F286258

General Info

Members Datasets Scaffolds Average Seq Length
186 131 373 158

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10000102|Ga0307406_1000010222
Length 161
Sequence MAAKKSSRQAHKKGVKQPSAIVNRRASYDYALGDTVTVGVVLTGREVRAARDGRVQLKGSFVTVRQNELWLNNASFSLALNSKGQHETSVDTTARKLLASRKEIDELYARKQDGMSIVPLRLLTQGRFIKLVIALGKGKKNYDKRQAIKKRDQERDTARSL

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
42 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
43 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
44 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
77 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
78 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
79 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
80 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
81 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
118 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
121 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
127 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
128 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
129 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.34
Nodule 0
Rhizoplane 1.61
Rhizosphere 70.43
Stem 0
Stem Tuber 0
Unclassified 13.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10000102 3300031901 Bacteria 49288
2 JGI24740J21852_10002697 3300001979 Bacteria 7968
3 JGI24739J22299_10000857 3300001989 Bacteria 11215
4 JGI24737J22298_10000452 3300001990 Bacteria 14115
5 JGI24743J22301_10013242 3300001991 Bacteria 1510
6 JGI24735J21928_10000054 3300002067 Bacteria 49038
7 JGI24738J21930_10001199 3300002075 Bacteria 7263
8 rootH1_10002360 3300003316 Bacteria 56099
9 rootH1_10002360 3300003323 Bacteria 3372
10 Ga0065712_10439985 3300005290 Unclassified 695
11 Ga0065715_10006403 3300005293 Bacteria 3638
12 Ga0070658_10000063 3300005327 Bacteria 107300
13 Ga0070683_100004853 3300005329 Bacteria 11137
14 Ga0070660_100052202 3300005339 Bacteria 3151
15 Ga0070661_100006621 3300005344 Bacteria 7991
16 Ga0070661_100269828 3300005344 Bacteria 1317
17 Ga0070692_10112707 3300005345 Bacteria 1506
18 Ga0070675_101210528 3300005354 Unclassified 695
19 Ga0070659_100001790 3300005366 Bacteria 15467
20 Ga0070659_100083254 3300005366 Unclassified 2557
21 Ga0068855_100000002 3300005563 Bacteria 616881
22 Ga0070664_100000051 3300005564 Bacteria 70646
23 Ga0068857_100246047 3300005577 Bacteria 1638
24 Ga0068854_100117124 3300005578 Bacteria 2017
25 Ga0068856_100000018 3300005614 Bacteria 151165
26 Ga0068856_100002398 3300005614 Bacteria 19281
27 Ga0068856_102041765 3300005614 Unclassified 583
28 Ga0068852_100000001 3300005616 Bacteria 716526
29 Ga0068852_100000045 3300005616 Bacteria 88494
30 Ga0075365_10000026 3300006038 Bacteria 61245
31 Ga0075365_10030320 3300006038 Unclassified 3463
32 Ga0075365_10071910 3300006038 Unclassified 2329
33 Ga0075365_10171769 3300006038 Bacteria 1513
34 Ga0075365_10226133 3300006038 Bacteria 1313
35 Ga0075368_10000128 3300006042 Bacteria 20142
36 Ga0075363_100007810 3300006048 Unclassified 4943
37 Ga0075364_10000781 3300006051 Bacteria 16736
38 Ga0075364_10020102 3300006051 Bacteria 4199
39 Ga0075367_10001381 3300006178 Bacteria 10368
40 Ga0075369_10001029 3300006186 Bacteria 9322
41 Ga0075369_10014929 3300006186 Bacteria 3110
42 Ga0075366_10001246 3300006195 Bacteria 12639
43 Ga0075370_10326988 3300006353 Bacteria 914
44 Ga0068871_100040160 3300006358 Bacteria 3747
45 Ga0068865_100001064 3300006881 Bacteria 15799
46 Ga0105244_10124255 3300009036 Unclassified 1248
47 Ga0105240_10001718 3300009093 Bacteria 36965
48 Ga0105240_10014184 3300009093 Bacteria 10884
49 Ga0105240_10201481 3300009093 Unclassified 2332
50 Ga0105245_10027872 3300009098 Bacteria 4978
51 Ga0105241_10067152 3300009174 Unclassified 2775
52 Ga0105248_12398527 3300009177 Unclassified 601
53 Ga0105237_10000002 3300009545 Bacteria 702357
54 Ga0105238_10002660 3300009551 Bacteria 17764
55 Ga0105032_100003 3300009979 Bacteria 186985
56 Ga0105029_100039 3300009984 Bacteria 6028
57 Ga0105029_106123 3300009984 Bacteria 854
58 Ga0105030_102326 3300009987 Bacteria 1663
59 Ga0105028_100932 3300009993 Bacteria 3086
60 Ga0105028_101087 3300009993 Unclassified 2872
61 Ga0105239_10000722 3300010375 Bacteria 46895
62 Ga0105239_10173355 3300010375 Bacteria 2413
63 Ga0105239_10181085 3300010375 Bacteria 2358
64 Ga0105246_10005353 3300011119 Bacteria 7812
65 Ga0105246_10400453 3300011119 Unclassified 1140
66 Ga0105246_10527062 3300011119 Bacteria 1008
67 Ga0105246_10754012 3300011119 Bacteria 859
68 Ga0157373_10016344 3300013100 Bacteria 5414
69 Ga0157371_10005390 3300013102 Bacteria 10802
70 Ga0157370_10007404 3300013104 Bacteria 11954
71 Ga0157369_10000024 3300013105 Bacteria 225851
72 Ga0157369_10005601 3300013105 Bacteria 14584
73 Ga0157369_10006357 3300013105 Bacteria 13711
74 Ga0157369_10008946 3300013105 Bacteria 11470
75 Ga0157369_10012651 3300013105 Bacteria 9570
76 Ga0157369_10652039 3300013105 Bacteria 1085
77 Ga0157374_10002360 3300013296 Bacteria 15919
78 Ga0157374_11201666 3300013296 Bacteria 779
79 Ga0157372_10000008 3300013307 Bacteria 305449
80 Ga0157372_10161804 3300013307 Bacteria 2587
81 Ga0157514_109437 3300013874 Bacteria 1393
82 Ga0157377_10000668 3300014745 Bacteria 14227
83 Ga0157376_10112409 3300014969 Bacteria 2400
84 Ga0207647_10000640 3300025904 Bacteria 27311
85 Ga0207705_10000093 3300025909 Bacteria 107314
86 Ga0207695_10002102 3300025913 Bacteria 30254
87 Ga0207695_10002605 3300025913 Bacteria 26438
88 Ga0207695_10140282 3300025913 Bacteria 2366
89 Ga0207695_10503336 3300025913 Unclassified 1093
90 Ga0207671_10000008 3300025914 Bacteria 798229
91 Ga0207657_10002779 3300025919 Bacteria 18849
92 Ga0207649_10010569 3300025920 Bacteria 5076
93 Ga0207694_10019228 3300025924 Bacteria 5164
94 Ga0207687_10091060 3300025927 Bacteria 2224
95 Ga0207690_10040820 3300025932 Bacteria 3036
96 Ga0207690_10060961 3300025932 Unclassified 2563
97 Ga0207706_10000209 3300025933 Bacteria 64890
98 Ga0207704_10000609 3300025938 Bacteria 15811
99 Ga0207661_10010521 3300025944 Bacteria 6663
100 Ga0207679_10001761 3300025945 Bacteria 13482
101 Ga0207667_10000005 3300025949 Bacteria 715503
102 Ga0207667_10000096 3300025949 Bacteria 143776
103 Ga0207640_10005721 3300025981 Bacteria 6772
104 Ga0207702_10000179 3300026078 Bacteria 76263
105 Ga0207702_10010516 3300026078 Bacteria 7739
106 Ga0207674_10028094 3300026116 Bacteria 5941
107 Ga0207674_10055610 3300026116 Unclassified 4022
108 Ga0207698_10000022 3300026142 Bacteria 131985
109 Ga0207698_10000165 3300026142 Bacteria 41957
110 Ga0210002_1007802 3300027617 Bacteria 1625
111 Ga0209974_10030847 3300027876 Bacteria 1775
112 Ga0314311_1140583 3300030733 Unclassified 2117
113 Ga0316179_1058425 3300030734 Bacteria 13049
114 Ga0316180_1168762 3300030736 Bacteria 1669
115 Ga0316183_1139918 3300030742 Bacteria 10398
116 Ga0316183_1168079 3300030742 Unclassified 2532
117 Ga0316181_1014881 3300030744 Bacteria 1667
118 Ga0316182_1017869 3300030745 Bacteria 3590
119 Ga0316182_1125898 3300030745 Bacteria 9786
120 Ga0316182_1366183 3300030745 Bacteria 7057
121 Ga0307516_10013501 3300031730 Bacteria 8694
122 Ga0307406_10000002 3300031901 Bacteria 255753
123 Ga0307412_11023234 3300031911 Bacteria 731
124 Ga0395899_0015497 3300037312 Bacteria 5811
125 Ga0395899_0021442 3300037312 Bacteria 4901
126 Ga0395900_0000001 3300037418 Bacteria 931146
127 Ga0395900_0790826 3300037418 Bacteria 877
128 Ga0395898_0000002 3300037466 Bacteria 931013
129 Ga0395901_0000072 3300038443 Bacteria 140394
130 Ga0395901_0136321 3300038443 Bacteria 2580
131 Ga0439438_016598 3300041405 Bacteria 2139
132 Ga0439466_0096607 3300041411 Bacteria 923
133 Ga0439442_011509 3300042002 Bacteria 1802
134 Ga0439445_0002501 3300042004 Bacteria 4091
135 Ga0439432_013234 3300042006 Bacteria 2809
136 Ga0439462_0088233 3300042015 Bacteria 850
137 Ga0450919_009340 3300042121 Bacteria 1126
138 Ga0450920_031609 3300042122 Bacteria 1043
139 Ga0439446_0004417 3300042156 Unclassified 3568
140 Ga0450909_000943 3300042185 Bacteria 3972
141 Ga0439464_0000043 3300042439 Bacteria 16217
142 Ga0466972_0026749 3300044658 Bacteria 2858
143 Ga0466965_0000136 3300044683 Bacteria 21041
144 Ga0453684_1049331 3300044712 Unclassified 864
145 Ga0495660_0000175 3300046810 Bacteria 69454
146 Ga0496100_0182834 3300048903 Bacteria 1517
147 Ga0496109_0813840 3300048912 Bacteria 872
148 Ga0496115_0000007 3300048918 Bacteria 244991
149 Ga0496121_0579177 3300048924 Bacteria 697
150 Ga0501034_0000090 3300049571 Bacteria 165117
151 Ga0501037_0000001 3300049573 Bacteria 753276
152 Ga0501038_0015706 3300049574 Bacteria 6881
153 nmdc:mga03n38_100698_c1 3300050490 Bacteria 1393
154 nmdc:mga00v17_101_c1 3300050491 Bacteria 50798
155 nmdc:mga00v17_51227_c1 3300050491 Bacteria 2510
156 nmdc:mga0yw44_15_c2 3300050492 Bacteria 56226
157 nmdc:mga0yw44_233735_c1 3300050492 Unclassified 1220
158 nmdc:mga0yw44_444923_c1 3300050492 Bacteria 878
159 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
160 nmdc:mga0k408_24002_c1 3300050493 Bacteria 3444
161 nmdc:mga06z11_111172_c1 3300050494 Bacteria 1517
162 nmdc:mga06z11_284_c1 3300050494 Bacteria 19699
163 nmdc:mga04h51_10424_c1 3300050495 Unclassified 2553
164 nmdc:mga07m45_364796_c1 3300050496 Bacteria 839
165 nmdc:mga07m45_509685_c1 3300050496 Unclassified 697
166 nmdc:mga07m45_978_c1 3300050496 Bacteria 12578
167 nmdc:mga0sz30_29687_c1 3300050516 Bacteria 2256
168 Ga0500643_015854 3300053087 Bacteria 2572
169 Ga0500643_039948 3300053087 Bacteria 1383
170 Ga0500644_0030265 3300053088 Bacteria 1711
171 Ga0500646_0000001 3300053090 Bacteria 273936
172 Ga0500646_0039198 3300053090 Bacteria 1328
173 Ga0500583_0023872 3300053092 Bacteria 2585
174 Ga0500583_0141365 3300053092 Bacteria 1196
175 Ga0500583_0491446 3300053092 Unclassified 577
176 Ga0500651_0000001 3300053093 Bacteria 529808
177 Ga0500641_0000001 3300053096 Bacteria 1115973
178 Ga0500650_0009862 3300053098 Bacteria 3853
179 Ga0500556_0051284 3300053104 Unclassified 1494
180 Ga0500594_0000004 3300053118 Bacteria 174508
181 Ga0500652_000007 3300053131 Bacteria 165913
182 Ga0500655_003384 3300053133 Bacteria 2884
183 Ga0500577_0047750 3300053142 Bacteria 1593
184 Ga0500616_0000067 3300053153 Bacteria 236311
185 Ga0500616_0076371 3300053153 Bacteria 1694
186 Ga0500616_0087619 3300053153 Bacteria 1549
187 Ga0500613_000849 3300053738 Unclassified 1893
188 Ga0307406_10000102
189 JGI24740J21852_10002697
190 JGI24739J22299_10000857
191 JGI24737J22298_10000452
192 JGI24743J22301_10013242
193 JGI24735J21928_10000054
194 JGI24738J21930_10001199
195 rootH1_10002360
196 Ga0065712_10439985
197 Ga0065715_10006403
198 Ga0070658_10000063
199 Ga0070683_100004853
200 Ga0070660_100052202
201 Ga0070661_100006621
202 Ga0070661_100269828
203 Ga0070692_10112707
204 Ga0070675_101210528
205 Ga0070659_100001790
206 Ga0070659_100083254
207 Ga0068855_100000002
208 Ga0070664_100000051
209 Ga0068857_100246047
210 Ga0068854_100117124
211 Ga0068856_100000018
212 Ga0068856_100002398
213 Ga0068856_102041765
214 Ga0068852_100000001
215 Ga0068852_100000045
216 Ga0075365_10000026
217 Ga0075365_10030320
218 Ga0075365_10071910
219 Ga0075365_10171769
220 Ga0075365_10226133
221 Ga0075368_10000128
222 Ga0075363_100007810
223 Ga0075364_10000781
224 Ga0075364_10020102
225 Ga0075367_10001381
226 Ga0075369_10001029
227 Ga0075369_10014929
228 Ga0075366_10001246
229 Ga0075370_10326988
230 Ga0068871_100040160
231 Ga0068865_100001064
232 Ga0105244_10124255
233 Ga0105240_10001718
234 Ga0105240_10014184
235 Ga0105240_10201481
236 Ga0105245_10027872
237 Ga0105241_10067152
238 Ga0105248_12398527
239 Ga0105237_10000002
240 Ga0105238_10002660
241 Ga0105032_100003
242 Ga0105029_100039
243 Ga0105029_106123
244 Ga0105030_102326
245 Ga0105028_100932
246 Ga0105028_101087
247 Ga0105239_10000722
248 Ga0105239_10173355
249 Ga0105239_10181085
250 Ga0105246_10005353
251 Ga0105246_10400453
252 Ga0105246_10527062
253 Ga0105246_10754012
254 Ga0157373_10016344
255 Ga0157371_10005390
256 Ga0157370_10007404
257 Ga0157369_10000024
258 Ga0157369_10005601
259 Ga0157369_10006357
260 Ga0157369_10008946
261 Ga0157369_10012651
262 Ga0157369_10652039
263 Ga0157374_10002360
264 Ga0157374_11201666
265 Ga0157372_10000008
266 Ga0157372_10161804
267 Ga0157514_109437
268 Ga0157377_10000668
269 Ga0157376_10112409
270 Ga0207647_10000640
271 Ga0207705_10000093
272 Ga0207695_10002102
273 Ga0207695_10002605
274 Ga0207695_10140282
275 Ga0207695_10503336
276 Ga0207671_10000008
277 Ga0207657_10002779
278 Ga0207649_10010569
279 Ga0207694_10019228
280 Ga0207687_10091060
281 Ga0207690_10040820
282 Ga0207690_10060961
283 Ga0207706_10000209
284 Ga0207704_10000609
285 Ga0207661_10010521
286 Ga0207679_10001761
287 Ga0207667_10000005
288 Ga0207667_10000096
289 Ga0207640_10005721
290 Ga0207702_10000179
291 Ga0207702_10010516
292 Ga0207674_10028094
293 Ga0207674_10055610
294 Ga0207698_10000022
295 Ga0207698_10000165
296 Ga0210002_1007802
297 Ga0209974_10030847
298 Ga0314311_1140583
299 Ga0316179_1058425
300 Ga0316180_1168762
301 Ga0316183_1139918
302 Ga0316183_1168079
303 Ga0316181_1014881
304 Ga0316182_1017869
305 Ga0316182_1125898
306 Ga0316182_1366183
307 Ga0307516_10013501
308 Ga0307406_10000002
309 Ga0307412_11023234
310 Ga0395899_0015497
311 Ga0395899_0021442
312 Ga0395900_0000001
313 Ga0395900_0790826
314 Ga0395898_0000002
315 Ga0395901_0000072
316 Ga0395901_0136321
317 Ga0439438_016598
318 Ga0439466_0096607
319 Ga0439442_011509
320 Ga0439445_0002501
321 Ga0439432_013234
322 Ga0439462_0088233
323 Ga0450919_009340
324 Ga0450920_031609
325 Ga0439446_0004417
326 Ga0450909_000943
327 Ga0439464_0000043
328 Ga0466972_0026749
329 Ga0466965_0000136
330 Ga0453684_1049331
331 Ga0495660_0000175
332 Ga0496100_0182834
333 Ga0496109_0813840
334 Ga0496115_0000007
335 Ga0496121_0579177
336 Ga0501034_0000090
337 Ga0501037_0000001
338 Ga0501038_0015706
339 nmdc:mga03n38_100698_c1
340 nmdc:mga00v17_101_c1
341 nmdc:mga00v17_51227_c1
342 nmdc:mga0yw44_15_c2
343 nmdc:mga0yw44_233735_c1
344 nmdc:mga0yw44_444923_c1
345 nmdc:mga0yw44_6_c1
346 nmdc:mga0k408_24002_c1
347 nmdc:mga06z11_111172_c1
348 nmdc:mga06z11_284_c1
349 nmdc:mga04h51_10424_c1
350 nmdc:mga07m45_364796_c1
351 nmdc:mga07m45_509685_c1
352 nmdc:mga07m45_978_c1
353 nmdc:mga0sz30_29687_c1
354 Ga0500643_015854
355 Ga0500643_039948
356 Ga0500644_0030265
357 Ga0500646_0000001
358 Ga0500646_0039198
359 Ga0500583_0023872
360 Ga0500583_0141365
361 Ga0500583_0491446
362 Ga0500651_0000001
363 Ga0500641_0000001
364 Ga0500650_0009862
365 Ga0500556_0051284
366 Ga0500594_0000004
367 Ga0500652_000007
368 Ga0500655_003384
369 Ga0500577_0047750
370 Ga0500616_0000067
371 Ga0500616_0076371
372 Ga0500616_0087619
373 Ga0500613_000849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01668

SmpB

SmpB protein

20

161

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ljp-assembly2.cif.gz_B structure of thermotoga maritima smpb 0.8495 16 134
1p6v-assembly2.cif.gz_C crystal structure of the trna domain of transfer-messenger rna in complex with smpb 0.849 14 135
1wjx-assembly1.cif.gz_A crystal sturucture of tt0801 from thermus thermophilus 0.8332 15 134
2ob7-assembly1.cif.gz_B structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.8263 14 135
2ob7-assembly1.cif.gz_C structure of tmrna-(smpb)2 complex as inferred from cryo-em 0.8199 14 130
ID Description Score Start End Superfamily
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.906 16 136 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8541 12 134 2.40.280.10
2czjC00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8473 12 134 2.40.280.10
af_P0A832_7_135_2.40.280.10 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.8382 16 136 2.40.280.10
1j1hA00 Mainly Beta;Beta Barrel;Small Protein B; Chain: A;;Small protein B 0.6428 13 134 2.40.280.10
ID Description Score Start End GO Terms
AF-A0A381Z638-F1-model_v4 SsrA-binding protein 0.8978 16 134 GO:0003723
GO:0005829
AF-A0A660ZPQ7-F1-model_v4 SsrA-binding protein 0.8968 16 135 GO:0003723
GO:0005829
AF-A0A1F8BBW5-F1-model_v4 SsrA-binding protein 0.8939 14 142 GO:0003723
GO:0005829
AF-A0A3C2AI62-F1-model_v4 SsrA-binding protein 0.8929 16 135 GO:0003723
GO:0005829
AF-A0A3B9P471-F1-model_v4 SsrA-binding protein 0.8894 14 138 GO:0003723
GO:0005829

Map