | 3300060353 | Bacteria | 651 |
| 166 | Ga0466962_0034900 | 3300061719 | Bacteria | 2409 |
| 167 | 2596371694 | 2595698237 | Bacteria | 6712432 |
| 168 | 2643758184 | 2643221547 | Bacteria | 4740017 |
| 169 | 2644730846 | 2643221733 | Bacteria | 5690728 |
| 170 | 2644736057 | 2643221734 | Bacteria | 5365412 |
| 171 | 2644742629 | 2643221736 | Bacteria | 6608466 |
| 172 | 2739356476 | 2738543032 | Bacteria | 5115625 |
| 173 | 2819722063 | 2818991467 | Bacteria | 5893227 |
| 174 | 2828309221 | 2828305725 | Bacteria | 4916900 |
| 175 | 2840879903 | 2840878972 | Bacteria | 5483153 |
| 176 | 2841764042 | 2841760612 | Bacteria | 6454112 |
| 177 | 2841915556 | 2841911363 | Bacteria | 6173697 |
| 178 | 2841920758 | 2841917233 | Bacteria | 6173500 |
| 179 | 2844108503 | 2844104063 | Bacteria | 6440972 |
| 180 | 2851185280 | 2851182111 | Bacteria | 6047226 |
| 181 | 2851250477 | 2851246043 | Bacteria | 6439203 |
| 182 | 2889307168 | 2889306138 | Bacteria | 6358934 |
| 183 | 2891635029 | 2891633521 | Bacteria | 4602265 |
| 184 | 2902336862 | 2902330777 | Bacteria | 6395352 |
| 185 | 2902411134 | 2902405164 | Bacteria | 6784948 |
| 186 | 2917701927 | 2917699015 | Bacteria | 7043791 |
| 187 | 2928127953 | 2928125067 | Bacteria | 5937560 |
| 188 | Ga0495675_0255229 | |||
| 189 | JGI25151J46595_10000090 | |||
| 190 | JGI25151J46595_10000701 | |||
| 191 | JGI25151J46595_10053809 | |||
| 192 | Ga0006562J51391_1039108 | |||
| 193 | Ga0055526_1009412 | |||
| 194 | Ga0055524_1000011 | |||
| 195 | Ga0065165_1000150 | |||
| 196 | Ga0070676_10105541 | |||
| 197 | Ga0070689_100316223 | |||
| 198 | Ga0070668_100233723 | |||
| 199 | Ga0070667_100124127 | |||
| 200 | Ga0070709_10083614 | |||
| 201 | Ga0070709_10240649 | |||
| 202 | Ga0070711_100121768 | |||
| 203 | Ga0070662_100112215 | |||
| 204 | Ga0068867_100704597 | |||
| 205 | Ga0070707_100044727 | |||
| 206 | Ga0070696_100506874 | |||
| 207 | Ga0068859_101080794 | |||
| 208 | Ga0068861_100515269 | |||
| 209 | Ga0068861_100657478 | |||
| 210 | Ga0068860_100011068 | |||
| 211 | Ga0068862_100856263 | |||
| 212 | Ga0081455_10158826 | |||
| 213 | Ga0081539_10043141 | |||
| 214 | Ga0070712_100606173 | |||
| 215 | Ga0075362_10013333 | |||
| 216 | Ga0075367_10026444 | |||
| 217 | Ga0075369_10096483 | |||
| 218 | Ga0075366_10063042 | |||
| 219 | Ga0075370_10107407 | |||
| 220 | Ga0075430_100160725 | |||
| 221 | Ga0075433_10066164 | |||
| 222 | Ga0068865_100823619 | |||
| 223 | Ga0097620_101080893 | |||
| 224 | Ga0099795_10101728 | |||
| 225 | Ga0111539_10128388 | |||
| 226 | Ga0171462_1015 | |||
| 227 | Ga0163162_10350851 | |||
| 228 | Ga0209130_1000187 | |||
| 229 | Ga0209675_1000438 | |||
| 230 | Ga0209676_1021077 | |||
| 231 | Ga0209025_1000010 | |||
| 232 | Ga0209025_1002910 | |||
| 233 | Ga0209025_1018393 | |||
| 234 | Ga0209564_1000019 | |||
| 235 | Ga0209564_1000143 | |||
| 236 | Ga0209256_1000111 | |||
| 237 | Ga0207426_1011956 | |||
| 238 | Ga0207645_10040768 | |||
| 239 | Ga0207705_10018155 | |||
| 240 | Ga0207693_10236058 | |||
| 241 | Ga0207693_10425864 | |||
| 242 | Ga0207646_10035277 | |||
| 243 | Ga0207706_10051812 | |||
| 244 | Ga0207667_10011334 | |||
| 245 | Ga0207668_10152759 | |||
| 246 | Ga0207702_10079838 | |||
| 247 | Ga0207674_10233287 | |||
| 248 | Ga0268264_10006189 | |||
| 249 | Ga0268264_10269653 | |||
| 250 | Ga0265332_10001254 | |||
| 251 | Ga0265325_10171739 | |||
| 252 | Ga0265329_10028541 | |||
| 253 | Ga0265340_10013373 | |||
| 254 | Ga0265339_10003862 | |||
| 255 | Ga0265331_10130894 | |||
| 256 | Ga0265313_10128064 | |||
| 257 | Ga0316575_10054549 | |||
| 258 | Ga0316579_10218173 | |||
| 259 | Ga0265314_10134140 | |||
| 260 | Ga0265342_10004862 | |||
| 261 | Ga0316576_10048486 | |||
| 262 | Ga0316578_10171091 | |||
| 263 | Ga0373961_0168617 | |||
| 264 | Ga0316574_0000639 | |||
| 265 | Ga0373927_0222277 | |||
| 266 | Ga0316582_0244721 | |||
| 267 | Ga0316584_0088943 | |||
| 268 | Ga0373925_0073612 | |||
| 269 | Ga0395899_0026347 | |||
| 270 | Ga0395899_0047092 | |||
| 271 | Ga0395900_0014309 | |||
| 272 | Ga0395900_0066998 | |||
| 273 | Ga0395898_0020681 | |||
| 274 | Ga0395898_0227178 | |||
| 275 | Ga0436364_0297114 | |||
| 276 | Ga0395901_0024876 | |||
| 277 | Ga0436360_1248842 | |||
| 278 | Ga0436363_0935528 | |||
| 279 | Ga0436363_1413887 | |||
| 280 | Ga0451797_1002739 | |||
| 281 | Ga0466969_0056257 | |||
| 282 | Ga0466966_0012147 | |||
| 283 | Ga0466963_0039501 | |||
| 284 | Ga0466968_0012822 | |||
| 285 | Ga0466970_0420220 | |||
| 286 | Ga0466957_0416963 | |||
| 287 | Ga0466960_0099946 | |||
| 288 | Ga0466960_0443748 | |||
| 289 | Ga0466959_0002839 | |||
| 290 | Ga0451576_0017719 | |||
| 291 | Ga0466958_0053666 | |||
| 292 | Ga0466967_0003202 | |||
| 293 | Ga0466967_0037348 | |||
| 294 | Ga0495667_0193807 | |||
| 295 | Ga0495670_0077243 | |||
| 296 | Ga0496104_0000042 | |||
| 297 | Ga0496104_0011008 | |||
| 298 | Ga0496104_0115079 | |||
| 299 | Ga0496105_0000076 | |||
| 300 | Ga0496105_0000543 | |||
| 301 | Ga0496105_0008504 | |||
| 302 | Ga0496108_0201147 | |||
| 303 | Ga0496109_1005053 | |||
| 304 | Ga0496110_0022870 | |||
| 305 | Ga0496112_0006353 | |||
| 306 | Ga0496113_0224163 | |||
| 307 | Ga0496115_0121839 | |||
| 308 | Ga0496119_0083090 | |||
| 309 | Ga0496122_0087176 | |||
| 310 | Ga0496122_0394516 | |||
| 311 | Ga0496124_0042107 | |||
| 312 | Ga0496125_0047880 | |||
| 313 | Ga0496125_0057192 | |||
| 314 | Ga0501033_0051111 | |||
| 315 | Ga0501033_0603625 | |||
| 316 | Ga0501034_0374117 | |||
| 317 | Ga0501036_0160727 | |||
| 318 | Ga0501037_0086639 | |||
| 319 | Ga0501040_0099768 | |||
| 320 | Ga0501042_0257903 | |||
| 321 | Ga0501046_0157647 | |||
| 322 | Ga0501048_0303701 | |||
| 323 | Ga0501067_0077674 | |||
| 324 | Ga0501070_0135558 | |||
| 325 | Ga0501072_0107069 | |||
| 326 | Ga0501072_0768105 | |||
| 327 | Ga0501074_0151494 | |||
| 328 | Ga0501074_0244344 | |||
| 329 | Ga0501076_0026352 | |||
| 330 | Ga0501076_0199956 | |||
| 331 | Ga0501077_0034333 | |||
| 332 | Ga0501079_0024568 | |||
| 333 | Ga0501080_0028860 | |||
| 334 | Ga0501080_0460417 | |||
| 335 | Ga0501080_0867103 | |||
| 336 | Ga0501081_0236045 | |||
| 337 | Ga0501035_0359478 | |||
| 338 | nmdc:mga03683_58530_c2 | |||
| 339 | nmdc:mga03n38_13381_c1 | |||
| 340 | nmdc:mga00v17_130597_c1 | |||
| 341 | nmdc:mga0k408_24948_c1 | |||
| 342 | nmdc:mga07m45_375730_c1 | |||
| 343 | nmdc:mga06r32_326610_c1 | |||
| 344 | nmdc:mga06r32_79886_c1 | |||
| 345 | nmdc:mga08y16_1091510_c1 | |||
| 346 | nmdc:mga0sz30_104335_c1 | |||
| 347 | nmdc:mga0sz30_277904_c1 | |||
| 348 | Ga0500627_0268507 | |||
| 349 | Ga0500636_0017160 | |||
| 350 | Ga0501084_0049157 | |||
| 351 | Ga0501082_0100299 | |||
| 352 | Ga0501082_1243244 | |||
| 353 | Ga0466962_0034900 | |||
| 354 | 2596371694 | |||
| 355 | 2643758184 | |||
| 356 | 2644730846 | |||
| 357 | 2644736057 | |||
| 358 | 2644742629 | |||
| 359 | 2739356476 | |||
| 360 | 2819722063 | |||
| 361 | 2828309221 | |||
| 362 | 2840879903 | |||
| 363 | 2841764042 | |||
| 364 | 2841915556 | |||
| 365 | 2841920758 | |||
| 366 | 2844108503 | |||
| 367 | 2851185280 | |||
| 368 | 2851250477 | |||
| 369 | 2889307168 | |||
| 370 | 2891635029 | |||
| 371 | 2902336862 | |||
| 372 | 2902411134 | |||
| 373 | 2917701927 | |||
| 374 | 2928127953 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2imd-assembly1.cif.gz_A | structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) | 0.9078 | 6 | 201 |
| 3fz5-assembly2.cif.gz_D | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.8989 | 7 | 201 |
| 3rpn-assembly3.cif.gz_F | crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione | 0.873 | 1 | 198 |
| 3fz5-assembly1.cif.gz_A | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.8726 | 5 | 201 |
| 3fz5-assembly2.cif.gz_D | crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides | 0.8718 | 7 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q18973_4_212_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8983 | 4 | 198 | 3.40.30.10 |
| af_Q09652_5_211_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8955 | 5 | 199 | 3.40.30.10 |
| 3fz5D00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8952 | 7 | 201 | 3.40.30.10 |
| 2imdA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8733 | 8 | 201 | 3.40.30.10 |
| 3fz5D00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8721 | 7 | 201 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E1UYL2-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9847 | 1 | 202 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A1E3GWM7-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9834 | 7 | 200 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |
| AF-A0A831YM22-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9799 | 7 | 180 |
GO:0003995
GO:0018845 GO:0050660 GO:1901170 |
| AF-A0A2W4RQN2-F1-model_v4 | Disulfide bond formation protein DsbA | 0.979 | 5 | 193 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |
| AF-W3RLB5-F1-model_v4 | 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) | 0.9778 | 1 | 200 |
GO:0004364
GO:0004602 GO:0005777 GO:0006749 GO:0018845 GO:1901170 |