F286671

General Info

Members Datasets Scaffolds Average Seq Length
186 112 372 121

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0812128|Ga0501032_0812128_20_436
Length 138
Sequence MRRFLRTPGGGTVTALAWVAVGALGGAMALARFLVDSTVARSGGASWLGEDFPIGTLAVNLSGTAALGVCSGLALSGSAYTIVAGGGLGAYTTFSTWMLESHRAGEDGDARVLWANIALSLLAGLAAVALGHWIGGLL

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
49 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
69 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
70 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
73 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
74 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
77 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
78 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
82 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
83 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
84 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
85 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
86 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
107 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
108 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
109 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
110 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
111 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 4.3
Rhizosphere 80.11
Stem 0
Stem Tuber 0
Unclassified 3.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0812128 3300049569 Bacteria 590
2 Ga0070680_100127199 3300005336 Bacteria 2129
3 Ga0070668_100459158 3300005347 Bacteria 1096
4 Ga0070659_101964378 3300005366 Bacteria 525
5 Ga0070667_100123117 3300005367 Bacteria 2258
6 Ga0070667_100941378 3300005367 Bacteria 805
7 Ga0070714_100165889 3300005435 Bacteria 2002
8 Ga0070713_100806407 3300005436 Bacteria 900
9 Ga0070713_100999160 3300005436 Bacteria 807
10 Ga0070710_10117912 3300005437 Bacteria 1603
11 Ga0070663_100018508 3300005455 Bacteria 4570
12 Ga0070663_100991916 3300005455 Bacteria 730
13 Ga0070681_10125066 3300005458 Bacteria 2504
14 Ga0070679_100016521 3300005530 Bacteria 7124
15 Ga0070684_100438818 3300005535 Bacteria 1206
16 Ga0070684_100778193 3300005535 Bacteria 894
17 Ga0070684_101373830 3300005535 Bacteria 665
18 Ga0070665_100017302 3300005548 Bacteria 7235
19 Ga0070665_100384700 3300005548 Bacteria 1411
20 Ga0068854_100838194 3300005578 Bacteria 804
21 Ga0068858_100317310 3300005842 Bacteria 1489
22 Ga0081455_10159058 3300005937 Bacteria 1733
23 Ga0075428_100016683 3300006844 Bacteria 8110
24 Ga0075431_101570767 3300006847 Bacteria 616
25 Ga0111539_10251554 3300009094 Bacteria 2057
26 Ga0105245_11035452 3300009098 Bacteria 866
27 Ga0114129_10122768 3300009147 Bacteria 3574
28 Ga0105249_10058568 3300009553 Bacteria 3530
29 Ga0163162_10852609 3300013306 Unclassified 1026
30 Ga0157372_11399849 3300013307 Bacteria 806
31 Ga0163163_10665699 3300014325 Bacteria 1104
32 Ga0157377_10466859 3300014745 Bacteria 875
33 Ga0157379_10382113 3300014968 Bacteria 1292
34 Ga0213875_10152090 3300021388 Bacteria 1084
35 Ga0207692_10094037 3300025898 Bacteria 1631
36 Ga0207680_10000179 3300025903 Bacteria 30919
37 Ga0207705_10194292 3300025909 Bacteria 1536
38 Ga0207707_10237750 3300025912 Bacteria 1584
39 Ga0207660_11320271 3300025917 Bacteria 586
40 Ga0207652_10001427 3300025921 Bacteria 21179
41 Ga0207668_10304122 3300025972 Bacteria 1317
42 Ga0207668_10735918 3300025972 Bacteria 869
43 Ga0207658_10001445 3300025986 Bacteria 18520
44 Ga0207677_10951300 3300026023 Bacteria 777
45 Ga0207703_10104503 3300026035 Bacteria 2406
46 Ga0207678_10014311 3300026067 Bacteria 6975
47 Ga0207702_11116800 3300026078 Bacteria 782
48 Ga0207702_11287831 3300026078 Bacteria 725
49 Ga0207641_12504116 3300026088 Bacteria 514
50 Ga0207676_11812190 3300026095 Bacteria 609
51 Ga0207683_10615394 3300026121 Bacteria 1005
52 Ga0207428_10397821 3300027907 Bacteria 1009
53 Ga0268266_10001487 3300028379 Bacteria 27807
54 Ga0268266_10006065 3300028379 Bacteria 11134
55 Ga0268266_10110903 3300028379 Bacteria 2430
56 Ga0268266_10186632 3300028379 Bacteria 1891
57 Ga0265338_10022710 3300028800 Bacteria 6480
58 Ga0265338_10901025 3300028800 Bacteria 602
59 Ga0307411_11221611 3300032005 Bacteria 682
60 Ga0316583_10242399 3300032133 Bacteria 624
61 Ga0373933_0614685 3300035724 Bacteria 714
62 Ga0436364_0307535 3300037853 Bacteria 551
63 Ga0436364_0564148 3300037853 Bacteria 7088
64 Ga0395901_1617245 3300038443 Bacteria 601
65 Ga0466969_0010161 3300044656 Bacteria 4992
66 Ga0466969_0090355 3300044656 Bacteria 1452
67 Ga0466966_0067848 3300044684 Bacteria 2240
68 Ga0466966_0145329 3300044684 Bacteria 1448
69 Ga0466961_0005947 3300044693 Bacteria 7731
70 Ga0466961_0006702 3300044693 Bacteria 7328
71 Ga0466961_0664674 3300044693 Unclassified 625
72 Ga0466963_0000581 3300044694 Bacteria 17359
73 Ga0466963_0006500 3300044694 Bacteria 6919
74 Ga0466963_0015904 3300044694 Bacteria 4671
75 Ga0466963_0048850 3300044694 Bacteria 2797
76 Ga0466963_0311960 3300044694 Bacteria 1107
77 Ga0466963_0437046 3300044694 Bacteria 923
78 Ga0466963_0884815 3300044694 Bacteria 629
79 Ga0466964_0136364 3300044706 Bacteria 1123
80 Ga0466964_0754511 3300044706 Bacteria 546
81 Ga0466971_0001338 3300044719 Bacteria 10305
82 Ga0466971_0032875 3300044719 Bacteria 2324
83 Ga0466971_0101996 3300044719 Bacteria 1319
84 Ga0466968_0031308 3300044735 Bacteria 2207
85 Ga0466968_0090781 3300044735 Bacteria 1353
86 Ga0466968_0168831 3300044735 Bacteria 1013
87 Ga0466970_0343625 3300044765 Bacteria 846
88 Ga0466957_0007889 3300044842 Bacteria 6038
89 Ga0466957_0091579 3300044842 Bacteria 1906
90 Ga0466957_0157470 3300044842 Bacteria 1473
91 Ga0466957_0163093 3300044842 Bacteria 1448
92 Ga0466957_1120424 3300044842 Bacteria 568
93 Ga0466959_0009410 3300045049 Bacteria 6950
94 Ga0466959_0057414 3300045049 Bacteria 2837
95 Ga0466959_0392611 3300045049 Bacteria 944
96 Ga0466958_0002001 3300045836 Bacteria 10031
97 Ga0466958_0005621 3300045836 Bacteria 6764
98 Ga0466958_0018378 3300045836 Bacteria 4057
99 Ga0466958_0021857 3300045836 Bacteria 3742
100 Ga0466958_0022045 3300045836 Bacteria 3726
101 Ga0466958_0026044 3300045836 Bacteria 3454
102 Ga0466958_0100783 3300045836 Bacteria 1796
103 Ga0466967_0000001 3300045976 Bacteria 229823
104 Ga0466967_0043338 3300045976 Bacteria 3896
105 Ga0466967_0127322 3300045976 Bacteria 2360
106 Ga0466967_0170508 3300045976 Bacteria 2047
107 Ga0466967_0224469 3300045976 Bacteria 1786
108 Ga0466967_0331574 3300045976 Bacteria 1470
109 Ga0466967_0800212 3300045976 Bacteria 936
110 Ga0466967_0806371 3300045976 Bacteria 932
111 Ga0466967_1007524 3300045976 Bacteria 829
112 Ga0466967_1755577 3300045976 Unclassified 618
113 Ga0495651_0627720 3300046462 Bacteria 675
114 Ga0495653_0001066 3300046463 Bacteria 21108
115 Ga0495618_0000142 3300046514 Bacteria 51147
116 Ga0495630_0001322 3300046517 Bacteria 17035
117 Ga0495645_0000636 3300046543 Bacteria 24169
118 Ga0495657_0003197 3300046675 Bacteria 13492
119 Ga0495649_0576238 3300046694 Bacteria 556
120 Ga0495674_0945328 3300047319 Unclassified 663
121 Ga0495672_0024634 3300047320 Bacteria 3872
122 Ga0495672_0247816 3300047320 Bacteria 866
123 Ga0495672_0339294 3300047320 Bacteria 701
124 Ga0495686_0075867 3300047472 Bacteria 2061
125 Ga0496101_0114101 3300048904 Bacteria 2037
126 Ga0496102_0065173 3300048905 Bacteria 3338
127 Ga0496103_0350341 3300048906 Bacteria 949
128 Ga0496105_0414865 3300048908 Bacteria 1067
129 Ga0496107_0400934 3300048910 Bacteria 1020
130 Ga0496109_0477527 3300048912 Bacteria 1177
131 Ga0496110_0822015 3300048913 Bacteria 834
132 Ga0496115_1429901 3300048918 Unclassified 509
133 Ga0496116_0000229 3300048919 Bacteria 104677
134 Ga0496117_0006451 3300048920 Bacteria 11870
135 Ga0496117_0305572 3300048920 Bacteria 840
136 Ga0496117_0500994 3300048920 Bacteria 589
137 Ga0496118_0005821 3300048921 Bacteria 13815
138 Ga0496118_0034256 3300048921 Bacteria 4148
139 Ga0496118_0121909 3300048921 Bacteria 1697
140 Ga0496119_0001270 3300048922 Bacteria 31302
141 Ga0496119_0009129 3300048922 Bacteria 8580
142 Ga0496119_0313635 3300048922 Bacteria 769
143 Ga0496120_0002500 3300048923 Bacteria 18450
144 Ga0496121_0028116 3300048924 Bacteria 5241
145 Ga0496121_0055298 3300048924 Bacteria 3308
146 Ga0496121_0087350 3300048924 Bacteria 2448
147 Ga0496121_0418020 3300048924 Bacteria 873
148 Ga0496124_0159848 3300048927 Bacteria 1757
149 Ga0496125_0047110 3300048928 Bacteria 3609
150 Ga0496125_0161574 3300048928 Bacteria 1521
151 Ga0496126_0017324 3300048929 Bacteria 7180
152 Ga0496126_0333830 3300048929 Bacteria 1243
153 Ga0496126_0390266 3300048929 Bacteria 1131
154 Ga0501034_0143241 3300049571 Bacteria 2369
155 Ga0501043_0682955 3300049579 Bacteria 751
156 Ga0501047_0024034 3300049581 Bacteria 5852
157 Ga0501047_0054887 3300049581 Bacteria 3853
158 Ga0501047_0164685 3300049581 Bacteria 2088
159 Ga0501047_1022562 3300049581 Bacteria 640
160 Ga0501047_1104296 3300049581 Bacteria 606
161 Ga0501067_0074810 3300049583 Bacteria 1877
162 Ga0501070_0030834 3300049586 Bacteria 4491
163 Ga0501072_1108491 3300049588 Bacteria 616
164 Ga0501073_0291606 3300049589 Bacteria 1126
165 Ga0501074_0375350 3300049590 Bacteria 1009
166 Ga0501080_0482746 3300049742 Bacteria 1109
167 Ga0501080_0511121 3300049742 Bacteria 1073
168 Ga0501083_0223177 3300049744 Unclassified 1227
169 Ga0501035_0074600 3300049822 Bacteria 3001
170 Ga0501035_0290476 3300049822 Bacteria 1380
171 Ga0501044_0141547 3300049823 Bacteria 2394
172 Ga0501044_0476238 3300049823 Unclassified 1152
173 Ga0501044_1011257 3300049823 Bacteria 703
174 nmdc:mga05p37_441281_c1 3300050507 Bacteria 1509
175 nmdc:mga06r32_1369827_c1 3300050510 Bacteria 650
176 nmdc:mga08y16_202530_c1 3300050511 Bacteria 2057
177 Ga0495601_0001981 3300053077 Bacteria 11457
178 Ga0495601_0151370 3300053077 Bacteria 1515
179 Ga0495612_0000044 3300053078 Bacteria 61126
180 Ga0500635_0010412 3300053080 Bacteria 2611
181 Ga0500650_0348492 3300053098 Bacteria 648
182 Ga0500595_007616 3300053119 Bacteria 4482
183 Ga0500595_021895 3300053119 Bacteria 2274
184 Ga0500652_000418 3300053131 Bacteria 15202
185 Ga0466962_0002829 3300061719 Bacteria 8260
186 Ga0466962_0056801 3300061719 Bacteria 1869
187 Ga0501032_0812128
188 Ga0070680_100127199
189 Ga0070668_100459158
190 Ga0070659_101964378
191 Ga0070667_100123117
192 Ga0070667_100941378
193 Ga0070714_100165889
194 Ga0070713_100806407
195 Ga0070713_100999160
196 Ga0070710_10117912
197 Ga0070663_100018508
198 Ga0070663_100991916
199 Ga0070681_10125066
200 Ga0070679_100016521
201 Ga0070684_100438818
202 Ga0070684_100778193
203 Ga0070684_101373830
204 Ga0070665_100017302
205 Ga0070665_100384700
206 Ga0068854_100838194
207 Ga0068858_100317310
208 Ga0081455_10159058
209 Ga0075428_100016683
210 Ga0075431_101570767
211 Ga0111539_10251554
212 Ga0105245_11035452
213 Ga0114129_10122768
214 Ga0105249_10058568
215 Ga0163162_10852609
216 Ga0157372_11399849
217 Ga0163163_10665699
218 Ga0157377_10466859
219 Ga0157379_10382113
220 Ga0213875_10152090
221 Ga0207692_10094037
222 Ga0207680_10000179
223 Ga0207705_10194292
224 Ga0207707_10237750
225 Ga0207660_11320271
226 Ga0207652_10001427
227 Ga0207668_10304122
228 Ga0207668_10735918
229 Ga0207658_10001445
230 Ga0207677_10951300
231 Ga0207703_10104503
232 Ga0207678_10014311
233 Ga0207702_11116800
234 Ga0207702_11287831
235 Ga0207641_12504116
236 Ga0207676_11812190
237 Ga0207683_10615394
238 Ga0207428_10397821
239 Ga0268266_10001487
240 Ga0268266_10006065
241 Ga0268266_10110903
242 Ga0268266_10186632
243 Ga0265338_10022710
244 Ga0265338_10901025
245 Ga0307411_11221611
246 Ga0316583_10242399
247 Ga0373933_0614685
248 Ga0436364_0307535
249 Ga0436364_0564148
250 Ga0395901_1617245
251 Ga0466969_0010161
252 Ga0466969_0090355
253 Ga0466966_0067848
254 Ga0466966_0145329
255 Ga0466961_0005947
256 Ga0466961_0006702
257 Ga0466961_0664674
258 Ga0466963_0000581
259 Ga0466963_0006500
260 Ga0466963_0015904
261 Ga0466963_0048850
262 Ga0466963_0311960
263 Ga0466963_0437046
264 Ga0466963_0884815
265 Ga0466964_0136364
266 Ga0466964_0754511
267 Ga0466971_0001338
268 Ga0466971_0032875
269 Ga0466971_0101996
270 Ga0466968_0031308
271 Ga0466968_0090781
272 Ga0466968_0168831
273 Ga0466970_0343625
274 Ga0466957_0007889
275 Ga0466957_0091579
276 Ga0466957_0157470
277 Ga0466957_0163093
278 Ga0466957_1120424
279 Ga0466959_0009410
280 Ga0466959_0057414
281 Ga0466959_0392611
282 Ga0466958_0002001
283 Ga0466958_0005621
284 Ga0466958_0018378
285 Ga0466958_0021857
286 Ga0466958_0022045
287 Ga0466958_0026044
288 Ga0466958_0100783
289 Ga0466967_0000001
290 Ga0466967_0043338
291 Ga0466967_0127322
292 Ga0466967_0170508
293 Ga0466967_0224469
294 Ga0466967_0331574
295 Ga0466967_0800212
296 Ga0466967_0806371
297 Ga0466967_1007524
298 Ga0466967_1755577
299 Ga0495651_0627720
300 Ga0495653_0001066
301 Ga0495618_0000142
302 Ga0495630_0001322
303 Ga0495645_0000636
304 Ga0495657_0003197
305 Ga0495649_0576238
306 Ga0495674_0945328
307 Ga0495672_0024634
308 Ga0495672_0247816
309 Ga0495672_0339294
310 Ga0495686_0075867
311 Ga0496101_0114101
312 Ga0496102_0065173
313 Ga0496103_0350341
314 Ga0496105_0414865
315 Ga0496107_0400934
316 Ga0496109_0477527
317 Ga0496110_0822015
318 Ga0496115_1429901
319 Ga0496116_0000229
320 Ga0496117_0006451
321 Ga0496117_0305572
322 Ga0496117_0500994
323 Ga0496118_0005821
324 Ga0496118_0034256
325 Ga0496118_0121909
326 Ga0496119_0001270
327 Ga0496119_0009129
328 Ga0496119_0313635
329 Ga0496120_0002500
330 Ga0496121_0028116
331 Ga0496121_0055298
332 Ga0496121_0087350
333 Ga0496121_0418020
334 Ga0496124_0159848
335 Ga0496125_0047110
336 Ga0496125_0161574
337 Ga0496126_0017324
338 Ga0496126_0333830
339 Ga0496126_0390266
340 Ga0501034_0143241
341 Ga0501043_0682955
342 Ga0501047_0024034
343 Ga0501047_0054887
344 Ga0501047_0164685
345 Ga0501047_1022562
346 Ga0501047_1104296
347 Ga0501067_0074810
348 Ga0501070_0030834
349 Ga0501072_1108491
350 Ga0501073_0291606
351 Ga0501074_0375350
352 Ga0501080_0482746
353 Ga0501080_0511121
354 Ga0501083_0223177
355 Ga0501035_0074600
356 Ga0501035_0290476
357 Ga0501044_0141547
358 Ga0501044_0476238
359 Ga0501044_1011257
360 nmdc:mga05p37_441281_c1
361 nmdc:mga06r32_1369827_c1
362 nmdc:mga08y16_202530_c1
363 Ga0495601_0001981
364 Ga0495601_0151370
365 Ga0495612_0000044
366 Ga0500635_0010412
367 Ga0500650_0348492
368 Ga0500595_007616
369 Ga0500595_021895
370 Ga0500652_000418
371 Ga0466962_0002829
372 Ga0466962_0056801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

17

132

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bx5-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 with monobody s12 0.899 5 117
5a43-assembly1.cif.gz_B crystal structure of a dual topology fluoride ion channel. 0.8939 5 120
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.8929 2 120
7kkb-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81c with bromide 0.8903 5 120
5kbn-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 f80i mutant 0.8854 5 117
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9831 8 114 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9566 8 114 1.10.287.70
af_Q2FXE5_5_115_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9174 12 114 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9163 12 116 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8903 12 114 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A5B8TZE5-F1-model_v4 Fluoride-specific ion channel FluC 0.9877 2 118 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A5B8UC75-F1-model_v4 Fluoride-specific ion channel FluC 0.9874 1 120 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A0R1KYM9-F1-model_v4 Fluoride-specific ion channel FluC 0.9853 35 121 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A552ZDL6-F1-model_v4 Fluoride-specific ion channel FluC 0.9837 4 121 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A1Q3NIL5-F1-model_v4 deleted 0.9815 1 117

Map