F287246

General Info

Members Datasets Scaffolds Average Seq Length
187 114 187 131

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100567830|Ga0070713_1005678303
Length 136
Sequence MIGLDTNVLVRYLTQDDPVQSLKANEIIERRLTPANPGFLSVVTMAETVWVLERAYGLTAQEIAAAVERILQVEVLVVENEQEVFAATVALGAMALKQGQGAFADALIAELGARAGCTHTLTFDKKALRLPAFRLP

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
52 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 2.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 0
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10007161 3300001991 Unclassified 1926
2 Ga0058863_10706487 3300004799 Unclassified 719
3 Ga0065707_10141057 3300005295 Bacteria 1748
4 Ga0070680_100055903 3300005336 Bacteria 3225
5 Ga0070709_10240833 3300005434 Unclassified 1299
6 Ga0070709_10275686 3300005434 Unclassified 1220
7 Ga0070709_10318595 3300005434 Bacteria 1141
8 Ga0070714_100010717 3300005435 Bacteria 7253
9 Ga0070714_100677699 3300005435 Bacteria 994
10 Ga0070714_100927591 3300005435 Bacteria 846
11 Ga0070713_100019564 3300005436 Bacteria 5174
12 Ga0070713_100389395 3300005436 Bacteria 1300
13 Ga0070713_100567830 3300005436 Bacteria 1075
14 Ga0070710_10003358 3300005437 Bacteria 7589
15 Ga0070710_10112331 3300005437 Unclassified 1638
16 Ga0070710_10173339 3300005437 Bacteria 1346
17 Ga0070711_100007607 3300005439 Bacteria 6594
18 Ga0070711_100009261 3300005439 Bacteria 6057
19 Ga0070711_100321448 3300005439 Bacteria 1236
20 Ga0070711_101638022 3300005439 Unclassified 563
21 Ga0070708_100004390 3300005445 Bacteria 11077
22 Ga0070708_100066146 3300005445 Bacteria 3244
23 Ga0070681_10016986 3300005458 Bacteria 7272
24 Ga0070685_10451740 3300005466 Unclassified 900
25 Ga0070706_100010041 3300005467 Bacteria 8790
26 Ga0070706_100311131 3300005467 Unclassified 1469
27 Ga0070706_100467495 3300005467 Bacteria 1173
28 Ga0070707_100236599 3300005468 Bacteria 1777
29 Ga0070707_100374205 3300005468 Bacteria 1384
30 Ga0070707_100446157 3300005468 Unclassified 1254
31 Ga0070698_100018601 3300005471 Bacteria 7313
32 Ga0070699_100107343 3300005518 Unclassified 2449
33 Ga0070699_100284762 3300005518 Bacteria 1481
34 Ga0070679_100029259 3300005530 Bacteria 5435
35 Ga0070697_100000469 3300005536 Bacteria 30871
36 Ga0070697_100025400 3300005536 Bacteria 4726
37 Ga0070697_100605768 3300005536 Unclassified 963
38 Ga0068853_100421015 3300005539 Unclassified 1252
39 Ga0070665_100093640 3300005548 Unclassified 3009
40 Ga0068860_100167763 3300005843 Unclassified 2120
41 Ga0070717_10091873 3300006028 Bacteria 2564
42 Ga0070717_10133290 3300006028 Unclassified 2138
43 Ga0070717_10176389 3300006028 Bacteria 1861
44 Ga0070717_10888398 3300006028 Bacteria 811
45 Ga0070715_10473439 3300006163 Bacteria 712
46 Ga0070716_100088569 3300006173 Unclassified 1867
47 Ga0070716_100128775 3300006173 Bacteria 1596
48 Ga0070716_101140209 3300006173 Unclassified 624
49 Ga0070712_100002436 3300006175 Bacteria 11468
50 Ga0070712_100107152 3300006175 Bacteria 2078
51 Ga0070712_100376024 3300006175 Unclassified 1168
52 Ga0075430_100456876 3300006846 Bacteria 1054
53 Ga0075433_10071415 3300006852 Bacteria 3052
54 Ga0075434_100012196 3300006871 Bacteria 8142
55 Ga0068865_100711329 3300006881 Unclassified 859
56 Ga0075436_100025395 3300006914 Bacteria 4077
57 Ga0075436_100556537 3300006914 Unclassified 842
58 Ga0075436_100924167 3300006914 Bacteria 653
59 Ga0075435_100119540 3300007076 Unclassified 2198
60 Ga0075435_100647443 3300007076 Bacteria 917
61 Ga0099794_10019446 3300007265 Bacteria 3060
62 Ga0099794_10025737 3300007265 Plasmid 2713
63 Ga0099794_10030137 3300007265 Bacteria 2531
64 Ga0099794_10039489 3300007265 Bacteria 2240
65 Ga0099794_10080899 3300007265 Bacteria 1602
66 Ga0099794_10277142 3300007265 Unclassified 867
67 Ga0099794_10325588 3300007265 Bacteria 798
68 Ga0099795_10490631 3300007788 Unclassified 571
69 Ga0105240_10493852 3300009093 Unclassified 1362
70 Ga0105242_10170913 3300009176 Bacteria 1910
71 Ga0105248_10522403 3300009177 Unclassified 1339
72 Ga0105237_10073487 3300009545 Bacteria 3411
73 Ga0105249_10531647 3300009553 Unclassified 1224
74 Ga0099796_10207443 3300010159 Bacteria 798
75 Ga0157370_10085411 3300013104 Bacteria 2965
76 Ga0157369_10159907 3300013105 Bacteria 2378
77 Ga0157378_10021395 3300013297 Bacteria 5688
78 Ga0163162_11544166 3300013306 Unclassified 757
79 Ga0163162_12369467 3300013306 Unclassified 610
80 Ga0157375_10000330 3300013308 Bacteria 42539
81 Ga0163163_12482541 3300014325 Unclassified 576
82 Ga0157379_10721648 3300014968 Unclassified 937
83 Ga0197907_10883768 3300020069 Unclassified 544
84 Ga0206352_10735433 3300020078 Unclassified 746
85 Ga0213874_10007025 3300021377 Plasmid 2688
86 Ga0213871_10048459 3300021441 Bacteria 1158
87 Ga0224572_1009439 3300024225 Unclassified 1820
88 Ga0228598_1006290 3300024227 Bacteria 2460
89 Ga0207692_10059432 3300025898 Unclassified 1974
90 Ga0207692_10208275 3300025898 Bacteria 1153
91 Ga0207685_10317784 3300025905 Bacteria 775
92 Ga0207699_10377062 3300025906 Bacteria 1006
93 Ga0207699_11202448 3300025906 Unclassified 561
94 Ga0207684_10001186 3300025910 Bacteria 29163
95 Ga0207684_11051704 3300025910 Unclassified 679
96 Ga0207707_10042781 3300025912 Bacteria 3952
97 Ga0207695_10708308 3300025913 Unclassified 887
98 Ga0207693_10004751 3300025915 Bacteria 11424
99 Ga0207693_10005878 3300025915 Bacteria 10179
100 Ga0207693_10213855 3300025915 Bacteria 1515
101 Ga0207663_10072721 3300025916 Unclassified 2223
102 Ga0207663_11372207 3300025916 Unclassified 569
103 Ga0207660_10058015 3300025917 Bacteria 2774
104 Ga0207652_10044487 3300025921 Bacteria 3782
105 Ga0207646_10000405 3300025922 Bacteria 57762
106 Ga0207646_10016623 3300025922 Bacteria 6901
107 Ga0207700_10198342 3300025928 Bacteria 1690
108 Ga0207700_10201598 3300025928 Unclassified 1677
109 Ga0207700_10526969 3300025928 Bacteria 1047
110 Ga0207664_10025205 3300025929 Bacteria 4476
111 Ga0207704_11093070 3300025938 Unclassified 677
112 Ga0207665_10243137 3300025939 Bacteria 1327
113 Ga0207665_10833406 3300025939 Unclassified 730
114 Ga0207711_10554465 3300025941 Unclassified 1072
115 Ga0207639_10389698 3300026041 Unclassified 1253
116 Ga0207641_10351621 3300026088 Bacteria 1405
117 Ga0209588_1048695 3300027671 Unclassified 1372
118 Ga0209588_1077593 3300027671 Bacteria 1073
119 Ga0209588_1186109 3300027671 Unclassified 650
120 Ga0265356_1000154 3300028017 Bacteria 12468
121 Ga0268266_10000194 3300028379 Bacteria 106020
122 Ga0265338_10189659 3300028800 Bacteria 1559
123 Ga0265770_1049884 3300030878 Unclassified 754
124 Ga0265773_1026477 3300031018 Unclassified 600
125 Ga0265339_10054860 3300031249 Bacteria 2163
126 Ga0265339_10134298 3300031249 Unclassified 1263
127 Ga0265316_10105405 3300031344 Bacteria 2139
128 Ga0265314_10205344 3300031711 Unclassified 1161
129 Ga0373957_0023119 3300035120 Bacteria 2221
130 Ga0373943_0290903 3300035170 Unclassified 926
131 Ga0373943_0457468 3300035170 Bacteria 742
132 Ga0373924_0033753 3300035410 Bacteria 2068
133 Ga0373924_0115374 3300035410 Unclassified 1163
134 Ga0373931_0131550 3300035691 Bacteria 1441
135 Ga0373931_0251355 3300035691 Unclassified 1075
136 Ga0373931_0429436 3300035691 Unclassified 841
137 Ga0373927_0055297 3300035695 Bacteria 2567
138 Ga0373927_0277334 3300035695 Bacteria 1103
139 Ga0373927_0704579 3300035695 Bacteria 667
140 Ga0373933_0070389 3300035724 Bacteria 2128
141 Ga0373933_0215499 3300035724 Bacteria 1231
142 Ga0373947_0228443 3300035725 Bacteria 1225
143 Ga0373947_0800141 3300035725 Unclassified 644
144 Ga0373937_0013332 3300036401 Bacteria 7242
145 Ga0373937_0122918 3300036401 Bacteria 2420
146 Ga0373925_0008776 3300037068 Bacteria 7363
147 Ga0373925_0442840 3300037068 Unclassified 1063
148 Ga0373925_0899433 3300037068 Bacteria 730
149 Ga0436365_0533427 3300039437 Bacteria 6207
150 Ga0436365_1422643 3300039437 Bacteria 1047
151 Ga0436360_0521402 3300039438 Bacteria 1313
152 Ga0436360_0946856 3300039438 Bacteria 1630
153 Ga0436360_1029658 3300039438 Bacteria 1391
154 Ga0436361_0383882 3300039447 Bacteria 1015
155 Ga0436361_0663931 3300039447 Unclassified 786
156 Ga0436363_0050582 3300039450 Unclassified 767
157 Ga0436363_0562101 3300039450 Bacteria 2080
158 Ga0436363_1543130 3300039450 Plasmid 2861
159 Ga0436362_0052030 3300039453 Unclassified 1355
160 Ga0436362_0099984 3300039453 Unclassified 839
161 Ga0439441_026488 3300042001 Bacteria 1101
162 Ga0495592_0178892 3300046454 Bacteria 1446
163 Ga0495590_0070156 3300046457 Unclassified 1229
164 Ga0495629_0401801 3300046459 Unclassified 931
165 Ga0495651_0000645 3300046462 Bacteria 26939
166 Ga0495651_0175088 3300046462 Bacteria 1524
167 Ga0495653_0141199 3300046463 Unclassified 1694
168 Ga0495580_0308518 3300046472 Unclassified 1077
169 Ga0495664_0046717 3300046477 Unclassified 2569
170 Ga0495664_0165369 3300046477 Bacteria 1342
171 Ga0495608_0512607 3300046511 Unclassified 726
172 Ga0495667_0070939 3300046559 Bacteria 2273
173 Ga0495599_0031526 3300046678 Bacteria 3327
174 Ga0495600_0022351 3300046809 Bacteria 4059
175 Ga0495674_0667487 3300047319 Unclassified 818
176 Ga0495680_0001235 3300047322 Bacteria 28051
177 Ga0495675_0129600 3300047444 Unclassified 1568
178 nmdc:mga0k408_223373_c1 3300050493 Bacteria 1124
179 nmdc:mga0qj67_437082_c1 3300050509 Bacteria 1054
180 nmdc:mga0rr50_1042035_c1 3300050513 Unclassified 696
181 nmdc:mga0rr50_146416_c1 3300050513 Unclassified 1905
182 nmdc:mga0rr50_608642_c1 3300050513 Bacteria 932
183 nmdc:mga08x19_1310612_c1 3300050514 Unclassified 513
184 nmdc:mga08x19_526215_c1 3300050514 Unclassified 836
185 nmdc:mga08x19_744844_c1 3300050514 Bacteria 696
186 nmdc:mga0a205_10437_c3 3300050515 Bacteria 4267
187 Ga0500644_0078738 3300053088 Unclassified 1207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_1042035_c1 nmdc:mga0rr50_1042035_c1_241_594 111
2 3300035695 Ga0373927_0704579 Ga0373927_0704579_18_374 112
3 3300046511 Ga0495608_0512607 Ga0495608_0512607_40_450 116
4 3300007265 Ga0099794_10039489 Ga0099794_100394893 117
5 3300001991 JGI24743J22301_10007161 JGI24743J22301_100071612 125
6 3300004799 Ga0058863_10706487 Ga0058863_107064871 125
7 3300005295 Ga0065707_10141057 Ga0065707_101410573 125
8 3300005336 Ga0070680_100055903 Ga0070680_1000559034 125
9 3300005434 Ga0070709_10240833 Ga0070709_102408334 125
10 3300005434 Ga0070709_10275686 Ga0070709_102756862 125
11 3300005434 Ga0070709_10318595 Ga0070709_103185952 125
12 3300005435 Ga0070714_100010717 Ga0070714_1000107175 125
13 3300005435 Ga0070714_100677699 Ga0070714_1006776991 125
14 3300005435 Ga0070714_100927591 Ga0070714_1009275911 125
15 3300005436 Ga0070713_100019564 Ga0070713_1000195642 125
16 3300005436 Ga0070713_100389395 Ga0070713_1003893951 125
17 3300005436 Ga0070713_100567830 Ga0070713_1005678303 125
18 3300005437 Ga0070710_10003358 Ga0070710_100033585 125
19 3300005437 Ga0070710_10112331 Ga0070710_101123313 125
20 3300005437 Ga0070710_10173339 Ga0070710_101733392 125
21 3300005439 Ga0070711_100007607 Ga0070711_1000076073 125
22 3300005439 Ga0070711_100009261 Ga0070711_1000092614 125
23 3300005439 Ga0070711_100321448 Ga0070711_1003214481 125
24 3300005439 Ga0070711_101638022 Ga0070711_1016380221 125
25 3300005445 Ga0070708_100004390 Ga0070708_10000439012 125
26 3300005445 Ga0070708_100066146 Ga0070708_1000661463 125
27 3300005458 Ga0070681_10016986 Ga0070681_100169866 125
28 3300005466 Ga0070685_10451740 Ga0070685_104517402 125
29 3300005467 Ga0070706_100010041 Ga0070706_1000100411 125
30 3300005467 Ga0070706_100311131 Ga0070706_1003111313 125
31 3300005467 Ga0070706_100467495 Ga0070706_1004674952 125
32 3300005468 Ga0070707_100236599 Ga0070707_1002365991 125
33 3300005468 Ga0070707_100374205 Ga0070707_1003742052 125
34 3300005468 Ga0070707_100446157 Ga0070707_1004461572 125
35 3300005471 Ga0070698_100018601 Ga0070698_1000186018 125
36 3300005518 Ga0070699_100107343 Ga0070699_1001073432 125
37 3300005518 Ga0070699_100284762 Ga0070699_1002847622 125
38 3300005530 Ga0070679_100029259 Ga0070679_1000292596 125
39 3300005536 Ga0070697_100000469 Ga0070697_1000004693 125
40 3300005536 Ga0070697_100025400 Ga0070697_1000254001 125
41 3300005536 Ga0070697_100605768 Ga0070697_1006057681 125
42 3300005539 Ga0068853_100421015 Ga0068853_1004210153 125
43 3300005548 Ga0070665_100093640 Ga0070665_1000936403 125
44 3300005843 Ga0068860_100167763 Ga0068860_1001677633 125
45 3300006028 Ga0070717_10091873 Ga0070717_100918733 125
46 3300006028 Ga0070717_10133290 Ga0070717_101332902 125
47 3300006028 Ga0070717_10176389 Ga0070717_101763893 125
48 3300006028 Ga0070717_10888398 Ga0070717_108883982 125
49 3300006163 Ga0070715_10473439 Ga0070715_104734391 125
50 3300006173 Ga0070716_100088569 Ga0070716_1000885694 125
51 3300006173 Ga0070716_100128775 Ga0070716_1001287752 125
52 3300006173 Ga0070716_101140209 Ga0070716_1011402092 125
53 3300006175 Ga0070712_100002436 Ga0070712_1000024368 125
54 3300006175 Ga0070712_100107152 Ga0070712_1001071523 125
55 3300006175 Ga0070712_100376024 Ga0070712_1003760243 125
56 3300006846 Ga0075430_100456876 Ga0075430_1004568762 125
57 3300006852 Ga0075433_10071415 Ga0075433_100714154 125
58 3300006871 Ga0075434_100012196 Ga0075434_10001219611 125
59 3300006881 Ga0068865_100711329 Ga0068865_1007113291 125
60 3300006914 Ga0075436_100025395 Ga0075436_1000253954 125
61 3300006914 Ga0075436_100556537 Ga0075436_1005565371 125
62 3300006914 Ga0075436_100924167 Ga0075436_1009241671 125
63 3300007076 Ga0075435_100119540 Ga0075435_1001195403 125
64 3300007076 Ga0075435_100647443 Ga0075435_1006474432 125
65 3300007265 Ga0099794_10019446 Ga0099794_100194462 125
66 3300007265 Ga0099794_10025737 Ga0099794_100257373 125
67 3300007265 Ga0099794_10030137 Ga0099794_100301374 125
68 3300007265 Ga0099794_10080899 Ga0099794_100808992 125
69 3300007265 Ga0099794_10277142 Ga0099794_102771422 125
70 3300007265 Ga0099794_10325588 Ga0099794_103255882 125
71 3300007788 Ga0099795_10490631 Ga0099795_104906312 125
72 3300009093 Ga0105240_10493852 Ga0105240_104938522 125
73 3300009176 Ga0105242_10170913 Ga0105242_101709134 125
74 3300009177 Ga0105248_10522403 Ga0105248_105224033 125
75 3300009545 Ga0105237_10073487 Ga0105237_100734875 125
76 3300009553 Ga0105249_10531647 Ga0105249_105316471 125
77 3300010159 Ga0099796_10207443 Ga0099796_102074432 125
78 3300013104 Ga0157370_10085411 Ga0157370_100854113 125
79 3300013105 Ga0157369_10159907 Ga0157369_101599073 125
80 3300013297 Ga0157378_10021395 Ga0157378_100213957 125
81 3300013306 Ga0163162_11544166 Ga0163162_115441662 125
82 3300013306 Ga0163162_12369467 Ga0163162_123694671 125
83 3300013308 Ga0157375_10000330 Ga0157375_1000033022 125
84 3300014325 Ga0163163_12482541 Ga0163163_124825411 125
85 3300014968 Ga0157379_10721648 Ga0157379_107216482 125
86 3300020069 Ga0197907_10883768 Ga0197907_108837681 125
87 3300020078 Ga0206352_10735433 Ga0206352_107354331 125
88 3300021377 Ga0213874_10007025 Ga0213874_100070252 125
89 3300021441 Ga0213871_10048459 Ga0213871_100484593 125
90 3300024225 Ga0224572_1009439 Ga0224572_10094391 125
91 3300024227 Ga0228598_1006290 Ga0228598_10062901 125
92 3300025898 Ga0207692_10059432 Ga0207692_100594322 125
93 3300025898 Ga0207692_10208275 Ga0207692_102082751 125
94 3300025905 Ga0207685_10317784 Ga0207685_103177842 125
95 3300025906 Ga0207699_10377062 Ga0207699_103770622 125
96 3300025906 Ga0207699_11202448 Ga0207699_112024481 125
97 3300025910 Ga0207684_10001186 Ga0207684_1000118623 125
98 3300025910 Ga0207684_11051704 Ga0207684_110517041 125
99 3300025912 Ga0207707_10042781 Ga0207707_100427813 125
100 3300025913 Ga0207695_10708308 Ga0207695_107083082 125
101 3300025915 Ga0207693_10004751 Ga0207693_100047518 125
102 3300025915 Ga0207693_10005878 Ga0207693_100058783 125
103 3300025915 Ga0207693_10213855 Ga0207693_102138553 125
104 3300025916 Ga0207663_10072721 Ga0207663_100727214 125
105 3300025916 Ga0207663_11372207 Ga0207663_113722072 125
106 3300025917 Ga0207660_10058015 Ga0207660_100580156 125
107 3300025921 Ga0207652_10044487 Ga0207652_100444876 125
108 3300025922 Ga0207646_10000405 Ga0207646_1000040521 125
109 3300025922 Ga0207646_10016623 Ga0207646_100166232 125
110 3300025928 Ga0207700_10198342 Ga0207700_101983421 125
111 3300025928 Ga0207700_10201598 Ga0207700_102015982 125
112 3300025928 Ga0207700_10526969 Ga0207700_105269692 125
113 3300025929 Ga0207664_10025205 Ga0207664_100252058 125
114 3300025938 Ga0207704_11093070 Ga0207704_110930701 125
115 3300025939 Ga0207665_10243137 Ga0207665_102431372 125
116 3300025939 Ga0207665_10833406 Ga0207665_108334062 125
117 3300025941 Ga0207711_10554465 Ga0207711_105544652 125
118 3300026041 Ga0207639_10389698 Ga0207639_103896983 125
119 3300026088 Ga0207641_10351621 Ga0207641_103516212 125
120 3300027671 Ga0209588_1048695 Ga0209588_10486953 125
121 3300027671 Ga0209588_1077593 Ga0209588_10775932 125
122 3300027671 Ga0209588_1186109 Ga0209588_11861091 125
123 3300028017 Ga0265356_1000154 Ga0265356_100015414 125
124 3300028379 Ga0268266_10000194 Ga0268266_1000019478 125
125 3300028800 Ga0265338_10189659 Ga0265338_101896593 125
126 3300030878 Ga0265770_1049884 Ga0265770_10498841 125
127 3300031018 Ga0265773_1026477 Ga0265773_10264771 125
128 3300031249 Ga0265339_10054860 Ga0265339_100548603 125
129 3300031249 Ga0265339_10134298 Ga0265339_101342982 125
130 3300031344 Ga0265316_10105405 Ga0265316_101054053 125
131 3300031711 Ga0265314_10205344 Ga0265314_102053442 125
132 3300035120 Ga0373957_0023119 Ga0373957_0023119_53_448 125
133 3300035170 Ga0373943_0290903 Ga0373943_0290903_159_554 125
134 3300035170 Ga0373943_0457468 Ga0373943_0457468_310_720 125
135 3300035410 Ga0373924_0033753 Ga0373924_0033753_158_553 125
136 3300035410 Ga0373924_0115374 Ga0373924_0115374_488_883 125
137 3300035691 Ga0373931_0131550 Ga0373931_0131550_861_1256 125
138 3300035691 Ga0373931_0251355 Ga0373931_0251355_363_785 125
139 3300035691 Ga0373931_0429436 Ga0373931_0429436_175_570 125
140 3300035695 Ga0373927_0055297 Ga0373927_0055297_1661_2056 125
141 3300035695 Ga0373927_0277334 Ga0373927_0277334_336_746 125
142 3300035724 Ga0373933_0070389 Ga0373933_0070389_896_1291 125
143 3300035724 Ga0373933_0215499 Ga0373933_0215499_686_1081 125
144 3300035725 Ga0373947_0228443 Ga0373947_0228443_415_810 125
145 3300035725 Ga0373947_0800141 Ga0373947_0800141_159_569 125
146 3300036401 Ga0373937_0013332 Ga0373937_0013332_5042_5437 125
147 3300036401 Ga0373937_0122918 Ga0373937_0122918_1742_2137 125
148 3300037068 Ga0373925_0008776 Ga0373925_0008776_5822_6217 125
149 3300037068 Ga0373925_0442840 Ga0373925_0442840_46_441 125
150 3300037068 Ga0373925_0899433 Ga0373925_0899433_182_562 125
151 3300039437 Ga0436365_0533427 Ga0436365_0533427_43_438 125
152 3300039437 Ga0436365_1422643 Ga0436365_1422643_241_645 125
153 3300039438 Ga0436360_0521402 Ga0436360_0521402_853_1248 125
154 3300039438 Ga0436360_0946856 Ga0436360_0946856_513_908 125
155 3300039438 Ga0436360_1029658 Ga0436360_1029658_691_1086 125
156 3300039447 Ga0436361_0383882 Ga0436361_0383882_560_955 125
157 3300039447 Ga0436361_0663931 Ga0436361_0663931_112_510 125
158 3300039450 Ga0436363_0050582 Ga0436363_0050582_217_612 125
159 3300039450 Ga0436363_0562101 Ga0436363_0562101_689_1084 125
160 3300039450 Ga0436363_1543130 Ga0436363_1543130_2047_2442 125
161 3300039453 Ga0436362_0052030 Ga0436362_0052030_208_603 125
162 3300039453 Ga0436362_0099984 Ga0436362_0099984_358_756 125
163 3300042001 Ga0439441_026488 Ga0439441_026488_175_570 125
164 3300046454 Ga0495592_0178892 Ga0495592_0178892_917_1312 125
165 3300046457 Ga0495590_0070156 Ga0495590_0070156_521_916 125
166 3300046459 Ga0495629_0401801 Ga0495629_0401801_47_442 125
167 3300046462 Ga0495651_0000645 Ga0495651_0000645_438_833 125
168 3300046462 Ga0495651_0175088 Ga0495651_0175088_110_505 125
169 3300046463 Ga0495653_0141199 Ga0495653_0141199_829_1224 125
170 3300046472 Ga0495580_0308518 Ga0495580_0308518_202_597 125
171 3300046477 Ga0495664_0046717 Ga0495664_0046717_466_861 125
172 3300046477 Ga0495664_0165369 Ga0495664_0165369_57_452 125
173 3300046559 Ga0495667_0070939 Ga0495667_0070939_475_870 125
174 3300046678 Ga0495599_0031526 Ga0495599_0031526_2084_2479 125
175 3300046809 Ga0495600_0022351 Ga0495600_0022351_269_664 125
176 3300047319 Ga0495674_0667487 Ga0495674_0667487_323_718 125
177 3300047322 Ga0495680_0001235 Ga0495680_0001235_458_853 125
178 3300047444 Ga0495675_0129600 Ga0495675_0129600_875_1270 125
179 3300050493 nmdc:mga0k408_223373_c1 nmdc:mga0k408_223373_c1_692_1090 125
180 3300050509 nmdc:mga0qj67_437082_c1 nmdc:mga0qj67_437082_c1_508_888 125
181 3300050513 nmdc:mga0rr50_146416_c1 nmdc:mga0rr50_146416_c1_718_1113 125
182 3300050513 nmdc:mga0rr50_608642_c1 nmdc:mga0rr50_608642_c1_271_666 125
183 3300050514 nmdc:mga08x19_1310612_c1 nmdc:mga08x19_1310612_c1_81_476 125
184 3300050514 nmdc:mga08x19_526215_c1 nmdc:mga08x19_526215_c1_25_420 125
185 3300050514 nmdc:mga08x19_744844_c1 nmdc:mga08x19_744844_c1_164_559 125
186 3300050515 nmdc:mga0a205_10437_c3 nmdc:mga0a205_10437_c3_1137_1532 125
187 3300053088 Ga0500644_0078738 Ga0500644_0078738_566_961 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

132

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6drh-assembly2.cif.gz_C adp-ribosyltransferase toxin/immunity pair 0.5218 43 91
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.5075 2 114
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.4717 1 124
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.4651 1 124
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.4607 2 114
ID Description Score Start End Superfamily
af_O53219_2_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5248 5 116 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5242 5 103 3.40.50.1010
af_P9WF53_3_131_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5191 5 114 3.40.50.1010
af_P9WF61_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5082 3 105 3.40.50.1010
af_P9WF79_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.5029 5 117 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1F9DKG9-F1-model_v4 PIN domain-containing protein 0.9884 1 125
AF-A0A1W9I9A5-F1-model_v4 deleted 0.9822 1 125
AF-D5H6J9-F1-model_v4 PIN domain-containing protein 0.9816 35 125
AF-A0A1F9DKG9-F1-model_v4 PIN domain-containing protein 0.9806 1 125
AF-A0A7V5WNQ2-F1-model_v4 PIN domain-containing protein 0.9761 1 96

Feature Viewer

pLDDT pTM Quality
97.87 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map