F286494

General Info

Members Datasets Scaffolds Average Seq Length
186 136 185 109

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0001231|Ga0495651_0001231_15188_15544
Length 118
Sequence MAFVITDACVDVMDRSCMEECPVDCIYEGGRKMYINPVECINCGACEQVCPSAAAFADRTVANTDAAWNIADNAAFFTDLLPGRDAPLGTPGGATHLGPVGADTPRIAVLGRAGNGAC

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
64 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
65 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
70 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
71 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
72 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
130 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.08
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.53
Nodule 0
Rhizoplane 13.44
Rhizosphere 73.12
Stem 0
Stem Tuber 0
Unclassified 5.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10051479 3300001989 Bacteria 1328
2 Ga0058862_12519518 3300004803 Bacteria 893
3 Ga0070683_100105947 3300005329 Bacteria 2650
4 Ga0070683_101046929 3300005329 Bacteria 784
5 Ga0070682_100214637 3300005337 Bacteria 1366
6 Ga0070682_102034888 3300005337 Bacteria 506
7 Ga0070660_100483649 3300005339 Bacteria 1029
8 Ga0070687_100241644 3300005343 Bacteria 1117
9 Ga0070668_100000180 3300005347 Bacteria 40892
10 Ga0070668_101411585 3300005347 Bacteria 635
11 Ga0070671_101694900 3300005355 Bacteria 561
12 Ga0070688_100330124 3300005365 Bacteria 1111
13 Ga0070667_100253663 3300005367 Bacteria 1573
14 Ga0070700_100140430 3300005441 Bacteria 1641
15 Ga0070663_100234658 3300005455 Bacteria 1446
16 Ga0070679_101628085 3300005530 Bacteria 593
17 Ga0070684_100179847 3300005535 Bacteria 1923
18 Ga0070665_101041482 3300005548 Bacteria 830
19 Ga0068857_100795573 3300005577 Bacteria 903
20 Ga0068856_100991083 3300005614 Bacteria 859
21 Ga0070702_100468452 3300005615 Bacteria 918
22 Ga0068860_100270520 3300005843 Bacteria 1658
23 Ga0068860_100371623 3300005843 Bacteria 1410
24 Ga0068862_100065690 3300005844 Bacteria 3125
25 Ga0068862_100906356 3300005844 Bacteria 867
26 Ga0081455_10009510 3300005937 Bacteria 9989
27 Ga0081455_10427469 3300005937 Bacteria 911
28 Ga0081539_10038625 3300005985 Bacteria 2827
29 Ga0081539_10043187 3300005985 Bacteria 2616
30 Ga0075368_10000135 3300006042 Bacteria 19588
31 Ga0075363_100262538 3300006048 Bacteria 996
32 Ga0075367_10016841 3300006178 Bacteria 3999
33 Ga0097621_101206562 3300006237 Bacteria 713
34 Ga0075434_100474733 3300006871 Bacteria 1272
35 Ga0111539_11186568 3300009094 Bacteria 887
36 Ga0105245_10234572 3300009098 Bacteria 1776
37 Ga0114129_11079678 3300009147 Bacteria 1006
38 Ga0105238_10363119 3300009551 Bacteria 1438
39 Ga0105239_11347601 3300010375 Bacteria 823
40 Ga0105246_11388773 3300011119 Bacteria 655
41 Ga0157378_10748741 3300013297 Bacteria 1000
42 Ga0163162_12287251 3300013306 Bacteria 621
43 Ga0163162_12553566 3300013306 Bacteria 588
44 Ga0163162_12694263 3300013306 Bacteria 572
45 Ga0157372_10089185 3300013307 Bacteria 3503
46 Ga0157372_10568765 3300013307 Bacteria 1321
47 Ga0182008_10112507 3300014497 Bacteria 1349
48 Ga0206356_10170814 3300020070 Bacteria 615
49 Ga0213875_10132507 3300021388 Bacteria 1166
50 Ga0207688_10564633 3300025901 Bacteria 716
51 Ga0207688_10911793 3300025901 Bacteria 556
52 Ga0207687_10634398 3300025927 Bacteria 903
53 Ga0207664_10676755 3300025929 Bacteria 928
54 Ga0207686_11492042 3300025934 Bacteria 557
55 Ga0207661_10279779 3300025944 Bacteria 1491
56 Ga0207679_11269919 3300025945 Bacteria 676
57 Ga0207712_10647091 3300025961 Bacteria 918
58 Ga0207668_10005168 3300025972 Bacteria 7679
59 Ga0207658_10265602 3300025986 Bacteria 1464
60 Ga0207677_10844236 3300026023 Bacteria 823
61 Ga0207708_10544515 3300026075 Bacteria 978
62 Ga0207674_11456271 3300026116 Bacteria 654
63 Ga0209371_1051405 3300027312 Bacteria 789
64 Ga0209813_10000766 3300027866 Bacteria 7308
65 Ga0268266_11119976 3300028379 Bacteria 761
66 Ga0268265_10868550 3300028380 Bacteria 884
67 Ga0268265_10911001 3300028380 Bacteria 864
68 Ga0268264_10205648 3300028381 Bacteria 1804
69 Ga0268264_10533428 3300028381 Bacteria 1149
70 Ga0268256_1059358 3300030500 Bacteria 773
71 Ga0307513_10004672 3300031456 Bacteria 18213
72 Ga0307513_10029999 3300031456 Bacteria 6184
73 Ga0307508_10099212 3300031616 Bacteria 2506
74 Ga0307516_10019184 3300031730 Bacteria 7087
75 Ga0307516_10029536 3300031730 Bacteria 5542
76 Ga0307516_10223205 3300031730 Bacteria 1592
77 Ga0307413_10546560 3300031824 Bacteria 939
78 Ga0316214_1035550 3300033545 Bacteria 711
79 Ga0373952_0031353 3300035092 Bacteria 1182
80 Ga0373942_0139736 3300035207 Bacteria 770
81 Ga0395900_0076676 3300037418 Bacteria 3435
82 Ga0395898_0006023 3300037466 Bacteria 13025
83 Ga0395898_0032495 3300037466 Bacteria 5209
84 Ga0395898_0454155 3300037466 Bacteria 1220
85 Ga0395901_0005007 3300038443 Bacteria 13377
86 Ga0395901_0519076 3300038443 Bacteria 1210
87 Ga0242419_006422 3300038698 Bacteria 853
88 Ga0436365_1261739 3300039437 Bacteria 501
89 Ga0451797_0316557 3300041453 Bacteria 539
90 Ga0451833_1049766 3300041491 Bacteria 510
91 Ga0451843_0837354 3300041509 Bacteria 2613
92 Ga0466972_0416692 3300044658 Bacteria 630
93 Ga0466965_0012453 3300044683 Bacteria 4000
94 Ga0466965_0876859 3300044683 Bacteria 522
95 Ga0466966_0054339 3300044684 Bacteria 2538
96 Ga0466966_0674069 3300044684 Bacteria 623
97 Ga0466961_0044264 3300044693 Bacteria 2848
98 Ga0466963_0003943 3300044694 Bacteria 8582
99 Ga0466963_0034542 3300044694 Bacteria 3290
100 Ga0466963_0169405 3300044694 Bacteria 1522
101 Ga0466963_0210695 3300044694 Bacteria 1360
102 Ga0466964_0042774 3300044706 Bacteria 1836
103 Ga0466971_0167487 3300044719 Bacteria 1030
104 Ga0466971_0202885 3300044719 Bacteria 936
105 Ga0466970_0027527 3300044765 Bacteria 2983
106 Ga0466970_0279829 3300044765 Bacteria 938
107 Ga0466957_0013238 3300044842 Bacteria 4785
108 Ga0466957_0068896 3300044842 Bacteria 2185
109 Ga0466960_0031154 3300044901 Bacteria 2459
110 Ga0466960_0092626 3300044901 Bacteria 1543
111 Ga0466959_0057102 3300045049 Bacteria 2846
112 Ga0466958_0029498 3300045836 Bacteria 3255
113 Ga0466958_0211030 3300045836 Bacteria 1237
114 Ga0466958_0253724 3300045836 Bacteria 1125
115 Ga0466967_0014483 3300045976 Bacteria 6145
116 Ga0466967_0028832 3300045976 Bacteria 4640
117 Ga0466967_0029458 3300045976 Bacteria 4594
118 Ga0466967_0118407 3300045976 Bacteria 2443
119 Ga0466967_0249329 3300045976 Bacteria 1696
120 Ga0466967_0458975 3300045976 Bacteria 1246
121 Ga0466967_0633005 3300045976 Bacteria 1057
122 Ga0495629_0836333 3300046459 Bacteria 606
123 Ga0495638_0001945 3300046460 Bacteria 17710
124 Ga0495651_0001231 3300046462 Bacteria 19805
125 Ga0495582_0290256 3300046473 Bacteria 940
126 Ga0495622_0132555 3300046557 Bacteria 1134
127 Ga0495667_0485232 3300046559 Bacteria 775
128 Ga0495588_0268877 3300046674 Bacteria 898
129 Ga0495658_0190498 3300046683 Bacteria 1275
130 Ga0495658_0778590 3300046683 Bacteria 613
131 Ga0495600_0399191 3300046809 Bacteria 856
132 Ga0495672_0159499 3300047320 Bacteria 1161
133 Ga0495676_0874974 3300047321 Bacteria 576
134 Ga0496100_0061630 3300048903 Bacteria 2472
135 Ga0496100_0821006 3300048903 Bacteria 729
136 Ga0496101_0046169 3300048904 Bacteria 3123
137 Ga0496102_0184574 3300048905 Bacteria 1965
138 Ga0496102_0958827 3300048905 Bacteria 776
139 Ga0496103_0009527 3300048906 Bacteria 5750
140 Ga0496104_0232612 3300048907 Bacteria 1755
141 Ga0496105_0438792 3300048908 Bacteria 1032
142 Ga0496106_0144879 3300048909 Bacteria 1870
143 Ga0496107_0105386 3300048910 Bacteria 2070
144 Ga0496107_0386954 3300048910 Bacteria 1040
145 Ga0496108_0374292 3300048911 Bacteria 1243
146 Ga0496109_0153239 3300048912 Bacteria 2158
147 Ga0496110_0032877 3300048913 Bacteria 4484
148 Ga0496110_0226878 3300048913 Bacteria 1698
149 Ga0496112_0180172 3300048915 Bacteria 2077
150 Ga0496112_1486072 3300048915 Bacteria 591
151 Ga0496112_1498513 3300048915 Bacteria 588
152 Ga0496113_0128377 3300048916 Bacteria 1987
153 Ga0496113_1570103 3300048916 Bacteria 507
154 Ga0496114_0092612 3300048917 Bacteria 2568
155 Ga0496114_0240538 3300048917 Bacteria 1592
156 Ga0496114_0451156 3300048917 Bacteria 1139
157 Ga0496115_0214384 3300048918 Bacteria 1590
158 Ga0501032_0358341 3300049569 Bacteria 939
159 Ga0501033_0000422 3300049570 Bacteria 40484
160 Ga0501036_0791708 3300049572 Bacteria 781
161 Ga0501043_0015235 3300049579 Bacteria 6021
162 Ga0501046_0002217 3300049580 Bacteria 18328
163 Ga0501067_0058154 3300049583 Bacteria 2141
164 Ga0501067_0167198 3300049583 Bacteria 1225
165 Ga0501068_0079994 3300049584 Bacteria 2004
166 Ga0501069_0011883 3300049585 Bacteria 4618
167 Ga0501069_0361070 3300049585 Bacteria 857
168 Ga0501080_0212882 3300049742 Bacteria 1771
169 Ga0501081_0590710 3300049743 Bacteria 831
170 nmdc:mga03n38_1528_c1 3300050490 Bacteria 6694
171 nmdc:mga06z11_7989_c1 3300050494 Bacteria 4385
172 nmdc:mga04h51_11020_c1 3300050495 Bacteria 2499
173 nmdc:mga0n895_1136879_c1 3300050512 Bacteria 757
174 nmdc:mga0sz30_20254_c1 3300050516 Bacteria 2682
175 Ga0495619_0190354 3300053085 Bacteria 1420
176 Ga0500556_0000389 3300053104 Bacteria 32143
177 Ga0500628_116051 3300053129 Bacteria 723
178 Ga0500568_0332364 3300053139 Bacteria 551
179 Ga0500604_0023484 3300053151 Bacteria 1759
180 Ga0500616_0011148 3300053153 Bacteria 5337
181 Ga0500620_008812 3300053155 Bacteria 2571
182 Ga0466962_0027633 3300061719 Bacteria 2722
183 Ga0466962_0526890 3300061719 Bacteria 599
184 Ga0466962_0540172 3300061719 Bacteria 592
185 Ga0530510_0157935 3300061734 Bacteria 1677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006042 Ga0075368_10000135 Ga0075368_1000013517 97
2 3300006048 Ga0075363_100262538 Ga0075363_1002625382 97
3 3300006178 Ga0075367_10016841 Ga0075367_100168413 97
4 3300027866 Ga0209813_10000766 Ga0209813_100007668 97
5 3300046460 Ga0495638_0001945 Ga0495638_0001945_9811_10104 97
6 3300046674 Ga0495588_0268877 Ga0495588_0268877_459_752 97
7 3300050490 nmdc:mga03n38_1528_c1 nmdc:mga03n38_1528_c1_1645_1974 97
8 3300050494 nmdc:mga06z11_7989_c1 nmdc:mga06z11_7989_c1_2540_2869 97
9 3300050495 nmdc:mga04h51_11020_c1 nmdc:mga04h51_11020_c1_1698_2027 97
10 3300053129 Ga0500628_116051 Ga0500628_116051_420_713 97
11 3300053139 Ga0500568_0332364 Ga0500568_0332364_24_317 97
12 3300053151 Ga0500604_0023484 Ga0500604_0023484_887_1180 97
13 3300005985 Ga0081539_10038625 Ga0081539_100386252 98
14 3300049572 Ga0501036_0791708 Ga0501036_0791708_32_361 99
15 3300039437 Ga0436365_1261739 Ga0436365_1261739_135_485 100
16 3300046809 Ga0495600_0399191 Ga0495600_0399191_515_835 101
17 3300044658 Ga0466972_0416692 Ga0466972_0416692_266_583 104
18 3300044683 Ga0466965_0012453 Ga0466965_0012453_1395_1712 104
19 3300044765 Ga0466970_0027527 Ga0466970_0027527_2254_2571 104
20 3300031456 Ga0307513_10029999 Ga0307513_100299993 107
21 iso_pu_bacteria 2751185782 2753268807 108
22 3300005339 Ga0070660_100483649 Ga0070660_1004836492 109
23 3300005347 Ga0070668_100000180 Ga0070668_1000001804 109
24 3300005843 Ga0068860_100270520 Ga0068860_1002705203 109
25 3300005844 Ga0068862_100065690 Ga0068862_1000656902 109
26 3300013297 Ga0157378_10748741 Ga0157378_107487412 109
27 3300013306 Ga0163162_12553566 Ga0163162_125535662 109
28 3300013307 Ga0157372_10568765 Ga0157372_105687651 109
29 3300014497 Ga0182008_10112507 Ga0182008_101125072 109
30 3300020070 Ga0206356_10170814 Ga0206356_101708142 109
31 3300025972 Ga0207668_10005168 Ga0207668_100051684 109
32 3300027312 Ga0209371_1051405 Ga0209371_10514052 109
33 3300028381 Ga0268264_10205648 Ga0268264_102056483 109
34 3300030500 Ga0268256_1059358 Ga0268256_10593582 109
35 3300037418 Ga0395900_0076676 Ga0395900_0076676_2079_2408 109
36 3300037466 Ga0395898_0006023 Ga0395898_0006023_3086_3415 109
37 3300037466 Ga0395898_0032495 Ga0395898_0032495_835_1164 109
38 3300037466 Ga0395898_0454155 Ga0395898_0454155_361_690 109
39 3300038443 Ga0395901_0005007 Ga0395901_0005007_7395_7724 109
40 3300038443 Ga0395901_0519076 Ga0395901_0519076_372_701 109
41 3300041491 Ga0451833_1049766 Ga0451833_1049766_142_471 109
42 3300041509 Ga0451843_0837354 Ga0451843_0837354_744_1073 109
43 3300044683 Ga0466965_0876859 Ga0466965_0876859_33_362 109
44 3300044684 Ga0466966_0054339 Ga0466966_0054339_11_340 109
45 3300044693 Ga0466961_0044264 Ga0466961_0044264_464_793 109
46 3300044694 Ga0466963_0003943 Ga0466963_0003943_4142_4471 109
47 3300044694 Ga0466963_0034542 Ga0466963_0034542_844_1173 109
48 3300044694 Ga0466963_0210695 Ga0466963_0210695_682_1011 109
49 3300044719 Ga0466971_0167487 Ga0466971_0167487_630_959 109
50 3300044719 Ga0466971_0202885 Ga0466971_0202885_188_517 109
51 3300044765 Ga0466970_0279829 Ga0466970_0279829_509_838 109
52 3300044842 Ga0466957_0013238 Ga0466957_0013238_795_1124 109
53 3300044842 Ga0466957_0068896 Ga0466957_0068896_1388_1717 109
54 3300044901 Ga0466960_0031154 Ga0466960_0031154_514_843 109
55 3300044901 Ga0466960_0092626 Ga0466960_0092626_308_637 109
56 3300045049 Ga0466959_0057102 Ga0466959_0057102_443_772 109
57 3300045836 Ga0466958_0029498 Ga0466958_0029498_2066_2395 109
58 3300045836 Ga0466958_0253724 Ga0466958_0253724_786_1115 109
59 3300045976 Ga0466967_0014483 Ga0466967_0014483_3010_3339 109
60 3300045976 Ga0466967_0028832 Ga0466967_0028832_3108_3437 109
61 3300045976 Ga0466967_0458975 Ga0466967_0458975_343_672 109
62 3300045976 Ga0466967_0633005 Ga0466967_0633005_514_843 109
63 3300047320 Ga0495672_0159499 Ga0495672_0159499_519_848 109
64 3300048903 Ga0496100_0821006 Ga0496100_0821006_355_684 109
65 3300048916 Ga0496113_1570103 Ga0496113_1570103_77_406 109
66 3300049569 Ga0501032_0358341 Ga0501032_0358341_273_602 109
67 3300049570 Ga0501033_0000422 Ga0501033_0000422_4439_4768 109
68 3300049579 Ga0501043_0015235 Ga0501043_0015235_3881_4210 109
69 3300049580 Ga0501046_0002217 Ga0501046_0002217_4568_4897 109
70 3300050516 nmdc:mga0sz30_20254_c1 nmdc:mga0sz30_20254_c1_1057_1386 109
71 3300053104 Ga0500556_0000389 Ga0500556_0000389_6521_6850 109
72 3300053153 Ga0500616_0011148 Ga0500616_0011148_1257_1586 109
73 3300053155 Ga0500620_008812 Ga0500620_008812_1352_1681 109
74 3300061719 Ga0466962_0027633 Ga0466962_0027633_1952_2281 109
75 3300061719 Ga0466962_0526890 Ga0466962_0526890_172_501 109
76 3300061719 Ga0466962_0540172 Ga0466962_0540172_82_411 109
77 3300005329 Ga0070683_100105947 Ga0070683_1001059474 110
78 3300005337 Ga0070682_100214637 Ga0070682_1002146372 110
79 3300005337 Ga0070682_102034888 Ga0070682_1020348881 110
80 3300005343 Ga0070687_100241644 Ga0070687_1002416442 110
81 3300005355 Ga0070671_101694900 Ga0070671_1016949002 110
82 3300005365 Ga0070688_100330124 Ga0070688_1003301242 110
83 3300005441 Ga0070700_100140430 Ga0070700_1001404302 110
84 3300005455 Ga0070663_100234658 Ga0070663_1002346582 110
85 3300005535 Ga0070684_100179847 Ga0070684_1001798473 110
86 3300005577 Ga0068857_100795573 Ga0068857_1007955731 110
87 3300005614 Ga0068856_100991083 Ga0068856_1009910832 110
88 3300005615 Ga0070702_100468452 Ga0070702_1004684522 110
89 3300005844 Ga0068862_100906356 Ga0068862_1009063561 110
90 3300006237 Ga0097621_101206562 Ga0097621_1012065622 110
91 3300006871 Ga0075434_100474733 Ga0075434_1004747332 110
92 3300009094 Ga0111539_11186568 Ga0111539_111865682 110
93 3300009098 Ga0105245_10234572 Ga0105245_102345723 110
94 3300009147 Ga0114129_11079678 Ga0114129_110796782 110
95 3300010375 Ga0105239_11347601 Ga0105239_113476012 110
96 3300011119 Ga0105246_11388773 Ga0105246_113887732 110
97 3300013306 Ga0163162_12287251 Ga0163162_122872512 110
98 3300013307 Ga0157372_10089185 Ga0157372_100891852 110
99 3300025901 Ga0207688_10564633 Ga0207688_105646331 110
100 3300025901 Ga0207688_10911793 Ga0207688_109117932 110
101 3300025927 Ga0207687_10634398 Ga0207687_106343982 110
102 3300025929 Ga0207664_10676755 Ga0207664_106767552 110
103 3300025934 Ga0207686_11492042 Ga0207686_114920421 110
104 3300025944 Ga0207661_10279779 Ga0207661_102797792 110
105 3300025945 Ga0207679_11269919 Ga0207679_112699192 110
106 3300025961 Ga0207712_10647091 Ga0207712_106470912 110
107 3300026075 Ga0207708_10544515 Ga0207708_105445152 110
108 3300026116 Ga0207674_11456271 Ga0207674_114562712 110
109 3300028380 Ga0268265_10911001 Ga0268265_109110012 110
110 3300031824 Ga0307413_10546560 Ga0307413_105465601 110
111 3300035092 Ga0373952_0031353 Ga0373952_0031353_213_545 110
112 3300035207 Ga0373942_0139736 Ga0373942_0139736_183_515 110
113 3300038698 Ga0242419_006422 Ga0242419_006422_447_779 110
114 3300045976 Ga0466967_0118407 Ga0466967_0118407_68_400 110
115 3300046473 Ga0495582_0290256 Ga0495582_0290256_341_673 110
116 3300046683 Ga0495658_0190498 Ga0495658_0190498_492_824 110
117 3300046683 Ga0495658_0778590 Ga0495658_0778590_83_415 110
118 3300047321 Ga0495676_0874974 Ga0495676_0874974_91_423 110
119 3300048903 Ga0496100_0061630 Ga0496100_0061630_80_412 110
120 3300048904 Ga0496101_0046169 Ga0496101_0046169_1022_1354 110
121 3300048905 Ga0496102_0184574 Ga0496102_0184574_1061_1393 110
122 3300048905 Ga0496102_0958827 Ga0496102_0958827_10_342 110
123 3300048906 Ga0496103_0009527 Ga0496103_0009527_1515_1847 110
124 3300048907 Ga0496104_0232612 Ga0496104_0232612_421_753 110
125 3300048908 Ga0496105_0438792 Ga0496105_0438792_61_393 110
126 3300048909 Ga0496106_0144879 Ga0496106_0144879_1116_1448 110
127 3300048910 Ga0496107_0105386 Ga0496107_0105386_1435_1767 110
128 3300048910 Ga0496107_0386954 Ga0496107_0386954_471_803 110
129 3300048911 Ga0496108_0374292 Ga0496108_0374292_225_557 110
130 3300048912 Ga0496109_0153239 Ga0496109_0153239_576_908 110
131 3300048913 Ga0496110_0032877 Ga0496110_0032877_1317_1649 110
132 3300048913 Ga0496110_0226878 Ga0496110_0226878_615_947 110
133 3300048915 Ga0496112_1486072 Ga0496112_1486072_167_499 110
134 3300048915 Ga0496112_1498513 Ga0496112_1498513_207_539 110
135 3300048916 Ga0496113_0128377 Ga0496113_0128377_970_1302 110
136 3300048917 Ga0496114_0092612 Ga0496114_0092612_1439_1771 110
137 3300048917 Ga0496114_0240538 Ga0496114_0240538_221_553 110
138 3300048917 Ga0496114_0451156 Ga0496114_0451156_458_790 110
139 3300048918 Ga0496115_0214384 Ga0496115_0214384_1009_1341 110
140 3300049583 Ga0501067_0058154 Ga0501067_0058154_534_866 110
141 3300049583 Ga0501067_0167198 Ga0501067_0167198_390_722 110
142 3300049584 Ga0501068_0079994 Ga0501068_0079994_1171_1503 110
143 3300049585 Ga0501069_0011883 Ga0501069_0011883_3107_3439 110
144 3300049585 Ga0501069_0361070 Ga0501069_0361070_20_352 110
145 3300049743 Ga0501081_0590710 Ga0501081_0590710_135_467 110
146 3300050512 nmdc:mga0n895_1136879_c1 nmdc:mga0n895_1136879_c1_275_607 110
147 3300061734 Ga0530510_0157935 Ga0530510_0157935_1176_1508 110
148 3300009551 Ga0105238_10363119 Ga0105238_103631192 111
149 3300031730 Ga0307516_10029536 Ga0307516_100295362 111
150 3300033545 Ga0316214_1035550 Ga0316214_10355502 111
151 3300044684 Ga0466966_0674069 Ga0466966_0674069_193_528 111
152 3300044694 Ga0466963_0169405 Ga0466963_0169405_51_386 111
153 3300045836 Ga0466958_0211030 Ga0466958_0211030_422_757 111
154 3300045976 Ga0466967_0249329 Ga0466967_0249329_671_1006 111
155 3300004803 Ga0058862_12519518 Ga0058862_125195182 112
156 3300005329 Ga0070683_101046929 Ga0070683_1010469292 112
157 3300005347 Ga0070668_101411585 Ga0070668_1014115851 112
158 3300005530 Ga0070679_101628085 Ga0070679_1016280851 112
159 3300005548 Ga0070665_101041482 Ga0070665_1010414822 112
160 3300005843 Ga0068860_100371623 Ga0068860_1003716232 112
161 3300005937 Ga0081455_10009510 Ga0081455_100095105 112
162 3300005937 Ga0081455_10427469 Ga0081455_104274692 112
163 3300005985 Ga0081539_10043187 Ga0081539_100431873 112
164 3300013306 Ga0163162_12694263 Ga0163162_126942631 112
165 3300021388 Ga0213875_10132507 Ga0213875_101325072 112
166 3300025986 Ga0207658_10265602 Ga0207658_102656022 112
167 3300026023 Ga0207677_10844236 Ga0207677_108442361 112
168 3300028379 Ga0268266_11119976 Ga0268266_111199762 112
169 3300028380 Ga0268265_10868550 Ga0268265_108685502 112
170 3300028381 Ga0268264_10533428 Ga0268264_105334282 112
171 3300031456 Ga0307513_10004672 Ga0307513_1000467217 112
172 3300031616 Ga0307508_10099212 Ga0307508_100992124 112
173 3300031730 Ga0307516_10019184 Ga0307516_100191846 112
174 3300031730 Ga0307516_10223205 Ga0307516_102232052 112
175 3300041453 Ga0451797_0316557 Ga0451797_0316557_74_412 112
176 3300044706 Ga0466964_0042774 Ga0466964_0042774_71_412 112
177 3300045976 Ga0466967_0029458 Ga0466967_0029458_3841_4182 112
178 3300046459 Ga0495629_0836333 Ga0495629_0836333_15_359 112
179 3300046557 Ga0495622_0132555 Ga0495622_0132555_78_419 112
180 3300046559 Ga0495667_0485232 Ga0495667_0485232_249_587 112
181 3300048915 Ga0496112_0180172 Ga0496112_0180172_1590_1934 112
182 3300049742 Ga0501080_0212882 Ga0501080_0212882_1022_1363 112
183 3300001989 JGI24739J22299_10051479 JGI24739J22299_100514792 113
184 3300005367 Ga0070667_100253663 Ga0070667_1002536632 113
185 3300046462 Ga0495651_0001231 Ga0495651_0001231_15188_15544 113
186 3300053085 Ga0495619_0190354 Ga0495619_0190354_694_1050 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

33

56

0.92

PF13237

Fer4_10

4Fe-4S dicluster domain

32

75

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fd2-assembly1.cif.gz_A site-directed mutagenesis of azotobacter vinelandii ferredoxin i. (fe-s) cluster-driven protein rearrangement 0.4591 2 54
1fri-assembly1.cif.gz_A azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential 0.457 2 54
1d3w-assembly1.cif.gz_A crystal structure of ferredoxin 1 d15e mutant from azotobacter vinelandii at 1.7 angstrom resolution. 0.4549 2 54
1bc6-assembly1.cif.gz_A 7-fe ferredoxin from bacillus schlegelii, nmr, 20 structures 0.4301 2 56
1bc6-assembly1.cif.gz_A 7-fe ferredoxin from bacillus schlegelii, nmr, 20 structures 0.3369 2 56
ID Description Score Start End Superfamily
af_F1QB45_1_102_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4272 17 35 3.30.200.20
af_Q57999_5_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.3851 3 47 3.40.50.300
1tcpA00 Few Secondary Structures;Irregular;Factor Xa Inhibitor;Pancreatic trypsin inhibitor Kunitz domain 0.2078 6 50 4.10.410.10
af_Q57999_5_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.2028 3 47 3.40.50.300
1tcpA00 Few Secondary Structures;Irregular;Factor Xa Inhibitor;Pancreatic trypsin inhibitor Kunitz domain 0.1837 6 50 4.10.410.10
ID Description Score Start End GO Terms
AF-A0A100HYW1-F1-model_v4 deleted 0.8325 62 111
AF-A0A6G9Z037-F1-model_v4 Ferredoxin family protein 0.6914 45 113
AF-A0A2S8LIG7-F1-model_v4 deleted 0.6834 45 113
AF-A0A7I7ZZM0-F1-model_v4 deleted 0.667 2 113
AF-A4T0N6-F1-model_v4 Ferredoxin 0.6664 2 113 GO:0009055
GO:0046872
GO:0051538
GO:0051539

Feature Viewer

pLDDT pTM Quality
61.52 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map