F288249

General Info

Members Datasets Scaffolds Average Seq Length
187 157 374 201

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0255229|Ga0495675_0255229_159_827
Length 222
Sequence MVVLGRFASARQNAESQGEERNLAQLDFWYDFASTYSYLAASRCSPLAEAAGVKLRWRPFLLGPIFAAQGWTTSPFNLFPAKGRNMWRDMERLCAARGLPLQQPKPFPQNSLLAARLALAVPDDLRPDFSLAVFRAEFGEGRSLSDEGVLSECLASLGLPAAEFLQKAKSDPVRVLLREETETAQKLGLFGAPSFVTPDGEIFWGDDRLEQALEWAKGAATR

Samples

Sample ID Description Type Environment
1 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
38 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
62 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
77 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
125 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
132 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
133 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
138 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
139 2643221733 Bosea sp. Root381 Isolate Unclassified
140 2643221734 Bosea sp. Root670 Isolate Unclassified
141 2643221736 Bosea sp. Root483D1 Isolate Unclassified
142 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
143 2818991467 Bosea vestrisii 3192 Isolate Unclassified
144 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
145 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
146 2841760612 Bosea sp. Tri-49 Isolate Nodule
147 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
148 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
149 2844104063 Bosea sp. Tri-39 Isolate Nodule
150 2851182111 Bosea sp. Tri-44 Isolate Nodule
151 2851246043 Bosea sp. Tri-54 Isolate Nodule
152 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
153 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
154 2902330777 Methylobacterium sp. 2A Isolate Unclassified
155 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
156 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
157 2928125067 Methylobacterium sp. 1973 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.24
Metatranscriptomes 0.53
Isolates 11.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.04
Nodule 3.21
Rhizoplane 6.95
Rhizosphere 62.57
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495675_0255229 3300047444 Bacteria 1052
2 JGI25151J46595_10000090 3300003187 Bacteria 123141
3 JGI25151J46595_10000701 3300003187 Bacteria 28057
4 JGI25151J46595_10053809 3300003187 Bacteria 1341
5 Ga0006562J51391_1039108 3300003578 Bacteria 1462
6 Ga0055526_1009412 3300003771 Bacteria 4702
7 Ga0055524_1000011 3300003775 Bacteria 261442
8 Ga0065165_1000150 3300005262 Bacteria 121992
9 Ga0070676_10105541 3300005328 Bacteria 1747
10 Ga0070689_100316223 3300005340 Bacteria 1303
11 Ga0070668_100233723 3300005347 Bacteria 1521
12 Ga0070667_100124127 3300005367 Bacteria 2249
13 Ga0070709_10083614 3300005434 Bacteria 2088
14 Ga0070709_10240649 3300005434 Bacteria 1299
15 Ga0070711_100121768 3300005439 Bacteria 1931
16 Ga0070662_100112215 3300005457 Bacteria 2078
17 Ga0068867_100704597 3300005459 Bacteria 891
18 Ga0070707_100044727 3300005468 Bacteria 4238
19 Ga0070696_100506874 3300005546 Bacteria 961
20 Ga0068859_101080794 3300005617 Bacteria 882
21 Ga0068861_100515269 3300005719 Bacteria 1084
22 Ga0068861_100657478 3300005719 Bacteria 969
23 Ga0068860_100011068 3300005843 Bacteria 8895
24 Ga0068862_100856263 3300005844 Bacteria 891
25 Ga0081455_10158826 3300005937 Bacteria 1735
26 Ga0081539_10043141 3300005985 Bacteria 2618
27 Ga0070712_100606173 3300006175 Bacteria 927
28 Ga0075362_10013333 3300006177 Bacteria 3289
29 Ga0075367_10026444 3300006178 Bacteria 3292
30 Ga0075369_10096483 3300006186 Bacteria 1323
31 Ga0075366_10063042 3300006195 Bacteria 2203
32 Ga0075370_10107407 3300006353 Bacteria 1619
33 Ga0075430_100160725 3300006846 Bacteria 1870
34 Ga0075433_10066164 3300006852 Bacteria 3171
35 Ga0068865_100823619 3300006881 Bacteria 802
36 Ga0097620_101080893 3300006931 Bacteria 882
37 Ga0099795_10101728 3300007788 Bacteria 1128
38 Ga0111539_10128388 3300009094 Bacteria 2970
39 Ga0171462_1015 3300013250 Bacteria 169578
40 Ga0163162_10350851 3300013306 Bacteria 1608
41 Ga0209130_1000187 3300025284 Bacteria 87082
42 Ga0209675_1000438 3300025291 Bacteria 32911
43 Ga0209676_1021077 3300025292 Bacteria 2197
44 Ga0209025_1000010 3300025294 Bacteria 986612
45 Ga0209025_1002910 3300025294 Bacteria 17082
46 Ga0209025_1018393 3300025294 Bacteria 3963
47 Ga0209564_1000019 3300025295 Bacteria 573686
48 Ga0209564_1000143 3300025295 Bacteria 177136
49 Ga0209256_1000111 3300025299 Bacteria 178442
50 Ga0207426_1011956 3300025302 Bacteria 3281
51 Ga0207645_10040768 3300025907 Bacteria 2973
52 Ga0207705_10018155 3300025909 Bacteria 5029
53 Ga0207693_10236058 3300025915 Bacteria 1436
54 Ga0207693_10425864 3300025915 Bacteria 1037
55 Ga0207646_10035277 3300025922 Bacteria 4518
56 Ga0207706_10051812 3300025933 Bacteria 3624
57 Ga0207667_10011334 3300025949 Bacteria 10367
58 Ga0207668_10152759 3300025972 Bacteria 1789
59 Ga0207702_10079838 3300026078 Bacteria 2837
60 Ga0207674_10233287 3300026116 Bacteria 1788
61 Ga0268264_10006189 3300028381 Bacteria 10110
62 Ga0268264_10269653 3300028381 Bacteria 1590
63 Ga0265332_10001254 3300031238 Bacteria 14610
64 Ga0265325_10171739 3300031241 Bacteria 1014
65 Ga0265329_10028541 3300031242 Bacteria 1829
66 Ga0265340_10013373 3300031247 Bacteria 4309
67 Ga0265339_10003862 3300031249 Bacteria 10402
68 Ga0265331_10130894 3300031250 Bacteria 1144
69 Ga0265313_10128064 3300031595 Bacteria 1102
70 Ga0316575_10054549 3300031665 Bacteria 1592
71 Ga0316579_10218173 3300031691 Bacteria 922
72 Ga0265314_10134140 3300031711 Bacteria 1540
73 Ga0265342_10004862 3300031712 Bacteria 10406
74 Ga0316576_10048486 3300031727 Bacteria 3081
75 Ga0316578_10171091 3300031728 Bacteria 1309
76 Ga0373961_0168617 3300035241 Bacteria 756
77 Ga0316574_0000639 3300035398 Bacteria 14688
78 Ga0373927_0222277 3300035695 Bacteria 1240
79 Ga0316582_0244721 3300036647 Bacteria 1229
80 Ga0316584_0088943 3300036712 Bacteria 2312
81 Ga0373925_0073612 3300037068 Bacteria 2586
82 Ga0395899_0026347 3300037312 Bacteria 4387
83 Ga0395899_0047092 3300037312 Bacteria 3210
84 Ga0395900_0014309 3300037418 Bacteria 8098
85 Ga0395900_0066998 3300037418 Bacteria 3689
86 Ga0395898_0020681 3300037466 Bacteria 6681
87 Ga0395898_0227178 3300037466 Bacteria 1780
88 Ga0436364_0297114 3300037853 Bacteria 2767
89 Ga0395901_0024876 3300038443 Bacteria 6146
90 Ga0436360_1248842 3300039438 Bacteria 1014
91 Ga0436363_0935528 3300039450 Bacteria 1713
92 Ga0436363_1413887 3300039450 Bacteria 780
93 Ga0451797_1002739 3300041453 Bacteria 876
94 Ga0466969_0056257 3300044656 Bacteria 1921
95 Ga0466966_0012147 3300044684 Bacteria 5705
96 Ga0466963_0039501 3300044694 Bacteria 3090
97 Ga0466968_0012822 3300044735 Bacteria 3288
98 Ga0466970_0420220 3300044765 Bacteria 764
99 Ga0466957_0416963 3300044842 Bacteria 920
100 Ga0466960_0099946 3300044901 Bacteria 1492
101 Ga0466960_0443748 3300044901 Bacteria 753
102 Ga0466959_0002839 3300045049 Bacteria 11158
103 Ga0451576_0017719 3300045051 Bacteria 7826
104 Ga0466958_0053666 3300045836 Bacteria 2444
105 Ga0466967_0003202 3300045976 Bacteria 10566
106 Ga0466967_0037348 3300045976 Bacteria 4155
107 Ga0495667_0193807 3300046559 Bacteria 1302
108 Ga0495670_0077243 3300046691 Bacteria 1693
109 Ga0496104_0000042 3300048907 Bacteria 155859
110 Ga0496104_0011008 3300048907 Bacteria 8092
111 Ga0496104_0115079 3300048907 Bacteria 2580
112 Ga0496105_0000076 3300048908 Bacteria 74954
113 Ga0496105_0000543 3300048908 Bacteria 24893
114 Ga0496105_0008504 3300048908 Bacteria 7973
115 Ga0496108_0201147 3300048911 Bacteria 1729
116 Ga0496109_1005053 3300048912 Bacteria 772
117 Ga0496110_0022870 3300048913 Bacteria 5312
118 Ga0496112_0006353 3300048915 Bacteria 10371
119 Ga0496113_0224163 3300048916 Bacteria 1498
120 Ga0496115_0121839 3300048918 Bacteria 2146
121 Ga0496119_0083090 3300048922 Bacteria 1840
122 Ga0496122_0087176 3300048925 Bacteria 2145
123 Ga0496122_0394516 3300048925 Bacteria 705
124 Ga0496124_0042107 3300048927 Bacteria 3934
125 Ga0496125_0047880 3300048928 Bacteria 3570
126 Ga0496125_0057192 3300048928 Bacteria 3161
127 Ga0501033_0051111 3300049570 Bacteria 3064
128 Ga0501033_0603625 3300049570 Bacteria 752
129 Ga0501034_0374117 3300049571 Bacteria 1350
130 Ga0501036_0160727 3300049572 Bacteria 1894
131 Ga0501037_0086639 3300049573 Bacteria 2267
132 Ga0501040_0099768 3300049576 Bacteria 2024
133 Ga0501042_0257903 3300049578 Unclassified 1258
134 Ga0501046_0157647 3300049580 Unclassified 1709
135 Ga0501048_0303701 3300049582 Bacteria 1136
136 Ga0501067_0077674 3300049583 Bacteria 1840
137 Ga0501070_0135558 3300049586 Bacteria 2033
138 Ga0501072_0107069 3300049588 Bacteria 2224
139 Ga0501072_0768105 3300049588 Bacteria 756
140 Ga0501074_0151494 3300049590 Bacteria 1657
141 Ga0501074_0244344 3300049590 Bacteria 1276
142 Ga0501076_0026352 3300049592 Bacteria 4502
143 Ga0501076_0199956 3300049592 Bacteria 1632
144 Ga0501077_0034333 3300049593 Bacteria 3228
145 Ga0501079_0024568 3300049741 Bacteria 4624
146 Ga0501080_0028860 3300049742 Bacteria 5165
147 Ga0501080_0460417 3300049742 Bacteria 1139
148 Ga0501080_0867103 3300049742 Bacteria 788
149 Ga0501081_0236045 3300049743 Bacteria 1333
150 Ga0501035_0359478 3300049822 Bacteria 1217
151 nmdc:mga03683_58530_c2 3300050489 Bacteria 1159
152 nmdc:mga03n38_13381_c1 3300050490 Bacteria 3115
153 nmdc:mga00v17_130597_c1 3300050491 Bacteria 1605
154 nmdc:mga0k408_24948_c1 3300050493 Bacteria 3383
155 nmdc:mga07m45_375730_c1 3300050496 Bacteria 825
156 nmdc:mga06r32_326610_c1 3300050510 Bacteria 1519
157 nmdc:mga06r32_79886_c1 3300050510 Bacteria 3182
158 nmdc:mga08y16_1091510_c1 3300050511 Bacteria 773
159 nmdc:mga0sz30_104335_c1 3300050516 Bacteria 1239
160 nmdc:mga0sz30_277904_c1 3300050516 Bacteria 746
161 Ga0500627_0268507 3300053158 Bacteria 751
162 Ga0500636_0017160 3300053177 Bacteria 4271
163 Ga0501084_0049157 3300054114 Bacteria 3530
164 Ga0501082_0100299 3300060353 Bacteria 2504
165 Ga0501082_1243244 3300060353 Bacteria 651
166 Ga0466962_0034900 3300061719 Bacteria 2409
167 2596371694 2595698237 Bacteria 6712432
168 2643758184 2643221547 Bacteria 4740017
169 2644730846 2643221733 Bacteria 5690728
170 2644736057 2643221734 Bacteria 5365412
171 2644742629 2643221736 Bacteria 6608466
172 2739356476 2738543032 Bacteria 5115625
173 2819722063 2818991467 Bacteria 5893227
174 2828309221 2828305725 Bacteria 4916900
175 2840879903 2840878972 Bacteria 5483153
176 2841764042 2841760612 Bacteria 6454112
177 2841915556 2841911363 Bacteria 6173697
178 2841920758 2841917233 Bacteria 6173500
179 2844108503 2844104063 Bacteria 6440972
180 2851185280 2851182111 Bacteria 6047226
181 2851250477 2851246043 Bacteria 6439203
182 2889307168 2889306138 Bacteria 6358934
183 2891635029 2891633521 Bacteria 4602265
184 2902336862 2902330777 Bacteria 6395352
185 2902411134 2902405164 Bacteria 6784948
186 2917701927 2917699015 Bacteria 7043791
187 2928127953 2928125067 Bacteria 5937560
188 Ga0495675_0255229
189 JGI25151J46595_10000090
190 JGI25151J46595_10000701
191 JGI25151J46595_10053809
192 Ga0006562J51391_1039108
193 Ga0055526_1009412
194 Ga0055524_1000011
195 Ga0065165_1000150
196 Ga0070676_10105541
197 Ga0070689_100316223
198 Ga0070668_100233723
199 Ga0070667_100124127
200 Ga0070709_10083614
201 Ga0070709_10240649
202 Ga0070711_100121768
203 Ga0070662_100112215
204 Ga0068867_100704597
205 Ga0070707_100044727
206 Ga0070696_100506874
207 Ga0068859_101080794
208 Ga0068861_100515269
209 Ga0068861_100657478
210 Ga0068860_100011068
211 Ga0068862_100856263
212 Ga0081455_10158826
213 Ga0081539_10043141
214 Ga0070712_100606173
215 Ga0075362_10013333
216 Ga0075367_10026444
217 Ga0075369_10096483
218 Ga0075366_10063042
219 Ga0075370_10107407
220 Ga0075430_100160725
221 Ga0075433_10066164
222 Ga0068865_100823619
223 Ga0097620_101080893
224 Ga0099795_10101728
225 Ga0111539_10128388
226 Ga0171462_1015
227 Ga0163162_10350851
228 Ga0209130_1000187
229 Ga0209675_1000438
230 Ga0209676_1021077
231 Ga0209025_1000010
232 Ga0209025_1002910
233 Ga0209025_1018393
234 Ga0209564_1000019
235 Ga0209564_1000143
236 Ga0209256_1000111
237 Ga0207426_1011956
238 Ga0207645_10040768
239 Ga0207705_10018155
240 Ga0207693_10236058
241 Ga0207693_10425864
242 Ga0207646_10035277
243 Ga0207706_10051812
244 Ga0207667_10011334
245 Ga0207668_10152759
246 Ga0207702_10079838
247 Ga0207674_10233287
248 Ga0268264_10006189
249 Ga0268264_10269653
250 Ga0265332_10001254
251 Ga0265325_10171739
252 Ga0265329_10028541
253 Ga0265340_10013373
254 Ga0265339_10003862
255 Ga0265331_10130894
256 Ga0265313_10128064
257 Ga0316575_10054549
258 Ga0316579_10218173
259 Ga0265314_10134140
260 Ga0265342_10004862
261 Ga0316576_10048486
262 Ga0316578_10171091
263 Ga0373961_0168617
264 Ga0316574_0000639
265 Ga0373927_0222277
266 Ga0316582_0244721
267 Ga0316584_0088943
268 Ga0373925_0073612
269 Ga0395899_0026347
270 Ga0395899_0047092
271 Ga0395900_0014309
272 Ga0395900_0066998
273 Ga0395898_0020681
274 Ga0395898_0227178
275 Ga0436364_0297114
276 Ga0395901_0024876
277 Ga0436360_1248842
278 Ga0436363_0935528
279 Ga0436363_1413887
280 Ga0451797_1002739
281 Ga0466969_0056257
282 Ga0466966_0012147
283 Ga0466963_0039501
284 Ga0466968_0012822
285 Ga0466970_0420220
286 Ga0466957_0416963
287 Ga0466960_0099946
288 Ga0466960_0443748
289 Ga0466959_0002839
290 Ga0451576_0017719
291 Ga0466958_0053666
292 Ga0466967_0003202
293 Ga0466967_0037348
294 Ga0495667_0193807
295 Ga0495670_0077243
296 Ga0496104_0000042
297 Ga0496104_0011008
298 Ga0496104_0115079
299 Ga0496105_0000076
300 Ga0496105_0000543
301 Ga0496105_0008504
302 Ga0496108_0201147
303 Ga0496109_1005053
304 Ga0496110_0022870
305 Ga0496112_0006353
306 Ga0496113_0224163
307 Ga0496115_0121839
308 Ga0496119_0083090
309 Ga0496122_0087176
310 Ga0496122_0394516
311 Ga0496124_0042107
312 Ga0496125_0047880
313 Ga0496125_0057192
314 Ga0501033_0051111
315 Ga0501033_0603625
316 Ga0501034_0374117
317 Ga0501036_0160727
318 Ga0501037_0086639
319 Ga0501040_0099768
320 Ga0501042_0257903
321 Ga0501046_0157647
322 Ga0501048_0303701
323 Ga0501067_0077674
324 Ga0501070_0135558
325 Ga0501072_0107069
326 Ga0501072_0768105
327 Ga0501074_0151494
328 Ga0501074_0244344
329 Ga0501076_0026352
330 Ga0501076_0199956
331 Ga0501077_0034333
332 Ga0501079_0024568
333 Ga0501080_0028860
334 Ga0501080_0460417
335 Ga0501080_0867103
336 Ga0501081_0236045
337 Ga0501035_0359478
338 nmdc:mga03683_58530_c2
339 nmdc:mga03n38_13381_c1
340 nmdc:mga00v17_130597_c1
341 nmdc:mga0k408_24948_c1
342 nmdc:mga07m45_375730_c1
343 nmdc:mga06r32_326610_c1
344 nmdc:mga06r32_79886_c1
345 nmdc:mga08y16_1091510_c1
346 nmdc:mga0sz30_104335_c1
347 nmdc:mga0sz30_277904_c1
348 Ga0500627_0268507
349 Ga0500636_0017160
350 Ga0501084_0049157
351 Ga0501082_0100299
352 Ga0501082_1243244
353 Ga0466962_0034900
354 2596371694
355 2643758184
356 2644730846
357 2644736057
358 2644742629
359 2739356476
360 2819722063
361 2828309221
362 2840879903
363 2841764042
364 2841915556
365 2841920758
366 2844108503
367 2851185280
368 2851250477
369 2889307168
370 2891635029
371 2902336862
372 2902411134
373 2917701927
374 2928127953

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

25

215

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imd-assembly1.cif.gz_A structure of semet 2-hydroxychromene-2-carboxylate isomerase (hcca isomerase) 0.9078 6 201
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8989 7 201
3rpn-assembly3.cif.gz_F crystal structure of human kappa class glutathione transferase in complex with s-hexylglutathione 0.873 1 198
3fz5-assembly1.cif.gz_A crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8726 5 201
3fz5-assembly2.cif.gz_D crystal structure of possible 2-hydroxychromene-2-carboxylate isomerase from rhodobacter sphaeroides 0.8718 7 201
ID Description Score Start End Superfamily
af_Q18973_4_212_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8983 4 198 3.40.30.10
af_Q09652_5_211_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8955 5 199 3.40.30.10
3fz5D00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8952 7 201 3.40.30.10
2imdA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8733 8 201 3.40.30.10
3fz5D00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8721 7 201 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1E1UYL2-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9847 1 202 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-A0A1E3GWM7-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9834 7 200 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-A0A831YM22-F1-model_v4 Acyl-CoA dehydrogenase 0.9799 7 180 GO:0003995
GO:0018845
GO:0050660
GO:1901170
AF-A0A2W4RQN2-F1-model_v4 Disulfide bond formation protein DsbA 0.979 5 193 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170
AF-W3RLB5-F1-model_v4 2-hydroxychromene-2-carboxylate isomerase (EC 5.99.1.4) 0.9778 1 200 GO:0004364
GO:0004602
GO:0005777
GO:0006749
GO:0018845
GO:1901170

Map