F286644

General Info

Members Datasets Scaffolds Average Seq Length
186 150 372 216

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0214162|Ga0496118_0214162_20_706
Length 228
Sequence VLVSWPCKPGERPIGRHDLVFVSPEGWRAMLATRGELAADPLVARWSDMGWPTIRRRAMPSEASGVALGLPLPPAAGKKRLCFLLQSDDIISVARSPLLNDARASAPRSWWPALDRLDELAFHHSVEARAFGSLAWRALTGLDYLTDRSDLDLLLDVGRDADLDRLVTDVAAIETDAPMRLDGELMREDGAAVNWREFHAGAGEILVKAIEGVRLLDRDLFISERTRS

Samples

Sample ID Description Type Environment
1 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
71 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
72 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
76 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
77 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
78 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
79 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
82 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
83 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
84 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
96 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
97 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
100 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
108 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
109 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
110 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
113 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
116 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
117 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
118 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
119 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
120 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
121 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
122 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
123 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
124 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
125 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
126 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
127 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
128 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
129 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
130 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
131 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
132 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
133 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
134 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
135 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
136 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
137 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
138 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
139 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
140 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
141 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
142 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
143 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
144 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
145 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
146 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
147 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
148 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
149 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
150 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.65
Metatranscriptomes 0
Isolates 19.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.58
Nodule 15.05
Rhizoplane 3.23
Rhizosphere 47.85
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496118_0214162 3300048921 Bacteria 1128
2 JGI25153J46596_10003877 3300003215 Bacteria 8224
3 Ga0065165_1015499 3300005262 Bacteria 2903
4 Ga0070682_100047092 3300005337 Bacteria 2679
5 Ga0070661_100056211 3300005344 Bacteria 2883
6 Ga0070667_100033812 3300005367 Bacteria 4277
7 Ga0070663_100000216 3300005455 Bacteria 28923
8 Ga0070663_100009307 3300005455 Bacteria 6079
9 Ga0070678_100255846 3300005456 Bacteria 1470
10 Ga0070662_100006917 3300005457 Bacteria 7342
11 Ga0070706_100047916 3300005467 Bacteria 3944
12 Ga0070706_100518421 3300005467 Bacteria 1109
13 Ga0070707_100608360 3300005468 Unclassified 1055
14 Ga0070698_100686905 3300005471 Bacteria 965
15 Ga0070699_100106617 3300005518 Bacteria 2458
16 Ga0070699_100815604 3300005518 Bacteria 854
17 Ga0068853_100053818 3300005539 Bacteria 3467
18 Ga0070696_100026053 3300005546 Bacteria 3978
19 Ga0070665_100000793 3300005548 Bacteria 41553
20 Ga0070665_100003470 3300005548 Bacteria 16799
21 Ga0070665_100033945 3300005548 Bacteria 5132
22 Ga0070665_100202277 3300005548 Bacteria 1987
23 Ga0070665_100337143 3300005548 Bacteria 1512
24 Ga0070704_100029684 3300005549 Bacteria 3655
25 Ga0068857_101108693 3300005577 Bacteria 764
26 Ga0068863_100238249 3300005841 Bacteria 1756
27 Ga0068858_100328003 3300005842 Bacteria 1464
28 Ga0068860_100124052 3300005843 Bacteria 2475
29 Ga0068862_100668476 3300005844 Bacteria 1003
30 Ga0081455_10090068 3300005937 Bacteria 2488
31 Ga0081540_1001470 3300005983 Bacteria 20340
32 Ga0081540_1009036 3300005983 Bacteria 6887
33 Ga0081540_1027966 3300005983 Bacteria 3180
34 Ga0075365_10038343 3300006038 Bacteria 3114
35 Ga0075365_10060506 3300006038 Bacteria 2527
36 Ga0075368_10047516 3300006042 Bacteria 1699
37 Ga0075364_10068526 3300006051 Bacteria 2333
38 Ga0070712_100040761 3300006175 Bacteria 3185
39 Ga0075362_10000364 3300006177 Bacteria 13059
40 Ga0075367_10082739 3300006178 Bacteria 1944
41 Ga0075367_10096831 3300006178 Bacteria 1800
42 Ga0075369_10001885 3300006186 Bacteria 7340
43 Ga0075370_10020747 3300006353 Bacteria 3594
44 Ga0075370_10068119 3300006353 Bacteria 2032
45 Ga0075433_10463763 3300006852 Bacteria 1116
46 Ga0075434_100002679 3300006871 Bacteria 15731
47 Ga0075435_100030258 3300007076 Bacteria 4255
48 Ga0105237_10170850 3300009545 Bacteria 2174
49 Ga0105237_10636854 3300009545 Bacteria 1073
50 Ga0105239_10045380 3300010375 Bacteria 4816
51 Ga0105239_10124392 3300010375 Bacteria 2865
52 Ga0105239_10553254 3300010375 Bacteria 1310
53 Ga0163163_10869114 3300014325 Bacteria 965
54 Ga0163163_11108576 3300014325 Unclassified 854
55 Ga0157380_10119127 3300014326 Bacteria 2233
56 Ga0182008_10000113 3300014497 Bacteria 61507
57 Ga0182007_10000213 3300015262 Bacteria 38873
58 Ga0209564_1008457 3300025295 Bacteria 5074
59 Ga0209758_1000209 3300025297 Bacteria 128038
60 Ga0209758_1002841 3300025297 Bacteria 16832
61 Ga0209758_1004616 3300025297 Bacteria 11306
62 Ga0209758_1028669 3300025297 Bacteria 2347
63 Ga0209758_1082937 3300025297 Bacteria 963
64 Ga0209256_1052226 3300025299 Bacteria 983
65 Ga0207426_1000237 3300025302 Bacteria 124707
66 Ga0207426_1013001 3300025302 Bacteria 3104
67 Ga0209257_1020705 3300025304 Bacteria 2417
68 Ga0207707_10043307 3300025912 Bacteria 3927
69 Ga0207671_10492838 3300025914 Bacteria 977
70 Ga0207649_10037477 3300025920 Bacteria 2929
71 Ga0207646_10794921 3300025922 Unclassified 843
72 Ga0207681_10091057 3300025923 Bacteria 2178
73 Ga0207706_10013352 3300025933 Bacteria 7472
74 Ga0207689_10002319 3300025942 Bacteria 17836
75 Ga0207658_10125978 3300025986 Bacteria 2050
76 Ga0207703_10249988 3300026035 Bacteria 1597
77 Ga0207639_10032746 3300026041 Bacteria 3829
78 Ga0207678_10000697 3300026067 Bacteria 30609
79 Ga0207678_10040954 3300026067 Bacteria 4016
80 Ga0207708_10047003 3300026075 Bacteria 3287
81 Ga0207675_100000292 3300026118 Bacteria 48260
82 Ga0207683_10145953 3300026121 Bacteria 2133
83 Ga0209813_10014656 3300027866 Bacteria 2114
84 Ga0268266_10019103 3300028379 Bacteria 5836
85 Ga0268264_10420201 3300028381 Bacteria 1289
86 Ga0307513_10386641 3300031456 Unclassified 1137
87 Ga0265314_10026992 3300031711 Bacteria 4306
88 Ga0307410_10172310 3300031852 Bacteria 1632
89 Ga0307416_100187023 3300032002 Bacteria 1948
90 Ga0307415_100061922 3300032126 Bacteria 2593
91 Ga0436365_0094119 3300039437 Unclassified 2107
92 Ga0451807_0987190 3300041486 Bacteria 2786
93 Ga0495605_0132011 3300046474 Bacteria 1126
94 Ga0495596_0131380 3300046500 Bacteria 972
95 Ga0495643_0095224 3300046522 Bacteria 1532
96 Ga0495648_0060497 3300046524 Bacteria 2253
97 Ga0495663_0135925 3300046525 Bacteria 832
98 Ga0495668_0090340 3300046616 Bacteria 1678
99 Ga0495668_0216705 3300046616 Bacteria 1048
100 Ga0495611_0100324 3300046648 Bacteria 1344
101 Ga0495588_0155044 3300046674 Bacteria 1211
102 Ga0495669_0047221 3300046684 Bacteria 1923
103 Ga0495669_0352354 3300046684 Bacteria 712
104 Ga0495670_0179431 3300046691 Bacteria 1118
105 Ga0495589_0087185 3300046794 Bacteria 1516
106 Ga0495636_0035771 3300047318 Bacteria 2046
107 Ga0495672_0035538 3300047320 Bacteria 3069
108 Ga0495672_0037889 3300047320 Bacteria 2947
109 Ga0495673_0006912 3300047469 Bacteria 6608
110 Ga0495686_0002800 3300047472 Bacteria 15833
111 Ga0495686_0087981 3300047472 Bacteria 1889
112 Ga0496102_0594131 3300048905 Bacteria 1030
113 Ga0496107_0162114 3300048910 Bacteria 1657
114 Ga0496108_0947350 3300048911 Unclassified 737
115 Ga0496115_0053435 3300048918 Bacteria 3242
116 Ga0496115_0343100 3300048918 Bacteria 1219
117 Ga0496119_0002194 3300048922 Bacteria 21820
118 Ga0496120_0000350 3300048923 Bacteria 75997
119 Ga0496121_0001346 3300048924 Bacteria 41986
120 Ga0496121_0055662 3300048924 Bacteria 3293
121 Ga0496121_0145927 3300048924 Bacteria 1748
122 Ga0496125_0111290 3300048928 Bacteria 1982
123 Ga0496126_0010532 3300048929 Bacteria 9682
124 Ga0496126_0050161 3300048929 Bacteria 3805
125 Ga0496126_0134438 3300048929 Bacteria 2134
126 Ga0496126_0355975 3300048929 Bacteria 1196
127 nmdc:mga03683_9307_c1 3300050489 Bacteria 3486
128 nmdc:mga00v17_25120_c1 3300050491 Bacteria 3460
129 nmdc:mga0yw44_66456_c1 3300050492 Bacteria 2225
130 nmdc:mga0yw44_83327_c1 3300050492 Bacteria 2008
131 nmdc:mga06z11_82066_c1 3300050494 Bacteria 1732
132 nmdc:mga04h51_19647_c1 3300050495 Bacteria 2006
133 nmdc:mga07m45_4015_c1 3300050496 Bacteria 7162
134 nmdc:mga07m45_76813_c1 3300050496 Bacteria 1904
135 nmdc:mga0qj67_435106_c1 3300050509 Bacteria 1057
136 nmdc:mga0n895_3215_c1 3300050512 Bacteria 13079
137 nmdc:mga0rr50_22838_c1 3300050513 Bacteria 4301
138 nmdc:mga0a205_494186_c1 3300050515 Bacteria 1081
139 nmdc:mga0sz30_15_c1 3300050516 Bacteria 83405
140 nmdc:mga0sz30_91093_c1 3300050516 Bacteria 1327
141 Ga0500643_005357 3300053087 Bacteria 5544
142 Ga0500641_0045062 3300053096 Bacteria 1795
143 Ga0500556_0048679 3300053104 Bacteria 1525
144 Ga0500562_030909 3300053108 Bacteria 1412
145 Ga0500595_001774 3300053119 Bacteria 11225
146 Ga0500568_0000082 3300053139 Bacteria 92308
147 Ga0500568_0005342 3300053139 Bacteria 6656
148 Ga0500590_160976 3300053148 Bacteria 1000
149 Ga0500637_0049789 3300053178 Bacteria 2385
150 Ga0466962_0094781 3300061719 Bacteria 1431
151 2513672160 2513237098 Bacteria 9902361
152 2524464656 2524023210 Bacteria 9029266
153 2644240861 2643221643 Bacteria 5749658
154 2824713862 2824704595 Bacteria 9667483
155 2824757892 2824753945 Bacteria 9787441
156 2824766976 2824763712 Bacteria 9792355
157 2885386245 2885383462 Bacteria 9473874
158 2903774219 2903768456 Bacteria 9749579
159 2904582768 2904578770 Bacteria 5302906
160 2904712504 2904711408 Bacteria 9771557
161 2935650316 2935648319 Bacteria 8801166
162 2935658463 2935656913 Bacteria 8965014
163 2935776874 2935769743 Bacteria 7878163
164 2935778334 2935777560 Bacteria 8077691
165 2935792868 2935785616 Bacteria 7962367
166 2935800990 2935793552 Bacteria 8012592
167 2935986027 2935984226 Bacteria 8302647
168 2936013125 2936011229 Bacteria 8801034
169 2936021788 2936019824 Bacteria 8804134
170 2936030418 2936028420 Bacteria 8965941
171 2936047982 2936046547 Bacteria 8903709
172 2936057982 2936055302 Bacteria 8785755
173 8016529830 8016522445 Bacteria 8156687
174 8016535064 8016530956 Bacteria 8155261
175 8016548270 8016539877 Bacteria 8155419
176 8016553855 8016548790 Bacteria 8155074
177 8016562230 8016557553 Bacteria 8154380
178 8016573407 8016566248 Bacteria 8158151
179 8016577539 8016575299 Bacteria 8154085
180 8016600046 8016595262 Bacteria 8149947
181 8016610716 8016603502 Bacteria 8731218
182 8016614214 8016613128 Bacteria 8794220
183 8016626770 8016622563 Bacteria 7999408
184 8019534819 8019530166 Bacteria 8155624
185 8019544656 8019538911 Bacteria 7872763
186 8019553881 8019547302 Bacteria 7996444
187 Ga0496118_0214162
188 JGI25153J46596_10003877
189 Ga0065165_1015499
190 Ga0070682_100047092
191 Ga0070661_100056211
192 Ga0070667_100033812
193 Ga0070663_100000216
194 Ga0070663_100009307
195 Ga0070678_100255846
196 Ga0070662_100006917
197 Ga0070706_100047916
198 Ga0070706_100518421
199 Ga0070707_100608360
200 Ga0070698_100686905
201 Ga0070699_100106617
202 Ga0070699_100815604
203 Ga0068853_100053818
204 Ga0070696_100026053
205 Ga0070665_100000793
206 Ga0070665_100003470
207 Ga0070665_100033945
208 Ga0070665_100202277
209 Ga0070665_100337143
210 Ga0070704_100029684
211 Ga0068857_101108693
212 Ga0068863_100238249
213 Ga0068858_100328003
214 Ga0068860_100124052
215 Ga0068862_100668476
216 Ga0081455_10090068
217 Ga0081540_1001470
218 Ga0081540_1009036
219 Ga0081540_1027966
220 Ga0075365_10038343
221 Ga0075365_10060506
222 Ga0075368_10047516
223 Ga0075364_10068526
224 Ga0070712_100040761
225 Ga0075362_10000364
226 Ga0075367_10082739
227 Ga0075367_10096831
228 Ga0075369_10001885
229 Ga0075370_10020747
230 Ga0075370_10068119
231 Ga0075433_10463763
232 Ga0075434_100002679
233 Ga0075435_100030258
234 Ga0105237_10170850
235 Ga0105237_10636854
236 Ga0105239_10045380
237 Ga0105239_10124392
238 Ga0105239_10553254
239 Ga0163163_10869114
240 Ga0163163_11108576
241 Ga0157380_10119127
242 Ga0182008_10000113
243 Ga0182007_10000213
244 Ga0209564_1008457
245 Ga0209758_1000209
246 Ga0209758_1002841
247 Ga0209758_1004616
248 Ga0209758_1028669
249 Ga0209758_1082937
250 Ga0209256_1052226
251 Ga0207426_1000237
252 Ga0207426_1013001
253 Ga0209257_1020705
254 Ga0207707_10043307
255 Ga0207671_10492838
256 Ga0207649_10037477
257 Ga0207646_10794921
258 Ga0207681_10091057
259 Ga0207706_10013352
260 Ga0207689_10002319
261 Ga0207658_10125978
262 Ga0207703_10249988
263 Ga0207639_10032746
264 Ga0207678_10000697
265 Ga0207678_10040954
266 Ga0207708_10047003
267 Ga0207675_100000292
268 Ga0207683_10145953
269 Ga0209813_10014656
270 Ga0268266_10019103
271 Ga0268264_10420201
272 Ga0307513_10386641
273 Ga0265314_10026992
274 Ga0307410_10172310
275 Ga0307416_100187023
276 Ga0307415_100061922
277 Ga0436365_0094119
278 Ga0451807_0987190
279 Ga0495605_0132011
280 Ga0495596_0131380
281 Ga0495643_0095224
282 Ga0495648_0060497
283 Ga0495663_0135925
284 Ga0495668_0090340
285 Ga0495668_0216705
286 Ga0495611_0100324
287 Ga0495588_0155044
288 Ga0495669_0047221
289 Ga0495669_0352354
290 Ga0495670_0179431
291 Ga0495589_0087185
292 Ga0495636_0035771
293 Ga0495672_0035538
294 Ga0495672_0037889
295 Ga0495673_0006912
296 Ga0495686_0002800
297 Ga0495686_0087981
298 Ga0496102_0594131
299 Ga0496107_0162114
300 Ga0496108_0947350
301 Ga0496115_0053435
302 Ga0496115_0343100
303 Ga0496119_0002194
304 Ga0496120_0000350
305 Ga0496121_0001346
306 Ga0496121_0055662
307 Ga0496121_0145927
308 Ga0496125_0111290
309 Ga0496126_0010532
310 Ga0496126_0050161
311 Ga0496126_0134438
312 Ga0496126_0355975
313 nmdc:mga03683_9307_c1
314 nmdc:mga00v17_25120_c1
315 nmdc:mga0yw44_66456_c1
316 nmdc:mga0yw44_83327_c1
317 nmdc:mga06z11_82066_c1
318 nmdc:mga04h51_19647_c1
319 nmdc:mga07m45_4015_c1
320 nmdc:mga07m45_76813_c1
321 nmdc:mga0qj67_435106_c1
322 nmdc:mga0n895_3215_c1
323 nmdc:mga0rr50_22838_c1
324 nmdc:mga0a205_494186_c1
325 nmdc:mga0sz30_15_c1
326 nmdc:mga0sz30_91093_c1
327 Ga0500643_005357
328 Ga0500641_0045062
329 Ga0500556_0048679
330 Ga0500562_030909
331 Ga0500595_001774
332 Ga0500568_0000082
333 Ga0500568_0005342
334 Ga0500590_160976
335 Ga0500637_0049789
336 Ga0466962_0094781
337 2513672160
338 2524464656
339 2644240861
340 2824713862
341 2824757892
342 2824766976
343 2885386245
344 2903774219
345 2904582768
346 2904712504
347 2935650316
348 2935658463
349 2935776874
350 2935778334
351 2935792868
352 2935800990
353 2935986027
354 2936013125
355 2936021788
356 2936030418
357 2936047982
358 2936057982
359 8016529830
360 8016535064
361 8016548270
362 8016553855
363 8016562230
364 8016573407
365 8016577539
366 8016600046
367 8016610716
368 8016614214
369 8016626770
370 8019534819
371 8019544656
372 8019553881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10620

MdcG

Phosphoribosyl-dephospho-CoA transferase MdcG C-terminal domain

97

219

0.96

PF20866

MdcG_N

Phosphoribosyl-dephospho-CoA transferase MdcG N-terminal domain

15

96

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wot-assembly1.cif.gz_A structure of putative minimal nucleotidyltransferase 0.6773 95 181
5lpa-assembly2.cif.gz_B aada e87q in complex with atp, calcium and dihydrostreptomycin 0.622 105 185
4f5q-assembly1.cif.gz_A closed ternary complex of r283k dna polymerase beta 0.5978 110 174
1y96-assembly2.cif.gz_D crystal structure of the gemin6/gemin7 heterodimer from the human smn complex 0.5896 15 95
8j7y-assembly1.cif.gz_B cryo-em structure of hznt7deltahis-loop-fab complex in zinc-bound state, determined in outward-facing conformation 0.5725 93 185
ID Description Score Start End Superfamily
af_Q58021_1_93_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7538 110 187 3.30.460.10
af_Q57606_1_96_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6835 113 186 3.30.460.10
af_Q57877_1_92_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6828 110 181 3.30.460.10
1wotA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6773 95 181 3.30.460.10
af_Q6DG36_660_775_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.6597 104 188 3.30.70.1350
ID Description Score Start End GO Terms
AF-A0A4Q7U7W2-F1-model_v4 deleted 0.9816 28 226
AF-A0A4Q7FZ25-F1-model_v4 Malonate decarboxylase holo-[acyl-carrier-protein] synthase 0.98 12 226 GO:0016779
AF-A0A370L9T7-F1-model_v4 Malonate decarboxylase holo-[acyl-carrier-protein] synthase 0.9768 7 226 GO:0016779
AF-A0A4Q7U7W2-F1-model_v4 deleted 0.9768 28 226
AF-A0A4Q7FZ25-F1-model_v4 Malonate decarboxylase holo-[acyl-carrier-protein] synthase 0.9755 12 226 GO:0016779

Map