F286694

General Info

Members Datasets Scaffolds Average Seq Length
186 152 147 260

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0057194|Ga0501046_0057194_895_1770
Length 291
Sequence MAARAYWKGYLKLSLVICPVALYPASSKSQKTRFHQINKKTGHRLRQQMVDEETGRAVDGDSKGRGYELAKGKFVQIEPEEIEAIEFENTHTIEIDEFVPEEEIDKRYYERPYYIVPDGKSGEEAFGVIRDAMKDKGRVALAGIIFANRQHILAIEPWGKGMLGTTLRFDHEVRDEKEFFKGIGSHRVPKEMVSLAVHILDTKAGHFDPAKFKDEYELALRKLVKRKAAGKTIEAPEEKEDRSNVIDLMEALRQSVKSRGRRVAAALSSTTGSKKTSKPRTRSKQRKRKAA

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
3 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
4 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
5 2643221688 Rhizobium sp. Root482 Isolate Unclassified
6 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
7 2751185800 Brucella pituitosa AA2 Isolate Unclassified
8 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
9 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
10 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
11 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
12 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
13 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
14 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
15 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
16 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
17 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
18 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
19 2842694124 Methylopila sp. R-72369 Isolate Unclassified
20 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
21 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
22 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
23 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
24 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
25 2909042592 Labrys sp. LIt4 Isolate Nodule
26 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
27 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
28 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
29 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
30 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
31 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
32 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
39 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
74 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
138 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
147 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
148 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
149 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
150 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
151 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
152 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.88
Metatranscriptomes 2.15
Isolates 20.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.29
Nodule 6.45
Rhizoplane 1.08
Rhizosphere 52.15
Stem 0
Stem Tuber 0
Unclassified 29.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000123 3300001979 Bacteria 28912
2 JGI25155J39150_1000027 3300002704 Bacteria 123955
3 JGI25156J39149_1000008 3300002705 Bacteria 229035
4 JGI25162J39368_1000196 3300002737 Bacteria 63573
5 JGI25154J39366_1000050 3300002738 Bacteria 124480
6 JGI25157J39369_1000028 3300002741 Bacteria 147384
7 JGI25159J45721_1000337 3300002987 Bacteria 21692
8 JGI25165J46597_1000149 3300003214 Bacteria 115839
9 JGI25165J46597_1000292 3300003214 Bacteria 63577
10 rootL2_10070114 3300003322 Bacteria 3390
11 rootL2_10241573 3300003322 Bacteria 3878
12 JGI25160J50197_1000032 3300003354 Bacteria 174525
13 JGI25161J50226_1000017 3300003374 Bacteria 174525
14 Ga0055543_1000039 3300004625 Bacteria 123885
15 Ga0065165_1000179 3300005262 Bacteria 112568
16 Ga0070709_10380748 3300005434 Bacteria 1049
17 Ga0070705_100002465 3300005440 Bacteria 9293
18 Ga0070700_100061231 3300005441 Bacteria 2374
19 Ga0070694_100001244 3300005444 Bacteria 14770
20 Ga0070694_100078249 3300005444 Bacteria 2293
21 Ga0070694_100299184 3300005444 Bacteria 1232
22 Ga0070681_10184484 3300005458 Bacteria 2007
23 Ga0070681_10363195 3300005458 Bacteria 1358
24 Ga0070707_100194569 3300005468 Bacteria 1977
25 Ga0070699_100037336 3300005518 Bacteria 4203
26 Ga0070695_100007102 3300005545 Bacteria 6637
27 Ga0070695_100012888 3300005545 Bacteria 5019
28 Ga0070695_100100038 3300005545 Bacteria 1951
29 Ga0068855_100382932 3300005563 Bacteria 1544
30 Ga0068864_100162779 3300005618 Bacteria 2029
31 Ga0068860_100045449 3300005843 Bacteria 4188
32 Ga0081455_10126635 3300005937 Bacteria 2003
33 Ga0081540_1000877 3300005983 Bacteria 27171
34 Ga0075428_100013412 3300006844 Bacteria 9115
35 Ga0075430_100082216 3300006846 Bacteria 2699
36 Ga0075431_100002692 3300006847 Bacteria 17222
37 Ga0075431_100056964 3300006847 Bacteria 4030
38 Ga0075431_100166960 3300006847 Bacteria 2262
39 Ga0075434_100883764 3300006871 Bacteria 909
40 Ga0075429_100048761 3300006880 Bacteria 3682
41 Ga0114129_10003701 3300009147 Bacteria 21536
42 Ga0157369_10018243 3300013105 Bacteria 7869
43 Ga0171462_1008 3300013250 Bacteria 384318
44 Ga0182005_1003872 3300015265 Bacteria 4965
45 Ga0213873_10006987 3300021358 Bacteria 2243
46 Ga0213872_10052481 3300021361 Bacteria 1850
47 Ga0213874_10001527 3300021377 Bacteria 4820
48 Ga0213876_10001548 3300021384 Bacteria 14152
49 Ga0213875_10000244 3300021388 Bacteria 54467
50 Ga0209435_100020 3300025206 Bacteria 229105
51 Ga0209672_105773 3300025228 Bacteria 2086
52 Ga0207427_100504 3300025231 Bacteria 20685
53 Ga0209437_100312 3300025233 Bacteria 65593
54 Ga0209646_1000070 3300025246 Bacteria 229105
55 Ga0209646_1022698 3300025246 Bacteria 893
56 Ga0209026_1000057 3300025250 Bacteria 229105
57 Ga0209759_1000047 3300025256 Bacteria 229105
58 Ga0209233_1000176 3300025261 Bacteria 142863
59 Ga0209233_1000230 3300025261 Bacteria 97941
60 Ga0209130_1000092 3300025284 Bacteria 149162
61 Ga0209025_1001673 3300025294 Bacteria 27174
62 Ga0207426_1000022 3300025302 Bacteria 547377
63 Ga0207653_10014383 3300025885 Bacteria 2483
64 Ga0207647_10048109 3300025904 Bacteria 2649
65 Ga0207707_10175344 3300025912 Bacteria 1873
66 Ga0207707_10197187 3300025912 Bacteria 1756
67 Ga0207646_10168957 3300025922 Bacteria 1975
68 Ga0207659_10190294 3300025926 Bacteria 1633
69 Ga0207712_10049797 3300025961 Bacteria 2922
70 Ga0207708_10037533 3300026075 Bacteria 3690
71 Ga0207676_10147733 3300026095 Bacteria 2020
72 Ga0268265_10005386 3300028380 Bacteria 8761
73 Ga0268264_10006553 3300028381 Bacteria 9801
74 Ga0265327_10014738 3300031251 Bacteria 5093
75 Ga0307414_10042825 3300032004 Bacteria 3079
76 Ga0373927_0157038 3300035695 Bacteria 1490
77 Ga0395899_0104003 3300037312 Bacteria 2047
78 Ga0395899_0198261 3300037312 Bacteria 1401
79 Ga0395900_0616222 3300037418 Bacteria 1024
80 Ga0395905_0000927 3300037471 Bacteria 37843
81 Ga0395905_0026451 3300037471 Bacteria 5469
82 Ga0436364_0617197 3300037853 Bacteria 7253
83 Ga0436364_0816071 3300037853 Bacteria 1710
84 Ga0395901_0050021 3300038443 Bacteria 4343
85 Ga0436365_0857014 3300039437 Bacteria 61108
86 Ga0436363_0483897 3300039450 Bacteria 17315
87 Ga0436363_0687861 3300039450 Bacteria 13715
88 Ga0436362_1096634 3300039453 Bacteria 18580
89 Ga0439465_0008169 3300041413 Bacteria 3304
90 Ga0451839_0299759 3300041496 Bacteria 1308
91 Ga0466963_0001584 3300044694 Bacteria 12356
92 Ga0466970_0000211 3300044765 Bacteria 28399
93 Ga0466957_0002160 3300044842 Bacteria 10526
94 Ga0466959_0030714 3300045049 Bacteria 3978
95 Ga0466958_0115610 3300045836 Bacteria 1676
96 Ga0495638_0013123 3300046460 Bacteria 5655
97 Ga0495638_0194368 3300046460 Bacteria 1149
98 Ga0496116_0079329 3300048919 Bacteria 2044
99 Ga0496119_0000519 3300048922 Bacteria 52339
100 Ga0496119_0003396 3300048922 Bacteria 16541
101 Ga0496119_0190539 3300048922 Bacteria 1069
102 Ga0496120_0019568 3300048923 Bacteria 4327
103 Ga0496120_0123007 3300048923 Bacteria 1339
104 Ga0496120_0195193 3300048923 Bacteria 984
105 Ga0496121_0057265 3300048924 Bacteria 3232
106 Ga0496122_0009068 3300048925 Bacteria 10558
107 Ga0496122_0026750 3300048925 Bacteria 4960
108 Ga0496123_0003048 3300048926 Bacteria 19280
109 Ga0496123_0006442 3300048926 Bacteria 11373
110 Ga0496124_0118326 3300048927 Bacteria 2121
111 Ga0496125_0000106 3300048928 Bacteria 199193
112 Ga0496125_0094223 3300048928 Bacteria 2232
113 Ga0501032_0291376 3300049569 Bacteria 1056
114 Ga0501033_0119677 3300049570 Bacteria 1912
115 Ga0501034_0002441 3300049571 Bacteria 22430
116 Ga0501034_0005760 3300049571 Bacteria 13476
117 Ga0501034_0050042 3300049571 Bacteria 4215
118 Ga0501034_0149582 3300049571 Bacteria 2311
119 Ga0501034_0643425 3300049571 Bacteria 962
120 Ga0501038_0022142 3300049574 Bacteria 5696
121 Ga0501046_0057194 3300049580 Bacteria 3060
122 Ga0501047_0051904 3300049581 Bacteria 3963
123 Ga0501047_0185985 3300049581 Bacteria 1943
124 Ga0501068_0271442 3300049584 Bacteria 1083
125 Ga0501073_0216541 3300049589 Bacteria 1323
126 Ga0501077_0061511 3300049593 Bacteria 2383
127 Ga0501035_0178446 3300049822 Bacteria 1831
128 Ga0501044_0311756 3300049823 Bacteria 1500
129 nmdc:mga05p37_233_c1 3300050507 Bacteria 56600
130 nmdc:mga09592_10811_c1 3300050508 Bacteria 7423
131 nmdc:mga09592_30818_c1 3300050508 Bacteria 4465
132 nmdc:mga0qj67_125051_c1 3300050509 Bacteria 2081
133 nmdc:mga0qj67_31928_c1 3300050509 Bacteria 4105
134 nmdc:mga0qj67_67782_c1 3300050509 Bacteria 2843
135 nmdc:mga06r32_1082_c1 3300050510 Bacteria 24455
136 nmdc:mga06r32_94_c1 3300050510 Bacteria 61840
137 nmdc:mga06r32_99219_c1 3300050510 Bacteria 2856
138 nmdc:mga08y16_95661_c1 3300050511 Bacteria 3094
139 Ga0500644_0001730 3300053088 Bacteria 5670
140 Ga0500618_000778 3300053125 Bacteria 17927
141 Ga0500616_0072661 3300053153 Bacteria 1748
142 Ga0500622_0001964 3300053156 Bacteria 15479
143 Ga0500645_005837 3300053730 Bacteria 4473
144 Ga0587073_0019266 3300059492 Bacteria 1286
145 Ga0587091_031368 3300059511 Bacteria 999
146 Ga0587106_004661 3300059605 Bacteria 1520
147 Ga0587072_013685 3300059643 Bacteria 1358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100166960 Ga0075431_1001669601 193
2 3300006880 Ga0075429_100048761 Ga0075429_1000487613 193
3 3300050508 nmdc:mga09592_30818_c1 nmdc:mga09592_30818_c1_2617_3342 193
4 3300050510 nmdc:mga06r32_99219_c1 nmdc:mga06r32_99219_c1_19_744 193
5 3300050509 nmdc:mga0qj67_125051_c1 nmdc:mga0qj67_125051_c1_437_1423 220
6 3300050510 nmdc:mga06r32_94_c1 nmdc:mga06r32_94_c1_4246_5232 220
7 3300009147 Ga0114129_10003701 Ga0114129_1000370120 221
8 3300050507 nmdc:mga05p37_233_c1 nmdc:mga05p37_233_c1_49397_50386 221
9 3300050508 nmdc:mga09592_10811_c1 nmdc:mga09592_10811_c1_2826_3815 221
10 3300050511 nmdc:mga08y16_95661_c1 nmdc:mga08y16_95661_c1_243_1232 221
11 3300006844 Ga0075428_100013412 Ga0075428_1000134122 223
12 3300050509 nmdc:mga0qj67_67782_c1 nmdc:mga0qj67_67782_c1_1868_2737 223
13 3300048919 Ga0496116_0079329 Ga0496116_0079329_1255_2004 228
14 3300049569 Ga0501032_0291376 Ga0501032_0291376_16_822 228
15 3300049570 Ga0501033_0119677 Ga0501033_0119677_663_1469 228
16 3300049571 Ga0501034_0643425 Ga0501034_0643425_131_937 228
17 3300049574 Ga0501038_0022142 Ga0501038_0022142_433_1239 228
18 3300049581 Ga0501047_0185985 Ga0501047_0185985_487_1293 228
19 3300049584 Ga0501068_0271442 Ga0501068_0271442_223_1029 228
20 3300049589 Ga0501073_0216541 Ga0501073_0216541_325_1131 228
21 3300049822 Ga0501035_0178446 Ga0501035_0178446_431_1237 228
22 3300046460 Ga0495638_0013123 Ga0495638_0013123_3355_4149 233
23 3300005444 Ga0070694_100078249 Ga0070694_1000782492 238
24 3300005458 Ga0070681_10184484 Ga0070681_101844841 238
25 3300005545 Ga0070695_100100038 Ga0070695_1001000382 238
26 3300005983 Ga0081540_1000877 Ga0081540_100087733 239
27 3300025912 Ga0207707_10175344 Ga0207707_101753441 239
28 iso_pu_bacteria 2855872281 2855877125 243
29 iso_pu_bacteria 2848992105 2848996873 244
30 3300041496 Ga0451839_0299759 Ga0451839_0299759_199_990 245
31 3300048923 Ga0496120_0123007 Ga0496120_0123007_410_1207 245
32 3300048928 Ga0496125_0000106 Ga0496125_0000106_154517_155314 245
33 3300025228 Ga0209672_105773 Ga0209672_1057732 246
34 3300037471 Ga0395905_0026451 Ga0395905_0026451_2102_2851 246
35 3300044694 Ga0466963_0001584 Ga0466963_0001584_11204_12010 246
36 3300044765 Ga0466970_0000211 Ga0466970_0000211_16384_17190 246
37 3300044842 Ga0466957_0002160 Ga0466957_0002160_2498_3304 246
38 3300045049 Ga0466959_0030714 Ga0466959_0030714_2037_2843 246
39 3300045836 Ga0466958_0115610 Ga0466958_0115610_299_1105 246
40 3300048923 Ga0496120_0195193 Ga0496120_0195193_184_927 246
41 3300048925 Ga0496122_0009068 Ga0496122_0009068_8134_8979 246
42 3300037312 Ga0395899_0198261 Ga0395899_0198261_33_782 247
43 3300053730 Ga0500645_005837 Ga0500645_005837_748_1494 247
44 3300025246 Ga0209646_1022698 Ga0209646_10226981 249
45 3300039437 Ga0436365_0857014 Ga0436365_0857014_37027_37839 249
46 3300039450 Ga0436363_0687861 Ga0436363_0687861_9397_10209 249
47 3300049581 Ga0501047_0051904 Ga0501047_0051904_246_1070 249
48 3300032004 Ga0307414_10042825 Ga0307414_100428253 250
49 3300049571 Ga0501034_0005760 Ga0501034_0005760_3079_3903 253
50 3300053125 Ga0500618_000778 Ga0500618_000778_3854_4660 253
51 3300049593 Ga0501077_0061511 Ga0501077_0061511_894_1760 255
52 3300005441 Ga0070700_100061231 Ga0070700_1000612312 258
53 3300005444 Ga0070694_100299184 Ga0070694_1002991841 258
54 3300005545 Ga0070695_100007102 Ga0070695_1000071024 258
55 3300026075 Ga0207708_10037533 Ga0207708_100375332 258
56 iso_pu_bacteria 2643221688 2644493124 258
57 3300049571 Ga0501034_0002441 Ga0501034_0002441_13277_14092 259
58 iso_pu_bacteria 2909042592 2909046277 259
59 3300005440 Ga0070705_100002465 Ga0070705_1000024656 260
60 3300005444 Ga0070694_100001244 Ga0070694_10000124428 260
61 3300005458 Ga0070681_10363195 Ga0070681_103631952 260
62 3300005468 Ga0070707_100194569 Ga0070707_1001945693 260
63 3300005518 Ga0070699_100037336 Ga0070699_1000373364 260
64 3300005545 Ga0070695_100012888 Ga0070695_1000128885 260
65 3300005618 Ga0068864_100162779 Ga0068864_1001627793 260
66 3300005843 Ga0068860_100045449 Ga0068860_1000454492 260
67 3300025885 Ga0207653_10014383 Ga0207653_100143831 260
68 3300025912 Ga0207707_10197187 Ga0207707_101971873 260
69 3300025922 Ga0207646_10168957 Ga0207646_101689571 260
70 3300025961 Ga0207712_10049797 Ga0207712_100497973 260
71 3300026095 Ga0207676_10147733 Ga0207676_101477332 260
72 3300028380 Ga0268265_10005386 Ga0268265_100053864 260
73 3300028381 Ga0268264_10006553 Ga0268264_1000655312 260
74 iso_pu_bacteria 2751185800 2753361308 260
75 3300005563 Ga0068855_100382932 Ga0068855_1003829322 261
76 3300013105 Ga0157369_10018243 Ga0157369_100182438 261
77 3300025904 Ga0207647_10048109 Ga0207647_100481093 261
78 3300037312 Ga0395899_0104003 Ga0395899_0104003_638_1432 261
79 3300049571 Ga0501034_0149582 Ga0501034_0149582_1238_2023 261
80 3300006847 Ga0075431_100056964 Ga0075431_1000569644 262
81 iso_pu_bacteria 2511231027 2511392394 262
82 iso_pu_bacteria 2842871566 2842874758 262
83 iso_pu_bacteria 2917699015 2917703353 262
84 iso_pu_bacteria 2939669807 2939672497 262
85 iso_pu_bacteria 8057529695 8057535432 262
86 3300003322 rootL2_10070114 rootL2_100701142 263
87 iso_pu_bacteria 2524023209 2524459236 263
88 iso_pu_bacteria 2767802442 2770198078 263
89 iso_pu_bacteria 2839993093 2839998057 263
90 iso_pu_bacteria 2842298080 2842301024 263
91 iso_pu_bacteria 2842357229 2842359961 263
92 iso_pu_bacteria 2852387548 2852394235 263
93 iso_pu_bacteria 2920822456 2920827327 263
94 iso_pu_bacteria 2929199973 2929202269 263
95 iso_pu_bacteria 3002141150 3002145859 263
96 iso_pu_bacteria 8046767195 8046773107 263
97 iso_pu_bacteria 8055909800 8055915245 263
98 iso_pu_bacteria 8057575449 8057579671 263
99 3300005434 Ga0070709_10380748 Ga0070709_103807481 264
100 3300006871 Ga0075434_100883764 Ga0075434_1008837641 264
101 3300025294 Ga0209025_1001673 Ga0209025_10016738 264
102 3300031251 Ga0265327_10014738 Ga0265327_100147382 264
103 iso_pu_bacteria 2582581316 2585333659 264
104 iso_pu_bacteria 2667528174 2671116605 264
105 iso_pu_bacteria 2775506902 2776269927 264
106 iso_pu_bacteria 2775506904 2776281044 264
107 iso_pu_bacteria 2818991448 2819607874 264
108 iso_pu_bacteria 2838029111 2838035263 264
109 iso_pu_bacteria 2840764183 2840766071 264
110 iso_pu_bacteria 2842475841 2842482022 264
111 iso_pu_bacteria 2842502639 2842507948 264
112 iso_pu_bacteria 2842694124 2842696835 264
113 iso_pu_bacteria 2904578770 2904580329 264
114 iso_pu_bacteria 2919119836 2919119995 264
115 iso_pu_bacteria 2919408235 2919413817 264
116 iso_pu_bacteria 643692032 643822337 264
117 iso_pu_bacteria 8005484373 8005489675 264
118 iso_pu_bacteria 8005645114 8005650553 264
119 3300003214 JGI25165J46597_1000149 JGI25165J46597_1000149110 265
120 3300006846 Ga0075430_100082216 Ga0075430_1000822162 265
121 3300006847 Ga0075431_100002692 Ga0075431_1000026926 265
122 3300025231 Ga0207427_100504 Ga0207427_10050420 265
123 3300025261 Ga0209233_1000176 Ga0209233_100017657 265
124 3300025926 Ga0207659_10190294 Ga0207659_101902942 265
125 3300049580 Ga0501046_0057194 Ga0501046_0057194_895_1770 265
126 3300050509 nmdc:mga0qj67_31928_c1 nmdc:mga0qj67_31928_c1_1771_2640 265
127 3300050510 nmdc:mga06r32_1082_c1 nmdc:mga06r32_1082_c1_8524_9393 265
128 3300013250 Ga0171462_1008 Ga0171462_1008327 266
129 3300015265 Ga0182005_1003872 Ga0182005_10038722 266
130 3300021361 Ga0213872_10052481 Ga0213872_100524812 266
131 3300037471 Ga0395905_0000927 Ga0395905_0000927_16666_17475 266
132 3300048924 Ga0496121_0057265 Ga0496121_0057265_1661_2464 266
133 3300048928 Ga0496125_0094223 Ga0496125_0094223_1388_2191 266
134 iso_pu_bacteria 2643221623 2644130534 266
135 3300002987 JGI25159J45721_1000337 JGI25159J45721_100033721 267
136 3300003322 rootL2_10241573 rootL2_102415733 267
137 3300003354 JGI25160J50197_1000032 JGI25160J50197_100003283 267
138 3300003374 JGI25161J50226_1000017 JGI25161J50226_100001783 267
139 3300004625 Ga0055543_1000039 Ga0055543_100003940 267
140 3300005262 Ga0065165_1000179 Ga0065165_100017983 267
141 3300021377 Ga0213874_10001527 Ga0213874_100015273 267
142 3300025284 Ga0209130_1000092 Ga0209130_100009286 267
143 3300025302 Ga0207426_1000022 Ga0207426_1000022426 267
144 3300037853 Ga0436364_0816071 Ga0436364_0816071_623_1432 267
145 3300039450 Ga0436363_0483897 Ga0436363_0483897_9750_10559 267
146 3300048922 Ga0496119_0190539 Ga0496119_0190539_179_985 267
147 3300053153 Ga0500616_0072661 Ga0500616_0072661_591_1397 267
148 3300059492 Ga0587073_0019266 Ga0587073_0019266_442_1245 267
149 3300059511 Ga0587091_031368 Ga0587091_031368_94_897 267
150 3300059605 Ga0587106_004661 Ga0587106_004661_178_981 267
151 3300059643 Ga0587072_013685 Ga0587072_013685_442_1245 267
152 3300001979 JGI24740J21852_10000123 JGI24740J21852_1000012323 268
153 3300002704 JGI25155J39150_1000027 JGI25155J39150_100002723 268
154 3300002705 JGI25156J39149_1000008 JGI25156J39149_1000008101 268
155 3300002737 JGI25162J39368_1000196 JGI25162J39368_100019632 268
156 3300002738 JGI25154J39366_1000050 JGI25154J39366_100005023 268
157 3300002741 JGI25157J39369_1000028 JGI25157J39369_1000028103 268
158 3300003214 JGI25165J46597_1000292 JGI25165J46597_100029232 268
159 3300005937 Ga0081455_10126635 Ga0081455_101266352 268
160 3300021358 Ga0213873_10006987 Ga0213873_100069872 268
161 3300021384 Ga0213876_10001548 Ga0213876_100015482 268
162 3300021388 Ga0213875_10000244 Ga0213875_1000024445 268
163 3300025206 Ga0209435_100020 Ga0209435_10002098 268
164 3300025233 Ga0209437_100312 Ga0209437_10031235 268
165 3300025246 Ga0209646_1000070 Ga0209646_100007098 268
166 3300025250 Ga0209026_1000057 Ga0209026_1000057124 268
167 3300025256 Ga0209759_1000047 Ga0209759_1000047124 268
168 3300025261 Ga0209233_1000230 Ga0209233_100023033 268
169 3300035695 Ga0373927_0157038 Ga0373927_0157038_154_963 268
170 3300037418 Ga0395900_0616222 Ga0395900_0616222_97_909 268
171 3300037853 Ga0436364_0617197 Ga0436364_0617197_664_1482 268
172 3300038443 Ga0395901_0050021 Ga0395901_0050021_90_902 268
173 3300039453 Ga0436362_1096634 Ga0436362_1096634_12236_13054 268
174 3300041413 Ga0439465_0008169 Ga0439465_0008169_1782_2591 268
175 3300046460 Ga0495638_0194368 Ga0495638_0194368_176_1021 268
176 3300048922 Ga0496119_0000519 Ga0496119_0000519_13368_14177 268
177 3300048922 Ga0496119_0003396 Ga0496119_0003396_2203_3009 268
178 3300048923 Ga0496120_0019568 Ga0496120_0019568_1492_2298 268
179 3300048925 Ga0496122_0026750 Ga0496122_0026750_247_1053 268
180 3300048926 Ga0496123_0003048 Ga0496123_0003048_8416_9243 268
181 3300048926 Ga0496123_0006442 Ga0496123_0006442_6003_6809 268
182 3300048927 Ga0496124_0118326 Ga0496124_0118326_515_1321 268
183 3300049571 Ga0501034_0050042 Ga0501034_0050042_312_1118 268
184 3300049823 Ga0501044_0311756 Ga0501044_0311756_249_1058 268
185 3300053088 Ga0500644_0001730 Ga0500644_0001730_4066_4890 268
186 3300053156 Ga0500622_0001964 Ga0500622_0001964_8678_9502 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02735

Ku

Ku70/Ku80 beta-barrel domain

12

195

0.91

Feature Viewer

pLDDT pTM Quality
66.92 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map