F287623

General Info

Members Datasets Scaffolds Average Seq Length
187 129 181 265

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10630816|Ga0105238_106308162
Length 268
Sequence MPVTTANGIEIYYERAGSGPPLLFISGTGGDLRTKPNVFDGPLPKRFEVLAYDQRGLGRTEKPDVAYRMADYADDAAALMADQGWDEANVIGVSFGGMVAQELVLRHPERVKRLVLACTSPGGAGGASYPFHDIQHLAGEARAEFLLPISDTRRDAAWAQANPDQHRVFVAMAAAPPPGAGEPGHEMGARRQLEARARHDTWDRLPDIACPVLIAAGRYDGIALPATQERMATRIPGAKLQVFEGGHLFMIQDRTAYPAMVEFLQAEP

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
6 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 0
Isolates 3.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.95
Nodule 0.53
Rhizoplane 6.42
Rhizosphere 81.28
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10001456 3300003791 Bacteria 17252
2 Ga0055531_10014732 3300003794 Bacteria 3501
3 Ga0065165_1000210 3300005262 Bacteria 101721
4 Ga0070658_10261851 3300005327 Bacteria 1469
5 Ga0070658_10554696 3300005327 Bacteria 994
6 Ga0070691_10000039 3300005341 Bacteria 37443
7 Ga0070671_100171023 3300005355 Bacteria 1838
8 Ga0070659_100001044 3300005366 Bacteria 20232
9 Ga0070678_100036798 3300005456 Bacteria 3430
10 Ga0070681_10018656 3300005458 Bacteria 6938
11 Ga0070699_100148365 3300005518 Bacteria 2073
12 Ga0070684_100116766 3300005535 Bacteria 2397
13 Ga0068853_100009799 3300005539 Bacteria 7731
14 Ga0068853_100211572 3300005539 Bacteria 1768
15 Ga0068853_100368086 3300005539 Bacteria 1340
16 Ga0070665_100000121 3300005548 Bacteria 147683
17 Ga0070665_100221386 3300005548 Bacteria 1893
18 Ga0068855_100029068 3300005563 Bacteria 6610
19 Ga0068855_100159975 3300005563 Bacteria 2557
20 Ga0068855_100202472 3300005563 Bacteria 2234
21 Ga0070664_100083797 3300005564 Bacteria 2751
22 Ga0068857_100000667 3300005577 Bacteria 25406
23 Ga0068856_100000142 3300005614 Bacteria 72931
24 Ga0068856_100003091 3300005614 Bacteria 16990
25 Ga0068852_100023098 3300005616 Bacteria 4999
26 Ga0068852_100352661 3300005616 Unclassified 1437
27 Ga0068863_100063540 3300005841 Bacteria 3491
28 Ga0068858_100044145 3300005842 Bacteria 4133
29 Ga0068862_100192911 3300005844 Bacteria 1834
30 Ga0081455_10320554 3300005937 Bacteria 1104
31 Ga0075363_100225209 3300006048 Bacteria 1075
32 Ga0070712_100000015 3300006175 Bacteria 106593
33 Ga0070712_100003947 3300006175 Bacteria 9125
34 Ga0075434_100022092 3300006871 Bacteria 6196
35 Ga0068865_100001515 3300006881 Bacteria 13546
36 Ga0075436_100000024 3300006914 Bacteria 115057
37 Ga0075436_100006793 3300006914 Bacteria 7831
38 Ga0105240_10000769 3300009093 Bacteria 58249
39 Ga0105240_10006742 3300009093 Bacteria 16815
40 Ga0105240_10055646 3300009093 Bacteria 4953
41 Ga0105240_10128452 3300009093 Bacteria 3043
42 Ga0105240_10324836 3300009093 Bacteria 1753
43 Ga0105245_10531372 3300009098 Bacteria 1196
44 Ga0105248_10001413 3300009177 Bacteria 26833
45 Ga0105237_10008109 3300009545 Bacteria 11410
46 Ga0105238_10001297 3300009551 Bacteria 25139
47 Ga0105238_10221674 3300009551 Bacteria 1867
48 Ga0105238_10266468 3300009551 Bacteria 1693
49 Ga0105238_10630816 3300009551 Bacteria 1081
50 Ga0105249_10359568 3300009553 Bacteria 1477
51 Ga0105239_10187816 3300010375 Bacteria 2313
52 Ga0105239_10189022 3300010375 Bacteria 2305
53 Ga0157370_10133992 3300013104 Bacteria 2310
54 Ga0157370_10563108 3300013104 Bacteria 1044
55 Ga0157369_10012337 3300013105 Bacteria 9702
56 Ga0157369_10109660 3300013105 Bacteria 2934
57 Ga0157369_10623032 3300013105 Bacteria 1113
58 Ga0157374_10049013 3300013296 Bacteria 3921
59 Ga0157372_10064392 3300013307 Bacteria 4114
60 Ga0157375_10069726 3300013308 Bacteria 3523
61 Ga0163163_10238917 3300014325 Bacteria 1866
62 Ga0163163_10344568 3300014325 Bacteria 1546
63 Ga0157379_10004084 3300014968 Bacteria 12453
64 Ga0157379_10023741 3300014968 Bacteria 5444
65 Ga0157379_10035701 3300014968 Bacteria 4432
66 Ga0157379_10415880 3300014968 Bacteria 1238
67 Ga0209026_1001009 3300025250 Bacteria 13901
68 Ga0209758_1002410 3300025297 Bacteria 19155
69 Ga0209050_1000101 3300025298 Bacteria 230076
70 Ga0209257_1001165 3300025304 Bacteria 33428
71 Ga0209257_1007918 3300025304 Bacteria 6240
72 Ga0207699_10000147 3300025906 Bacteria 45662
73 Ga0207699_10024699 3300025906 Bacteria 3289
74 Ga0207705_10235038 3300025909 Bacteria 1395
75 Ga0207707_10016493 3300025912 Bacteria 6441
76 Ga0207695_10001328 3300025913 Bacteria 41985
77 Ga0207695_10002756 3300025913 Bacteria 25626
78 Ga0207695_10009972 3300025913 Bacteria 11669
79 Ga0207695_10038360 3300025913 Bacteria 5159
80 Ga0207693_10000048 3300025915 Bacteria 100685
81 Ga0207693_10022415 3300025915 Bacteria 5019
82 Ga0207663_10001182 3300025916 Bacteria 12053
83 Ga0207663_10130266 3300025916 Bacteria 1737
84 Ga0207660_10071016 3300025917 Bacteria 2532
85 Ga0207660_10179362 3300025917 Bacteria 1644
86 Ga0207652_10009959 3300025921 Bacteria 7653
87 Ga0207694_10155847 3300025924 Bacteria 1842
88 Ga0207694_10156885 3300025924 Bacteria 1836
89 Ga0207694_10226536 3300025924 Bacteria 1526
90 Ga0207694_10470874 3300025924 Bacteria 1050
91 Ga0207687_10136194 3300025927 Bacteria 1857
92 Ga0207700_10033794 3300025928 Bacteria 3663
93 Ga0207644_10134425 3300025931 Bacteria 1897
94 Ga0207690_10001186 3300025932 Bacteria 16502
95 Ga0207690_10092603 3300025932 Bacteria 2139
96 Ga0207706_10063031 3300025933 Bacteria 3264
97 Ga0207704_10002589 3300025938 Bacteria 8161
98 Ga0207665_10142888 3300025939 Bacteria 1708
99 Ga0207711_10000482 3300025941 Bacteria 41192
100 Ga0207679_10061931 3300025945 Bacteria 2787
101 Ga0207679_10146891 3300025945 Bacteria 1914
102 Ga0207667_10015747 3300025949 Bacteria 8575
103 Ga0207667_10029222 3300025949 Bacteria 5979
104 Ga0207667_10107790 3300025949 Bacteria 2874
105 Ga0207667_10122912 3300025949 Bacteria 2674
106 Ga0207667_10546654 3300025949 Bacteria 1172
107 Ga0207651_10001555 3300025960 Bacteria 10492
108 Ga0207703_10029583 3300026035 Bacteria 4323
109 Ga0207639_10074517 3300026041 Bacteria 2665
110 Ga0207639_10087344 3300026041 Bacteria 2486
111 Ga0207702_10000066 3300026078 Bacteria 117825
112 Ga0207641_10074009 3300026088 Bacteria 2937
113 Ga0207676_10126848 3300026095 Bacteria 2163
114 Ga0207674_10000004 3300026116 Bacteria 241430
115 Ga0207674_10165151 3300026116 Bacteria 2168
116 Ga0207683_10109714 3300026121 Bacteria 2470
117 Ga0207698_10488549 3300026142 Bacteria 1196
118 Ga0268266_10000106 3300028379 Bacteria 175109
119 Ga0268266_10160252 3300028379 Bacteria 2035
120 Ga0307517_10040314 3300028786 Bacteria 5089
121 Ga0265338_10005527 3300028800 Bacteria 16471
122 Ga0265338_10048201 3300028800 Bacteria 3880
123 Ga0265338_10081630 3300028800 Bacteria 2710
124 Ga0265338_10136955 3300028800 Bacteria 1923
125 Ga0307511_10046240 3300030521 Bacteria 3583
126 Ga0265320_10000097 3300031240 Bacteria 74341
127 Ga0265325_10000288 3300031241 Bacteria 35410
128 Ga0265325_10021516 3300031241 Bacteria 3542
129 Ga0265339_10000371 3300031249 Bacteria 35315
130 Ga0265327_10000130 3300031251 Bacteria 165066
131 Ga0307513_10004143 3300031456 Bacteria 19418
132 Ga0265313_10001101 3300031595 Bacteria 25894
133 Ga0265342_10083080 3300031712 Bacteria 1847
134 Ga0307414_10448020 3300032004 Bacteria 1131
135 Ga0307411_10425096 3300032005 Bacteria 1105
136 Ga0373932_0019990 3300035112 Bacteria 1751
137 Ga0373931_0017720 3300035691 Bacteria 3528
138 Ga0373935_0035580 3300035692 Bacteria 3109
139 Ga0373935_0114819 3300035692 Bacteria 1792
140 Ga0373937_0075077 3300036401 Bacteria 3121
141 Ga0373925_0187782 3300037068 Bacteria 1639
142 Ga0395899_0000187 3300037312 Bacteria 90916
143 Ga0395900_0000009 3300037418 Bacteria 476249
144 Ga0395898_0003798 3300037466 Bacteria 16721
145 Ga0395905_0077692 3300037471 Bacteria 3110
146 Ga0395905_0090070 3300037471 Bacteria 2875
147 Ga0395901_0000412 3300038443 Bacteria 50385
148 Ga0495582_0183038 3300046473 Bacteria 1194
149 Ga0495630_0068506 3300046517 Bacteria 2669
150 Ga0495668_0077843 3300046616 Bacteria 1821
151 Ga0495668_0183531 3300046616 Bacteria 1146
152 Ga0495611_0121851 3300046648 Bacteria 1216
153 Ga0495670_0178118 3300046691 Unclassified 1122
154 Ga0496100_0082701 3300048903 Bacteria 2172
155 Ga0496102_0016015 3300048905 Bacteria 6545
156 Ga0496102_0112140 3300048905 Bacteria 2543
157 Ga0496103_0325883 3300048906 Unclassified 988
158 Ga0496106_0322560 3300048909 Unclassified 1240
159 Ga0496107_0154481 3300048910 Unclassified 1699
160 Ga0496107_0266334 3300048910 Bacteria 1275
161 Ga0496109_0026185 3300048912 Bacteria 5199
162 Ga0496110_0384495 3300048913 Bacteria 1279
163 Ga0496112_0174261 3300048915 Bacteria 2116
164 Ga0496112_0184825 3300048915 Bacteria 2048
165 Ga0496115_0030650 3300048918 Bacteria 4233
166 Ga0501033_0034497 3300049570 Bacteria 3795
167 Ga0501033_0159409 3300049570 Bacteria 1625
168 Ga0501047_0005187 3300049581 Bacteria 12228
169 Ga0501048_0190594 3300049582 Bacteria 1453
170 Ga0501035_0302498 3300049822 Unclassified 1347
171 Ga0501044_0001454 3300049823 Bacteria 27833
172 nmdc:mga03683_116705_c1 3300050489 Bacteria 1184
173 nmdc:mga0n895_10932_c1 3300050512 Bacteria 8065
174 nmdc:mga0n895_302639_c1 3300050512 Bacteria 1621
175 nmdc:mga0rr50_10398_c1 3300050513 Bacteria 5901
176 nmdc:mga08x19_3780_c1 3300050514 Bacteria 9006
177 nmdc:mga08x19_52_c1 3300050514 Bacteria 123790
178 Ga0500641_0108254 3300053096 Bacteria 1195
179 Ga0500562_002873 3300053108 Bacteria 4294
180 Ga0500595_005820 3300053119 Bacteria 5319
181 Ga0500645_001973 3300053730 Bacteria 9689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2965119406 2965123497 240
2 iso_pu_bacteria 2968117919 2968122676 240
3 3300009093 Ga0105240_10128452 Ga0105240_101284522 250
4 3300025913 Ga0207695_10001328 Ga0207695_100013287 250
5 3300005548 Ga0070665_100221386 Ga0070665_1002213862 255
6 3300028379 Ga0268266_10160252 Ga0268266_101602522 255
7 iso_pu_bacteria 2643221598 2643998246 261
8 iso_pu_bacteria 2643221614 2644087218 261
9 iso_pu_bacteria 2643221661 2644342171 261
10 iso_pu_bacteria 2643221666 2644368457 261
11 3300005937 Ga0081455_10320554 Ga0081455_103205542 263
12 3300046473 Ga0495582_0183038 Ga0495582_0183038_355_1149 264
13 3300046517 Ga0495630_0068506 Ga0495630_0068506_769_1563 264
14 3300005262 Ga0065165_1000210 Ga0065165_100021036 265
15 3300005341 Ga0070691_10000039 Ga0070691_1000003910 265
16 3300005366 Ga0070659_100001044 Ga0070659_1000010442 265
17 3300005518 Ga0070699_100148365 Ga0070699_1001483652 265
18 3300005535 Ga0070684_100116766 Ga0070684_1001167662 265
19 3300005539 Ga0068853_100009799 Ga0068853_1000097994 265
20 3300005563 Ga0068855_100202472 Ga0068855_1002024723 265
21 3300005564 Ga0070664_100083797 Ga0070664_1000837972 265
22 3300005577 Ga0068857_100000667 Ga0068857_10000066717 265
23 3300005614 Ga0068856_100000142 Ga0068856_10000014223 265
24 3300005614 Ga0068856_100003091 Ga0068856_10000309111 265
25 3300005842 Ga0068858_100044145 Ga0068858_1000441453 265
26 3300006048 Ga0075363_100225209 Ga0075363_1002252092 265
27 3300006175 Ga0070712_100000015 Ga0070712_10000001555 265
28 3300006871 Ga0075434_100022092 Ga0075434_1000220922 265
29 3300006881 Ga0068865_100001515 Ga0068865_10000151513 265
30 3300006914 Ga0075436_100000024 Ga0075436_10000002470 265
31 3300006914 Ga0075436_100006793 Ga0075436_1000067937 265
32 3300009093 Ga0105240_10000769 Ga0105240_1000076924 265
33 3300009093 Ga0105240_10055646 Ga0105240_100556465 265
34 3300009177 Ga0105248_10001413 Ga0105248_1000141314 265
35 3300009545 Ga0105237_10008109 Ga0105237_1000810911 265
36 3300009551 Ga0105238_10001297 Ga0105238_1000129717 265
37 3300009551 Ga0105238_10221674 Ga0105238_102216742 265
38 3300010375 Ga0105239_10187816 Ga0105239_101878162 265
39 3300013104 Ga0157370_10133992 Ga0157370_101339922 265
40 3300013105 Ga0157369_10012337 Ga0157369_100123379 265
41 3300013296 Ga0157374_10049013 Ga0157374_100490132 265
42 3300014968 Ga0157379_10004084 Ga0157379_100040848 265
43 3300014968 Ga0157379_10035701 Ga0157379_100357014 265
44 3300025250 Ga0209026_1001009 Ga0209026_100100910 265
45 3300025304 Ga0209257_1007918 Ga0209257_10079184 265
46 3300025906 Ga0207699_10000147 Ga0207699_1000014728 265
47 3300025906 Ga0207699_10024699 Ga0207699_100246991 265
48 3300025913 Ga0207695_10038360 Ga0207695_100383602 265
49 3300025915 Ga0207693_10000048 Ga0207693_1000004852 265
50 3300025916 Ga0207663_10130266 Ga0207663_101302661 265
51 3300025924 Ga0207694_10155847 Ga0207694_101558472 265
52 3300025924 Ga0207694_10470874 Ga0207694_104708741 265
53 3300025928 Ga0207700_10033794 Ga0207700_100337942 265
54 3300025932 Ga0207690_10001186 Ga0207690_100011862 265
55 3300025938 Ga0207704_10002589 Ga0207704_100025894 265
56 3300025939 Ga0207665_10142888 Ga0207665_101428882 265
57 3300025941 Ga0207711_10000482 Ga0207711_1000048231 265
58 3300025945 Ga0207679_10146891 Ga0207679_101468912 265
59 3300025949 Ga0207667_10029222 Ga0207667_100292222 265
60 3300026035 Ga0207703_10029583 Ga0207703_100295832 265
61 3300026041 Ga0207639_10074517 Ga0207639_100745173 265
62 3300026078 Ga0207702_10000066 Ga0207702_1000006680 265
63 3300026116 Ga0207674_10000004 Ga0207674_1000000431 265
64 3300026116 Ga0207674_10165151 Ga0207674_101651512 265
65 3300026142 Ga0207698_10488549 Ga0207698_104885492 265
66 3300028800 Ga0265338_10005527 Ga0265338_1000552715 265
67 3300028800 Ga0265338_10048201 Ga0265338_100482014 265
68 3300028800 Ga0265338_10081630 Ga0265338_100816302 265
69 3300028800 Ga0265338_10136955 Ga0265338_101369552 265
70 3300030521 Ga0307511_10046240 Ga0307511_100462402 265
71 3300031240 Ga0265320_10000097 Ga0265320_1000009719 265
72 3300031241 Ga0265325_10000288 Ga0265325_1000028832 265
73 3300031241 Ga0265325_10021516 Ga0265325_100215162 265
74 3300031249 Ga0265339_10000371 Ga0265339_100003717 265
75 3300031595 Ga0265313_10001101 Ga0265313_1000110114 265
76 3300031712 Ga0265342_10083080 Ga0265342_100830802 265
77 3300032004 Ga0307414_10448020 Ga0307414_104480202 265
78 3300032005 Ga0307411_10425096 Ga0307411_104250961 265
79 3300035112 Ga0373932_0019990 Ga0373932_0019990_881_1678 265
80 3300035691 Ga0373931_0017720 Ga0373931_0017720_2434_3231 265
81 3300035692 Ga0373935_0035580 Ga0373935_0035580_1931_2728 265
82 3300035692 Ga0373935_0114819 Ga0373935_0114819_168_965 265
83 3300037068 Ga0373925_0187782 Ga0373925_0187782_299_1096 265
84 3300037471 Ga0395905_0077692 Ga0395905_0077692_2225_3022 265
85 3300046616 Ga0495668_0077843 Ga0495668_0077843_156_953 265
86 3300048905 Ga0496102_0112140 Ga0496102_0112140_1431_2228 265
87 3300048909 Ga0496106_0322560 Ga0496106_0322560_352_1149 265
88 3300048913 Ga0496110_0384495 Ga0496110_0384495_304_1101 265
89 3300048915 Ga0496112_0184825 Ga0496112_0184825_1142_1942 265
90 3300049570 Ga0501033_0034497 Ga0501033_0034497_663_1460 265
91 3300049570 Ga0501033_0159409 Ga0501033_0159409_564_1361 265
92 3300049822 Ga0501035_0302498 Ga0501035_0302498_272_1069 265
93 3300049823 Ga0501044_0001454 Ga0501044_0001454_16689_17486 265
94 3300050489 nmdc:mga03683_116705_c1 nmdc:mga03683_116705_c1_280_1077 265
95 3300050512 nmdc:mga0n895_10932_c1 nmdc:mga0n895_10932_c1_1238_2035 265
96 3300050512 nmdc:mga0n895_302639_c1 nmdc:mga0n895_302639_c1_289_1086 265
97 3300050513 nmdc:mga0rr50_10398_c1 nmdc:mga0rr50_10398_c1_2475_3272 265
98 3300050514 nmdc:mga08x19_3780_c1 nmdc:mga08x19_3780_c1_7803_8600 265
99 3300050514 nmdc:mga08x19_52_c1 nmdc:mga08x19_52_c1_91199_91996 265
100 3300053096 Ga0500641_0108254 Ga0500641_0108254_279_1076 265
101 3300053108 Ga0500562_002873 Ga0500562_002873_3329_4126 265
102 3300053119 Ga0500595_005820 Ga0500595_005820_2445_3242 265
103 3300053730 Ga0500645_001973 Ga0500645_001973_8693_9490 265
104 3300005327 Ga0070658_10261851 Ga0070658_102618512 266
105 3300005327 Ga0070658_10554696 Ga0070658_105546961 266
106 3300005355 Ga0070671_100171023 Ga0070671_1001710232 266
107 3300005456 Ga0070678_100036798 Ga0070678_1000367981 266
108 3300005458 Ga0070681_10018656 Ga0070681_100186562 266
109 3300005539 Ga0068853_100211572 Ga0068853_1002115722 266
110 3300005539 Ga0068853_100368086 Ga0068853_1003680861 266
111 3300005548 Ga0070665_100000121 Ga0070665_10000012165 266
112 3300005563 Ga0068855_100029068 Ga0068855_1000290684 266
113 3300005563 Ga0068855_100159975 Ga0068855_1001599752 266
114 3300005616 Ga0068852_100023098 Ga0068852_1000230982 266
115 3300005616 Ga0068852_100352661 Ga0068852_1003526612 266
116 3300005841 Ga0068863_100063540 Ga0068863_1000635403 266
117 3300005844 Ga0068862_100192911 Ga0068862_1001929112 266
118 3300009093 Ga0105240_10006742 Ga0105240_1000674219 266
119 3300009093 Ga0105240_10324836 Ga0105240_103248362 266
120 3300009098 Ga0105245_10531372 Ga0105245_105313721 266
121 3300009551 Ga0105238_10266468 Ga0105238_102664681 266
122 3300009553 Ga0105249_10359568 Ga0105249_103595682 266
123 3300010375 Ga0105239_10189022 Ga0105239_101890222 266
124 3300013104 Ga0157370_10563108 Ga0157370_105631082 266
125 3300013105 Ga0157369_10109660 Ga0157369_101096602 266
126 3300013307 Ga0157372_10064392 Ga0157372_100643923 266
127 3300013308 Ga0157375_10069726 Ga0157375_100697263 266
128 3300014325 Ga0163163_10238917 Ga0163163_102389171 266
129 3300014325 Ga0163163_10344568 Ga0163163_103445682 266
130 3300014968 Ga0157379_10415880 Ga0157379_104158802 266
131 3300025909 Ga0207705_10235038 Ga0207705_102350381 266
132 3300025912 Ga0207707_10016493 Ga0207707_100164932 266
133 3300025913 Ga0207695_10002756 Ga0207695_1000275619 266
134 3300025913 Ga0207695_10009972 Ga0207695_1000997210 266
135 3300025917 Ga0207660_10071016 Ga0207660_100710161 266
136 3300025917 Ga0207660_10179362 Ga0207660_101793622 266
137 3300025921 Ga0207652_10009959 Ga0207652_100099596 266
138 3300025924 Ga0207694_10156885 Ga0207694_101568852 266
139 3300025927 Ga0207687_10136194 Ga0207687_101361942 266
140 3300025931 Ga0207644_10134425 Ga0207644_101344253 266
141 3300025932 Ga0207690_10092603 Ga0207690_100926032 266
142 3300025933 Ga0207706_10063031 Ga0207706_100630312 266
143 3300025945 Ga0207679_10061931 Ga0207679_100619312 266
144 3300025949 Ga0207667_10015747 Ga0207667_100157477 266
145 3300025949 Ga0207667_10107790 Ga0207667_101077902 266
146 3300025949 Ga0207667_10122912 Ga0207667_101229122 266
147 3300025960 Ga0207651_10001555 Ga0207651_1000155511 266
148 3300026041 Ga0207639_10087344 Ga0207639_100873443 266
149 3300026088 Ga0207641_10074009 Ga0207641_100740092 266
150 3300026095 Ga0207676_10126848 Ga0207676_101268482 266
151 3300026121 Ga0207683_10109714 Ga0207683_101097143 266
152 3300028379 Ga0268266_10000106 Ga0268266_1000010699 266
153 3300028786 Ga0307517_10040314 Ga0307517_100403142 266
154 3300031251 Ga0265327_10000130 Ga0265327_1000013023 266
155 3300031456 Ga0307513_10004143 Ga0307513_100041438 266
156 3300037312 Ga0395899_0000187 Ga0395899_0000187_41915_42730 266
157 3300037418 Ga0395900_0000009 Ga0395900_0000009_13648_14463 266
158 3300037466 Ga0395898_0003798 Ga0395898_0003798_4029_4844 266
159 3300037471 Ga0395905_0090070 Ga0395905_0090070_1221_2036 266
160 3300038443 Ga0395901_0000412 Ga0395901_0000412_42345_43160 266
161 3300046616 Ga0495668_0183531 Ga0495668_0183531_280_1080 266
162 3300046648 Ga0495611_0121851 Ga0495611_0121851_160_960 266
163 3300048903 Ga0496100_0082701 Ga0496100_0082701_1156_1956 266
164 3300048905 Ga0496102_0016015 Ga0496102_0016015_3667_4467 266
165 3300048906 Ga0496103_0325883 Ga0496103_0325883_155_955 266
166 3300048910 Ga0496107_0266334 Ga0496107_0266334_324_1124 266
167 3300048912 Ga0496109_0026185 Ga0496109_0026185_2189_2989 266
168 3300048915 Ga0496112_0174261 Ga0496112_0174261_853_1653 266
169 3300048918 Ga0496115_0030650 Ga0496115_0030650_916_1716 266
170 3300049581 Ga0501047_0005187 Ga0501047_0005187_4737_5543 266
171 3300049582 Ga0501048_0190594 Ga0501048_0190594_540_1340 266
172 3300006175 Ga0070712_100003947 Ga0070712_1000039473 267
173 3300009551 Ga0105238_10630816 Ga0105238_106308162 267
174 3300013105 Ga0157369_10623032 Ga0157369_106230321 267
175 3300014968 Ga0157379_10023741 Ga0157379_100237414 267
176 3300025915 Ga0207693_10022415 Ga0207693_100224153 267
177 3300025916 Ga0207663_10001182 Ga0207663_100011827 267
178 3300025924 Ga0207694_10226536 Ga0207694_102265362 267
179 3300025949 Ga0207667_10546654 Ga0207667_105466542 267
180 3300036401 Ga0373937_0075077 Ga0373937_0075077_1924_2727 267
181 3300046691 Ga0495670_0178118 Ga0495670_0178118_172_975 267
182 3300048910 Ga0496107_0154481 Ga0496107_0154481_490_1293 267
183 3300003791 Ga0055530_10001456 Ga0055530_100014565 268
184 3300003794 Ga0055531_10014732 Ga0055531_100147322 268
185 3300025297 Ga0209758_1002410 Ga0209758_100241018 268
186 3300025298 Ga0209050_1000101 Ga0209050_100010133 268
187 3300025304 Ga0209257_1001165 Ga0209257_10011653 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

43

251

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

20

253

0.78

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

22

258

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8477 2 116
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8453 2 116
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.8443 2 116
6eb3-assembly1.cif.gz_A structural and enzymatic characterization of an esterase from a metagenomic library 0.8434 1 261
3e3a-assembly1.cif.gz_A the structure of rv0554 from mycobacterium tuberculosis 0.842 10 262
ID Description Score Start End Superfamily
af_Q4CQ94_14_186_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.827 9 138 3.40.50.12270
3hzoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.824 13 261 3.40.50.1820
3oosA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8199 2 261 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8177 2 124 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8096 2 265 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7C3GEX3-F1-model_v4 Alpha/beta hydrolase 0.9687 70 268 GO:0016787
AF-A0A520U8H3-F1-model_v4 Alpha/beta hydrolase 0.9551 1 265 GO:0004806
GO:0046503
AF-A0A520U8H3-F1-model_v4 Alpha/beta hydrolase 0.9516 1 265 GO:0004806
GO:0046503
AF-A0A7C3GEX3-F1-model_v4 Alpha/beta hydrolase 0.9499 70 268 GO:0016787
AF-A0A358A542-F1-model_v4 Alpha/beta hydrolase 0.9195 1 231 GO:0004806
GO:0046503

Feature Viewer

pLDDT pTM Quality
96.38 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map