F286248

General Info

Members Datasets Scaffolds Average Seq Length
186 131 150 260

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10107053|Ga0307405_101070532
Length 293
Sequence VLLNAPGNAWQRGESGDPADEAALPPHPVTAALDRPVVAGGEQPLAPITATLRAMFGTSTQLPGLAPDLLIADPAGWEPTTELTGARLDTLLDAGRRRWNAQPPAAAALAWKAYTYWLALPAVLGWASARRVPLLTAGDVLMHFDDPRPLVTLGLRSEIPVAVLPSDPLALSGLPQVRVVHDETQLLALFRSSLLDQHLTPLLDAIHGRVRLGKRTLLGSLSSGVAYAVLRSADVLPGSSAETIDKLLTALGVDDLIELVPAGNGKLDVQRKTCCLAFTLPQPKICAGCCIKP

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
3 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
4 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
5 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
6 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
7 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
8 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
9 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
10 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
11 2855683550 Micromonospora sp. RP3T Isolate Unclassified
12 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
13 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
14 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
15 2858868258 Micromonospora sp. MH33 Isolate Unclassified
16 2858882152 Micromonospora noduli MED15 Isolate Nodule
17 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
18 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
19 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
20 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
21 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
22 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
23 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
24 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
25 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
26 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
27 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
28 2902582711 Micromonospora sp. AP08 Isolate Unclassified
29 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
30 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
31 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
98 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
99 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
107 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
108 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
109 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
120 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
121 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
124 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 649633069 Micromonospora sp. L5 Isolate Unclassified
127 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
128 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
129 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
130 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
131 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.65
Metatranscriptomes 0
Isolates 19.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 2.69
Rhizoplane 1.08
Rhizosphere 68.82
Stem 0
Stem Tuber 0
Unclassified 24.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10031246 3300003316 Bacteria 3824
2 rootH1_10120849 3300003316 Bacteria 1898
3 rootL2_10039944 3300003322 Bacteria 9727
4 Ga0070683_100002904 3300005329 Bacteria 13727
5 Ga0070690_100288403 3300005330 Bacteria 1173
6 Ga0068869_100551797 3300005334 Bacteria 968
7 Ga0070682_100468392 3300005337 Bacteria 969
8 Ga0068868_100057329 3300005338 Bacteria 3077
9 Ga0070668_100002368 3300005347 Bacteria 13863
10 Ga0070668_100185308 3300005347 Bacteria 1702
11 Ga0070675_100019073 3300005354 Bacteria 5464
12 Ga0070673_100450362 3300005364 Bacteria 1158
13 Ga0070659_100007107 3300005366 Bacteria 8119
14 Ga0070701_10113641 3300005438 Bacteria 1516
15 Ga0070662_100025112 3300005457 Bacteria 4111
16 Ga0070684_100008784 3300005535 Bacteria 7923
17 Ga0070684_100132063 3300005535 Bacteria 2253
18 Ga0070665_100085339 3300005548 Bacteria 3163
19 Ga0070664_100000216 3300005564 Bacteria 41059
20 Ga0070664_100247221 3300005564 Bacteria 1602
21 Ga0068852_100074053 3300005616 Bacteria 2998
22 Ga0068864_100261522 3300005618 Bacteria 1610
23 Ga0068858_100036794 3300005842 Bacteria 4538
24 Ga0068860_100028135 3300005843 Bacteria 5411
25 Ga0068860_100134653 3300005843 Bacteria 2372
26 Ga0068862_100017701 3300005844 Bacteria 5932
27 Ga0068862_100027243 3300005844 Bacteria 4809
28 Ga0081539_10000070 3300005985 Bacteria 235651
29 Ga0081539_10001053 3300005985 Bacteria 50504
30 Ga0081539_10002343 3300005985 Bacteria 27234
31 Ga0081539_10002533 3300005985 Bacteria 25494
32 Ga0070716_100125798 3300006173 Bacteria 1612
33 Ga0075428_100000588 3300006844 Bacteria 37105
34 Ga0075428_100003475 3300006844 Bacteria 17235
35 Ga0075428_100008209 3300006844 Bacteria 11582
36 Ga0075428_100526943 3300006844 Bacteria 1263
37 Ga0075428_100532147 3300006844 Unclassified 1257
38 Ga0075428_100542809 3300006844 Unclassified 1243
39 Ga0075430_100007937 3300006846 Bacteria 8972
40 Ga0075430_100131449 3300006846 Bacteria 2086
41 Ga0075430_100187276 3300006846 Bacteria 1721
42 Ga0075430_100214765 3300006846 Bacteria 1596
43 Ga0075430_100524496 3300006846 Unclassified 977
44 Ga0075431_100022557 3300006847 Bacteria 6436
45 Ga0075431_100026358 3300006847 Bacteria 5964
46 Ga0075431_100112976 3300006847 Bacteria 2803
47 Ga0075429_100038295 3300006880 Bacteria 4174
48 Ga0075429_100061627 3300006880 Bacteria 3268
49 Ga0075429_100368018 3300006880 Bacteria 1259
50 Ga0111539_10001288 3300009094 Bacteria 33483
51 Ga0105245_10002128 3300009098 Bacteria 17926
52 Ga0114129_10002487 3300009147 Bacteria 25586
53 Ga0114129_10005407 3300009147 Bacteria 18035
54 Ga0114129_10005624 3300009147 Bacteria 17733
55 Ga0105249_10750612 3300009553 Bacteria 1038
56 Ga0163163_10199683 3300014325 Bacteria 2048
57 Ga0207688_10030790 3300025901 Bacteria 2960
58 Ga0207650_10148425 3300025925 Bacteria 1849
59 Ga0207687_10021791 3300025927 Bacteria 4259
60 Ga0207706_10018420 3300025933 Bacteria 6283
61 Ga0207665_10124258 3300025939 Bacteria 1826
62 Ga0207689_10004394 3300025942 Bacteria 12813
63 Ga0207661_10018175 3300025944 Bacteria 5223
64 Ga0207651_10216436 3300025960 Bacteria 1546
65 Ga0207668_10379778 3300025972 Bacteria 1189
66 Ga0207703_10052830 3300026035 Bacteria 3301
67 Ga0207678_10048765 3300026067 Bacteria 3660
68 Ga0207708_10012227 3300026075 Bacteria 6401
69 Ga0207676_10138380 3300026095 Bacteria 2081
70 Ga0207674_10054770 3300026116 Bacteria 4060
71 Ga0268266_10812832 3300028379 Bacteria 903
72 Ga0268265_10077486 3300028380 Bacteria 2611
73 Ga0268264_10078082 3300028381 Bacteria 2822
74 Ga0268264_10220143 3300028381 Bacteria 1747
75 Ga0268264_10298527 3300028381 Bacteria 1515
76 Ga0307515_10000083 3300028794 Bacteria 222889
77 Ga0307515_10020141 3300028794 Bacteria 11925
78 Ga0307515_10075736 3300028794 Bacteria 4477
79 Ga0307512_10003714 3300030522 Bacteria 17336
80 Ga0307512_10051320 3300030522 Bacteria 3301
81 Ga0307513_10010477 3300031456 Bacteria 11616
82 Ga0307513_10027858 3300031456 Bacteria 6476
83 Ga0307408_100444155 3300031548 Bacteria 1124
84 Ga0307508_10007107 3300031616 Bacteria 10432
85 Ga0307508_10008702 3300031616 Bacteria 9367
86 Ga0307508_10031842 3300031616 Bacteria 4766
87 Ga0307508_10419880 3300031616 Bacteria 929
88 Ga0307516_10012029 3300031730 Bacteria 9355
89 Ga0307516_10018737 3300031730 Bacteria 7188
90 Ga0307516_10458555 3300031730 Bacteria 930
91 Ga0307405_10045242 3300031731 Bacteria 2696
92 Ga0307405_10107053 3300031731 Bacteria 1887
93 Ga0307413_10073126 3300031824 Bacteria 2166
94 Ga0307410_10020656 3300031852 Bacteria 4034
95 Ga0326468_10000395 3300031889 Bacteria 4609
96 Ga0307406_10001677 3300031901 Bacteria 12178
97 Ga0307407_10005475 3300031903 Bacteria 5514
98 Ga0307407_10077571 3300031903 Bacteria 1999
99 Ga0307412_10106121 3300031911 Bacteria 1997
100 Ga0307409_100018400 3300031995 Bacteria 4696
101 Ga0307409_100076075 3300031995 Bacteria 2691
102 Ga0307416_100253777 3300032002 Unclassified 1714
103 Ga0307416_100538452 3300032002 Bacteria 1239
104 Ga0307411_10426740 3300032005 Bacteria 1103
105 Ga0307415_100007372 3300032126 Bacteria 6015
106 Ga0307415_100026881 3300032126 Bacteria 3637
107 Ga0307415_100047240 3300032126 Bacteria 2897
108 Ga0307415_100082933 3300032126 Bacteria 2295
109 Ga0307415_100260824 3300032126 Bacteria 1414
110 Ga0373948_0009705 3300034817 Bacteria 1666
111 Ga0373938_0056331 3300034957 Bacteria 910
112 Ga0373951_0003587 3300035091 Bacteria 3743
113 Ga0373942_0018254 3300035207 Bacteria 1739
114 Ga0395899_0008664 3300037312 Bacteria 7827
115 Ga0395900_0142189 3300037418 Bacteria 2456
116 Ga0395900_0256888 3300037418 Bacteria 1746
117 Ga0395898_0007312 3300037466 Bacteria 11723
118 Ga0395905_0041213 3300037471 Bacteria 4333
119 Ga0395901_0013034 3300038443 Bacteria 8437
120 Ga0451800_1067534 3300041459 Bacteria 958
121 Ga0451837_1513476 3300041494 Bacteria 973
122 Ga0451845_0447766 3300041501 Bacteria 1499
123 Ga0451849_0770688 3300041505 Bacteria 1069
124 Ga0451853_0149980 3300041512 Bacteria 3924
125 Ga0466967_0161850 3300045976 Bacteria 2101
126 Ga0495632_0064080 3300046519 Bacteria 1778
127 Ga0496108_0000121 3300048911 Bacteria 77401
128 Ga0501045_0171336 3300049824 Bacteria 1617
129 nmdc:mga05p37_30235_c1 3300050507 Bacteria 6608
130 nmdc:mga05p37_4156_c1 3300050507 Bacteria 16904
131 nmdc:mga05p37_60129_c1 3300050507 Bacteria 4679
132 nmdc:mga09592_64_c2 3300050508 Bacteria 55104
133 nmdc:mga09592_7074_c1 3300050508 Bacteria 9114
134 nmdc:mga0qj67_188710_c1 3300050509 Bacteria 1675
135 nmdc:mga0qj67_205552_c1 3300050509 Bacteria 1599
136 nmdc:mga0qj67_428262_c1 3300050509 Unclassified 1067
137 nmdc:mga0qj67_430705_c1 3300050509 Unclassified 1063
138 nmdc:mga0qj67_4960_c1 3300050509 Bacteria 9673
139 nmdc:mga0qj67_93136_c1 3300050509 Bacteria 2422
140 nmdc:mga0qj67_93_c2 3300050509 Bacteria 55104
141 nmdc:mga06r32_1096_c2 3300050510 Bacteria 19407
142 nmdc:mga06r32_17536_c1 3300050510 Bacteria 6536
143 nmdc:mga06r32_181497_c1 3300050510 Bacteria 2091
144 Ga0500646_0006465 3300053090 Bacteria 2980
145 Ga0500641_0017573 3300053096 Bacteria 2678
146 Ga0500660_057374 3300053100 Bacteria 1893
147 Ga0500556_0086816 3300053104 Bacteria 1190
148 Ga0500588_0003101 3300053146 Bacteria 3469
149 Ga0500600_0054235 3300053149 Bacteria 2261
150 Ga0501084_0719128 3300054114 Bacteria 842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10054770 Ga0207674_100547703 210
2 3300050509 nmdc:mga0qj67_430705_c1 nmdc:mga0qj67_430705_c1_123_845 220
3 3300048911 Ga0496108_0000121 Ga0496108_0000121_13568_14350 235
4 iso_pu_bacteria 2751185782 2753271921 235
5 3300006846 Ga0075430_100524496 Ga0075430_1005244961 237
6 3300034957 Ga0373938_0056331 Ga0373938_0056331_50_766 238
7 3300041459 Ga0451800_1067534 Ga0451800_1067534_102_818 238
8 3300041501 Ga0451845_0447766 Ga0451845_0447766_45_761 238
9 3300041505 Ga0451849_0770688 Ga0451849_0770688_135_851 238
10 3300041512 Ga0451853_0149980 Ga0451853_0149980_315_1031 238
11 3300005564 Ga0070664_100247221 Ga0070664_1002472212 239
12 3300006844 Ga0075428_100000588 Ga0075428_10000058837 239
13 3300006844 Ga0075428_100008209 Ga0075428_1000082096 239
14 3300006846 Ga0075430_100007937 Ga0075430_1000079378 239
15 3300006847 Ga0075431_100022557 Ga0075431_10002255710 239
16 3300006847 Ga0075431_100112976 Ga0075431_1001129763 239
17 3300006880 Ga0075429_100038295 Ga0075429_1000382956 239
18 3300006880 Ga0075429_100061627 Ga0075429_1000616272 239
19 3300009147 Ga0114129_10005407 Ga0114129_1000540720 239
20 3300009147 Ga0114129_10005624 Ga0114129_1000562410 239
21 3300041494 Ga0451837_1513476 Ga0451837_1513476_212_931 239
22 3300050507 nmdc:mga05p37_4156_c1 nmdc:mga05p37_4156_c1_12992_13795 239
23 3300050507 nmdc:mga05p37_60129_c1 nmdc:mga05p37_60129_c1_2722_3468 239
24 3300050508 nmdc:mga09592_64_c2 nmdc:mga09592_64_c2_3851_4654 239
25 3300050508 nmdc:mga09592_7074_c1 nmdc:mga09592_7074_c1_1083_1829 239
26 3300050509 nmdc:mga0qj67_4960_c1 nmdc:mga0qj67_4960_c1_4722_5468 239
27 3300050509 nmdc:mga0qj67_93_c2 nmdc:mga0qj67_93_c2_3851_4654 239
28 3300050510 nmdc:mga06r32_1096_c2 nmdc:mga06r32_1096_c2_3979_4782 239
29 3300050510 nmdc:mga06r32_181497_c1 nmdc:mga06r32_181497_c1_773_1519 239
30 3300053104 Ga0500556_0086816 Ga0500556_0086816_22_741 239
31 3300050509 nmdc:mga0qj67_428262_c1 nmdc:mga0qj67_428262_c1_168_953 240
32 3300050507 nmdc:mga05p37_30235_c1 nmdc:mga05p37_30235_c1_4426_5154 241
33 3300053090 Ga0500646_0006465 Ga0500646_0006465_18_791 241
34 3300005535 Ga0070684_100132063 Ga0070684_1001320633 243
35 3300005618 Ga0068864_100261522 Ga0068864_1002615223 243
36 3300014325 Ga0163163_10199683 Ga0163163_101996832 243
37 3300026095 Ga0207676_10138380 Ga0207676_101383802 243
38 3300037418 Ga0395900_0256888 Ga0395900_0256888_697_1431 244
39 3300038443 Ga0395901_0013034 Ga0395901_0013034_3905_4639 244
40 3300049824 Ga0501045_0171336 Ga0501045_0171336_790_1578 246
41 3300054114 Ga0501084_0719128 Ga0501084_0719128_14_802 246
42 3300032002 Ga0307416_100253777 Ga0307416_1002537771 247
43 3300006173 Ga0070716_100125798 Ga0070716_1001257982 248
44 3300025939 Ga0207665_10124258 Ga0207665_101242582 248
45 3300006844 Ga0075428_100003475 Ga0075428_1000034757 250
46 3300006847 Ga0075431_100026358 Ga0075431_1000263586 250
47 3300050510 nmdc:mga06r32_17536_c1 nmdc:mga06r32_17536_c1_3984_4748 250
48 3300006844 Ga0075428_100532147 Ga0075428_1005321472 251
49 3300031616 Ga0307508_10008702 Ga0307508_100087024 253
50 3300037312 Ga0395899_0008664 Ga0395899_0008664_500_1267 253
51 3300037418 Ga0395900_0142189 Ga0395900_0142189_184_951 253
52 3300037466 Ga0395898_0007312 Ga0395898_0007312_6010_6777 253
53 3300037471 Ga0395905_0041213 Ga0395905_0041213_3162_3929 253
54 3300053096 Ga0500641_0017573 Ga0500641_0017573_558_1379 253
55 3300053146 Ga0500588_0003101 Ga0500588_0003101_1118_1939 253
56 iso_pu_bacteria 2622736626 2623585615 253
57 iso_pu_bacteria 2855670206 2855674241 253
58 iso_pu_bacteria 2855676851 2855679900 253
59 iso_pu_bacteria 2857288857 2857290893 253
60 iso_pu_bacteria 2858848962 2858853872 253
61 iso_pu_bacteria 2858882152 2858885106 253
62 iso_pu_bacteria 2858888857 2858893152 253
63 iso_pu_bacteria 2858895516 2858901838 253
64 iso_pu_bacteria 2869061728 2869062001 253
65 iso_pu_bacteria 2880489317 2880494611 253
66 iso_pu_bacteria 2880495981 2880497704 253
67 iso_pu_bacteria 2929226422 2929232974 253
68 iso_pu_bacteria 2996221748 2996222958 253
69 iso_pu_bacteria 649633069 649816227 253
70 iso_pu_bacteria 8054704163 8054709712 253
71 iso_pu_bacteria 8054734606 8054740335 253
72 3300006880 Ga0075429_100368018 Ga0075429_1003680182 254
73 3300009147 Ga0114129_10002487 Ga0114129_1000248722 254
74 iso_pu_bacteria 2869068681 2869071168 254
75 3300005334 Ga0068869_100551797 Ga0068869_1005517971 255
76 iso_pu_bacteria 2831935698 2831938894 255
77 iso_pu_bacteria 8001781756 8001782988 255
78 3300006846 Ga0075430_100131449 Ga0075430_1001314493 256
79 3300009094 Ga0111539_10001288 Ga0111539_1000128811 256
80 3300009098 Ga0105245_10002128 Ga0105245_100021287 256
81 iso_pu_bacteria 2855683550 2855689926 256
82 3300035207 Ga0373942_0018254 Ga0373942_0018254_557_1363 257
83 iso_pu_bacteria 2501939600 2501943421 257
84 iso_pu_bacteria 2515154129 2515720729 257
85 iso_pu_bacteria 2515154202 2516087101 257
86 iso_pu_bacteria 2832004796 2832006803 257
87 iso_pu_bacteria 2856858025 2856859519 257
88 iso_pu_bacteria 2858868258 2858872263 257
89 iso_pu_bacteria 2858902515 2858905071 257
90 iso_pu_bacteria 2866065130 2866067193 257
91 iso_pu_bacteria 2869048445 2869053371 257
92 iso_pu_bacteria 2902582711 2902588377 257
93 iso_pu_bacteria 8054727385 8054728296 257
94 3300053100 Ga0500660_057374 Ga0500660_057374_840_1625 258
95 iso_pu_bacteria 2675903059 2676482866 258
96 iso_pu_bacteria 2867319477 2867324087 258
97 iso_pu_bacteria 2867507094 2867509753 258
98 iso_pu_bacteria 8003856774 8003857905 258
99 3300006846 Ga0075430_100214765 Ga0075430_1002147652 259
100 3300050509 nmdc:mga0qj67_205552_c1 nmdc:mga0qj67_205552_c1_203_988 259
101 3300003316 rootH1_10120849 rootH1_101208492 260
102 3300003322 rootL2_10039944 rootL2_100399448 260
103 3300005329 Ga0070683_100002904 Ga0070683_1000029046 260
104 3300005330 Ga0070690_100288403 Ga0070690_1002884031 260
105 3300005338 Ga0068868_100057329 Ga0068868_1000573291 260
106 3300005347 Ga0070668_100185308 Ga0070668_1001853082 260
107 3300005354 Ga0070675_100019073 Ga0070675_1000190735 260
108 3300005364 Ga0070673_100450362 Ga0070673_1004503621 260
109 3300005366 Ga0070659_100007107 Ga0070659_1000071074 260
110 3300005438 Ga0070701_10113641 Ga0070701_101136412 260
111 3300005457 Ga0070662_100025112 Ga0070662_1000251124 260
112 3300005535 Ga0070684_100008784 Ga0070684_1000087845 260
113 3300005564 Ga0070664_100000216 Ga0070664_10000021636 260
114 3300005616 Ga0068852_100074053 Ga0068852_1000740532 260
115 3300005844 Ga0068862_100027243 Ga0068862_1000272432 260
116 3300006844 Ga0075428_100526943 Ga0075428_1005269432 260
117 3300025901 Ga0207688_10030790 Ga0207688_100307902 260
118 3300025925 Ga0207650_10148425 Ga0207650_101484252 260
119 3300025927 Ga0207687_10021791 Ga0207687_100217912 260
120 3300025933 Ga0207706_10018420 Ga0207706_100184204 260
121 3300025942 Ga0207689_10004394 Ga0207689_1000439413 260
122 3300025944 Ga0207661_10018175 Ga0207661_100181753 260
123 3300025960 Ga0207651_10216436 Ga0207651_102164362 260
124 3300025972 Ga0207668_10379778 Ga0207668_103797781 260
125 3300026067 Ga0207678_10048765 Ga0207678_100487652 260
126 3300026075 Ga0207708_10012227 Ga0207708_100122274 260
127 3300028381 Ga0268264_10078082 Ga0268264_100780822 260
128 3300031548 Ga0307408_100444155 Ga0307408_1004441551 260
129 3300034817 Ga0373948_0009705 Ga0373948_0009705_591_1373 260
130 3300005337 Ga0070682_100468392 Ga0070682_1004683921 261
131 3300005548 Ga0070665_100085339 Ga0070665_1000853392 261
132 3300005842 Ga0068858_100036794 Ga0068858_1000367942 261
133 3300005843 Ga0068860_100028135 Ga0068860_1000281354 261
134 3300005844 Ga0068862_100017701 Ga0068862_1000177013 261
135 3300026035 Ga0207703_10052830 Ga0207703_100528302 261
136 3300028379 Ga0268266_10812832 Ga0268266_108128321 261
137 3300028381 Ga0268264_10220143 Ga0268264_102201432 261
138 3300031995 Ga0307409_100076075 Ga0307409_1000760754 261
139 3300032002 Ga0307416_100538452 Ga0307416_1005384521 261
140 3300032126 Ga0307415_100260824 Ga0307415_1002608242 261
141 3300050509 nmdc:mga0qj67_93136_c1 nmdc:mga0qj67_93136_c1_1003_1812 261
142 3300005985 Ga0081539_10000070 Ga0081539_10000070184 262
143 3300031995 Ga0307409_100018400 Ga0307409_1000184002 262
144 3300032005 Ga0307411_10426740 Ga0307411_104267401 262
145 3300032126 Ga0307415_100007372 Ga0307415_1000073724 262
146 3300032126 Ga0307415_100082933 Ga0307415_1000829332 262
147 3300031456 Ga0307513_10010477 Ga0307513_100104772 263
148 3300005985 Ga0081539_10001053 Ga0081539_1000105350 264
149 3300006844 Ga0075428_100542809 Ga0075428_1005428091 264
150 3300006846 Ga0075430_100187276 Ga0075430_1001872761 264
151 3300031616 Ga0307508_10031842 Ga0307508_100318423 264
152 3300031730 Ga0307516_10018737 Ga0307516_100187371 264
153 3300050509 nmdc:mga0qj67_188710_c1 nmdc:mga0qj67_188710_c1_343_1143 264
154 3300031731 Ga0307405_10107053 Ga0307405_101070532 265
155 3300031824 Ga0307413_10073126 Ga0307413_100731262 265
156 3300031852 Ga0307410_10020656 Ga0307410_100206562 265
157 3300031889 Ga0326468_10000395 Ga0326468_100003953 265
158 3300031901 Ga0307406_10001677 Ga0307406_100016772 265
159 3300031903 Ga0307407_10005475 Ga0307407_100054753 265
160 3300031903 Ga0307407_10077571 Ga0307407_100775713 265
161 3300031911 Ga0307412_10106121 Ga0307412_101061212 265
162 3300032126 Ga0307415_100026881 Ga0307415_1000268813 265
163 3300032126 Ga0307415_100047240 Ga0307415_1000472402 265
164 3300005347 Ga0070668_100002368 Ga0070668_1000023682 266
165 3300005843 Ga0068860_100134653 Ga0068860_1001346532 266
166 3300005985 Ga0081539_10002343 Ga0081539_100023439 266
167 3300028380 Ga0268265_10077486 Ga0268265_100774862 266
168 3300031731 Ga0307405_10045242 Ga0307405_100452422 266
169 3300035091 Ga0373951_0003587 Ga0373951_0003587_386_1186 266
170 3300005985 Ga0081539_10002533 Ga0081539_1000253328 267
171 3300028381 Ga0268264_10298527 Ga0268264_102985271 267
172 3300045976 Ga0466967_0161850 Ga0466967_0161850_879_1682 267
173 3300003316 rootH1_10031246 rootH1_100312464 268
174 3300009553 Ga0105249_10750612 Ga0105249_107506121 268
175 3300028794 Ga0307515_10000083 Ga0307515_100000833 268
176 3300028794 Ga0307515_10020141 Ga0307515_100201419 268
177 3300028794 Ga0307515_10075736 Ga0307515_100757362 268
178 3300030522 Ga0307512_10003714 Ga0307512_1000371415 268
179 3300030522 Ga0307512_10051320 Ga0307512_100513202 268
180 3300031456 Ga0307513_10027858 Ga0307513_100278584 268
181 3300031616 Ga0307508_10007107 Ga0307508_100071072 268
182 3300031616 Ga0307508_10419880 Ga0307508_104198801 268
183 3300031730 Ga0307516_10012029 Ga0307516_100120294 268
184 3300031730 Ga0307516_10458555 Ga0307516_104585551 268
185 3300046519 Ga0495632_0064080 Ga0495632_0064080_800_1606 268
186 3300053149 Ga0500600_0054235 Ga0500600_0054235_569_1375 268

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cbb-assembly2.cif.gz_B crystal structure of sbnc in the biosynthesis of staphyloferrin b 0.7264 52 223
5jm8-assembly1.cif.gz_A the structure of atp-bound aerobactin synthetase iuca from a hypervirulent pathotype of klebsiella pneumoniae 0.7047 52 223
7qp5-assembly1.cif.gz_A crystal structure of e. coli fhuf 0.6834 18 266
7qp5-assembly1.cif.gz_A crystal structure of e. coli fhuf 0.6736 18 266
2w02-assembly1.cif.gz_A co-complex structure of achromobactin synthetase protein d (acsd) with atp from pectobacterium chrysanthemi 0.6593 52 222
ID Description Score Start End Superfamily
af_Q2FW70_430_654_1.10.510.40 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; 0.7281 53 221 1.10.510.40
af_Q54B07_491_726_1.10.510.40 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; 0.722 52 239 1.10.510.40
af_Q2G1N1_365_563_1.10.510.40 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; 0.7202 52 223 1.10.510.40
af_Q2FW72_375_581_1.10.510.40 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; 0.7181 52 237 1.10.510.40
2x0oA04 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1; 0.7 52 239 1.10.510.40
ID Description Score Start End GO Terms
AF-A0A810LNE6-F1-model_v4 deleted 0.9926 14 268
AF-A0A810LNE6-F1-model_v4 deleted 0.966 14 268
AF-A0A1H2CVQ8-F1-model_v4 Ferric iron reductase FhuF-like transporter 0.9567 1 268
AF-R4M0T6-F1-model_v4 Aerobactin siderophore biosynthesis IucA/IucC-like C-terminal domain-containing protein 0.9554 1 268
AF-A0A285JRF2-F1-model_v4 Ferric iron reductase FhuF-like transporter 0.953 16 267 GO:0051537

Feature Viewer

pLDDT pTM Quality
88.45 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map