F286186

General Info

Members Datasets Scaffolds Average Seq Length
186 116 372 138

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1077969|Ga0265319_10779692
Length 139
Sequence MTIQDEQSVVSTQSQDPAAVGQPVVSSSVQTRRVTATPDGSELARRIIVLVFGLIQLVIGLRILLLIVDARTGNAIVSAVLNISQVFVGPFEGILKTDALHAGGSMLDIAALVALIGWTVVEAVVLWILNIFRRDALTA

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
93 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
94 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 2.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.69
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 24.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1077969 3300028563 Unclassified 1055
2 Ga0058862_11783758 3300004803 Bacteria 700
3 Ga0065707_10125690 3300005295 Bacteria 2016
4 Ga0065707_10493376 3300005295 Unclassified 760
5 Ga0070680_100000001 3300005336 Bacteria 276263
6 Ga0070680_101028528 3300005336 Bacteria 712
7 Ga0070691_10517795 3300005341 Bacteria 692
8 Ga0070687_100051466 3300005343 Bacteria 2132
9 Ga0070673_100210948 3300005364 Bacteria 1677
10 Ga0070667_101647098 3300005367 Unclassified 603
11 Ga0070703_10483912 3300005406 Bacteria 554
12 Ga0070701_11233771 3300005438 Unclassified 532
13 Ga0070711_100164982 3300005439 Bacteria 1683
14 Ga0070705_100005702 3300005440 Bacteria 6082
15 Ga0070705_100081662 3300005440 Bacteria 1987
16 Ga0070700_100058733 3300005441 Unclassified 2418
17 Ga0070700_102022987 3300005441 Unclassified 500
18 Ga0070694_100019400 3300005444 Bacteria 4323
19 Ga0070694_100072710 3300005444 Unclassified 2373
20 Ga0070694_100148790 3300005444 Bacteria 1708
21 Ga0070708_100004742 3300005445 Bacteria 10710
22 Ga0070708_100159810 3300005445 Bacteria 2099
23 Ga0070708_100529284 3300005445 Unclassified 1112
24 Ga0070708_100886845 3300005445 Unclassified 838
25 Ga0070681_10102911 3300005458 Bacteria 2800
26 Ga0068867_100621108 3300005459 Bacteria 945
27 Ga0070706_100001052 3300005467 Bacteria 29968
28 Ga0070706_100014495 3300005467 Bacteria 7282
29 Ga0070706_100024548 3300005467 Bacteria 5550
30 Ga0070706_100057584 3300005467 Unclassified 3586
31 Ga0070706_100178012 3300005467 Bacteria 1985
32 Ga0070706_100248469 3300005467 Bacteria 1661
33 Ga0070707_100004139 3300005468 Bacteria 13600
34 Ga0070707_100007866 3300005468 Bacteria 9898
35 Ga0070707_100033857 3300005468 Bacteria 4872
36 Ga0070707_100034086 3300005468 Bacteria 4855
37 Ga0070698_100007530 3300005471 Bacteria 11774
38 Ga0070698_100087456 3300005471 Unclassified 3102
39 Ga0070698_100119282 3300005471 Bacteria 2599
40 Ga0070698_100141186 3300005471 Bacteria 2359
41 Ga0070698_100200847 3300005471 Bacteria 1930
42 Ga0070698_100420795 3300005471 Bacteria 1270
43 Ga0070698_100936334 3300005471 Unclassified 812
44 Ga0070699_100015039 3300005518 Bacteria 6650
45 Ga0070699_100145419 3300005518 Bacteria 2094
46 Ga0070699_100546519 3300005518 Bacteria 1054
47 Ga0070699_101257308 3300005518 Bacteria 679
48 Ga0070679_100155885 3300005530 Bacteria 2258
49 Ga0070697_100001101 3300005536 Bacteria 20415
50 Ga0070697_100092712 3300005536 Bacteria 2500
51 Ga0070697_100168205 3300005536 Bacteria 1854
52 Ga0070697_100481225 3300005536 Bacteria 1084
53 Ga0070697_101945687 3300005536 Unclassified 526
54 Ga0070686_100047622 3300005544 Unclassified 2711
55 Ga0070686_100092367 3300005544 Bacteria 2027
56 Ga0070695_100031113 3300005545 Bacteria 3325
57 Ga0070695_100357667 3300005545 Bacteria 1095
58 Ga0070696_100017229 3300005546 Bacteria 4874
59 Ga0070696_100621933 3300005546 Bacteria 873
60 Ga0070696_101722168 3300005546 Unclassified 540
61 Ga0070704_100061240 3300005549 Unclassified 2692
62 Ga0070704_100112948 3300005549 Unclassified 2071
63 Ga0070704_100236645 3300005549 Bacteria 1493
64 Ga0070704_100632574 3300005549 Bacteria 943
65 Ga0068854_100296170 3300005578 Unclassified 1307
66 Ga0068854_101028694 3300005578 Bacteria 731
67 Ga0068856_100373004 3300005614 Bacteria 1446
68 Ga0068859_101083717 3300005617 Unclassified 881
69 Ga0068864_100848334 3300005618 Unclassified 900
70 Ga0068861_101621871 3300005719 Bacteria 638
71 Ga0068863_102314478 3300005841 Unclassified 547
72 Ga0068860_100224149 3300005843 Bacteria 1826
73 Ga0097621_100474288 3300006237 Bacteria 1130
74 Ga0075428_100000938 3300006844 Bacteria 30839
75 Ga0075431_100665482 3300006847 Unclassified 1021
76 Ga0075433_10002933 3300006852 Bacteria 13092
77 Ga0075434_100399697 3300006871 Bacteria 1395
78 Ga0075434_101501239 3300006871 Bacteria 683
79 Ga0075429_100732940 3300006880 Bacteria 866
80 Ga0068865_100716078 3300006881 Unclassified 857
81 Ga0097620_101083678 3300006931 Unclassified 881
82 Ga0114129_10001308 3300009147 Bacteria 33262
83 Ga0105243_10113193 3300009148 Bacteria 2275
84 Ga0105243_10507509 3300009148 Bacteria 1144
85 Ga0105242_10187302 3300009176 Bacteria 1830
86 Ga0105248_10666390 3300009177 Unclassified 1174
87 Ga0105249_11617555 3300009553 Bacteria 720
88 Ga0105239_10288416 3300010375 Bacteria 1848
89 Ga0105239_10737804 3300010375 Bacteria 1127
90 Ga0105246_10125923 3300011119 Bacteria 1906
91 Ga0105246_10804779 3300011119 Bacteria 834
92 Ga0157373_10276629 3300013100 Bacteria 1189
93 Ga0157378_10036093 3300013297 Bacteria 4375
94 Ga0157378_10068189 3300013297 Unclassified 3189
95 Ga0157378_11150402 3300013297 Unclassified 814
96 Ga0157378_11596269 3300013297 Bacteria 698
97 Ga0163162_11090213 3300013306 Bacteria 905
98 Ga0157375_11217567 3300013308 Bacteria 884
99 Ga0163163_10112911 3300014325 Bacteria 2747
100 Ga0157379_10674177 3300014968 Bacteria 969
101 Ga0163161_10641396 3300017792 Unclassified 879
102 Ga0207684_10003893 3300025910 Bacteria 14315
103 Ga0207684_10050150 3300025910 Unclassified 3540
104 Ga0207684_10080584 3300025910 Unclassified 2769
105 Ga0207684_10209547 3300025910 Bacteria 1681
106 Ga0207684_10252241 3300025910 Bacteria 1522
107 Ga0207707_10132154 3300025912 Bacteria 2183
108 Ga0207707_11209440 3300025912 Bacteria 611
109 Ga0207660_10000001 3300025917 Bacteria 1034169
110 Ga0207660_11410569 3300025917 Unclassified 564
111 Ga0207662_10112008 3300025918 Archaea 1702
112 Ga0207652_10342885 3300025921 Bacteria 1349
113 Ga0207646_10004268 3300025922 Bacteria 15611
114 Ga0207646_10009070 3300025922 Bacteria 9879
115 Ga0207646_10050127 3300025922 Bacteria 3737
116 Ga0207646_10088571 3300025922 Bacteria 2770
117 Ga0207687_10051308 3300025927 Bacteria 2875
118 Ga0207706_10175360 3300025933 Bacteria 1883
119 Ga0207709_10311923 3300025935 Bacteria 1174
120 Ga0207709_10611383 3300025935 Bacteria 864
121 Ga0207704_10197310 3300025938 Bacteria 1470
122 Ga0207665_10180456 3300025939 Bacteria 1529
123 Ga0207640_10239302 3300025981 Bacteria 1402
124 Ga0207640_10300697 3300025981 Bacteria 1269
125 Ga0207640_11503060 3300025981 Bacteria 605
126 Ga0207677_10997481 3300026023 Bacteria 759
127 Ga0207708_10824239 3300026075 Bacteria 800
128 Ga0207676_10338107 3300026095 Unclassified 1388
129 Ga0207675_100408430 3300026118 Bacteria 1339
130 Ga0268264_10408191 3300028381 Bacteria 1307
131 Ga0265326_10040730 3300028558 Unclassified 1319
132 Ga0265319_1000973 3300028563 Bacteria 18023
133 Ga0265334_10007842 3300028573 Bacteria 4569
134 Ga0265318_10006382 3300028577 Bacteria 5431
135 Ga0265318_10035177 3300028577 Bacteria 1928
136 Ga0265318_10101957 3300028577 Unclassified 1056
137 Ga0265318_10245347 3300028577 Bacteria 653
138 Ga0265322_10003884 3300028654 Bacteria 4482
139 Ga0265322_10053651 3300028654 Unclassified 1144
140 Ga0265336_10009899 3300028666 Bacteria 3280
141 Ga0265324_10005316 3300029957 Bacteria 5584
142 Ga0265332_10003566 3300031238 Bacteria 7479
143 Ga0265328_10038909 3300031239 Bacteria 1755
144 Ga0265320_10000314 3300031240 Bacteria 39484
145 Ga0265320_10396446 3300031240 Bacteria 610
146 Ga0265325_10014332 3300031241 Bacteria 4484
147 Ga0265325_10066852 3300031241 Bacteria 1812
148 Ga0265329_10008632 3300031242 Bacteria 3850
149 Ga0265329_10124126 3300031242 Bacteria 829
150 Ga0265340_10003008 3300031247 Bacteria 9594
151 Ga0265339_10166076 3300031249 Bacteria 1108
152 Ga0265316_10051771 3300031344 Bacteria 3224
153 Ga0265316_10411210 3300031344 Unclassified 973
154 Ga0265313_10049443 3300031595 Bacteria 2023
155 Ga0265314_10003392 3300031711 Bacteria 15436
156 Ga0265342_10015164 3300031712 Bacteria 5081
157 Ga0265342_10420745 3300031712 Bacteria 688
158 Ga0307409_100176521 3300031995 Bacteria 1886
159 Ga0439441_024617 3300042001 Unclassified 1131
160 Ga0439458_0075340 3300042157 Bacteria 856
161 Ga0439459_0057881 3300042438 Bacteria 868
162 Ga0451577_0673997 3300042876 Bacteria 937
163 Ga0453683_0099981 3300044673 Bacteria 1821
164 Ga0451576_1461174 3300045051 Bacteria 711
165 Ga0451576_1854215 3300045051 Bacteria 623
166 Ga0495590_0072013 3300046457 Bacteria 1214
167 Ga0495599_0487856 3300046678 Unclassified 726
168 Ga0495647_0429123 3300046681 Bacteria 610
169 Ga0496102_1034300 3300048905 Unclassified 742
170 Ga0496103_0401900 3300048906 Bacteria 880
171 Ga0496106_0094373 3300048909 Bacteria 2313
172 Ga0496112_0000001 3300048915 Bacteria 1346031
173 Ga0496112_0115480 3300048915 Unclassified 2655
174 Ga0501068_0145760 3300049584 Bacteria 1486
175 Ga0501071_0375768 3300049587 Bacteria 1083
176 nmdc:mga05p37_156_c1 3300050507 Bacteria 65375
177 nmdc:mga09592_147588_c1 3300050508 Bacteria 2028
178 nmdc:mga09592_214163_c1 3300050508 Bacteria 1669
179 nmdc:mga06r32_647238_c1 3300050510 Unclassified 1025
180 nmdc:mga0n895_288674_c1 3300050512 Bacteria 1663
181 nmdc:mga0a205_8173_c1 3300050515 Bacteria 9506
182 Ga0495619_0745133 3300053085 Bacteria 665
183 Ga0587088_174776 3300059508 Unclassified 534
184 Ga0587089_095239 3300059509 Unclassified 534
185 Ga0587128_046955 3300059630 Unclassified 776
186 Ga0587107_057692 3300059652 Unclassified 676
187 Ga0265319_1077969
188 Ga0058862_11783758
189 Ga0065707_10125690
190 Ga0065707_10493376
191 Ga0070680_100000001
192 Ga0070680_101028528
193 Ga0070691_10517795
194 Ga0070687_100051466
195 Ga0070673_100210948
196 Ga0070667_101647098
197 Ga0070703_10483912
198 Ga0070701_11233771
199 Ga0070711_100164982
200 Ga0070705_100005702
201 Ga0070705_100081662
202 Ga0070700_100058733
203 Ga0070700_102022987
204 Ga0070694_100019400
205 Ga0070694_100072710
206 Ga0070694_100148790
207 Ga0070708_100004742
208 Ga0070708_100159810
209 Ga0070708_100529284
210 Ga0070708_100886845
211 Ga0070681_10102911
212 Ga0068867_100621108
213 Ga0070706_100001052
214 Ga0070706_100014495
215 Ga0070706_100024548
216 Ga0070706_100057584
217 Ga0070706_100178012
218 Ga0070706_100248469
219 Ga0070707_100004139
220 Ga0070707_100007866
221 Ga0070707_100033857
222 Ga0070707_100034086
223 Ga0070698_100007530
224 Ga0070698_100087456
225 Ga0070698_100119282
226 Ga0070698_100141186
227 Ga0070698_100200847
228 Ga0070698_100420795
229 Ga0070698_100936334
230 Ga0070699_100015039
231 Ga0070699_100145419
232 Ga0070699_100546519
233 Ga0070699_101257308
234 Ga0070679_100155885
235 Ga0070697_100001101
236 Ga0070697_100092712
237 Ga0070697_100168205
238 Ga0070697_100481225
239 Ga0070697_101945687
240 Ga0070686_100047622
241 Ga0070686_100092367
242 Ga0070695_100031113
243 Ga0070695_100357667
244 Ga0070696_100017229
245 Ga0070696_100621933
246 Ga0070696_101722168
247 Ga0070704_100061240
248 Ga0070704_100112948
249 Ga0070704_100236645
250 Ga0070704_100632574
251 Ga0068854_100296170
252 Ga0068854_101028694
253 Ga0068856_100373004
254 Ga0068859_101083717
255 Ga0068864_100848334
256 Ga0068861_101621871
257 Ga0068863_102314478
258 Ga0068860_100224149
259 Ga0097621_100474288
260 Ga0075428_100000938
261 Ga0075431_100665482
262 Ga0075433_10002933
263 Ga0075434_100399697
264 Ga0075434_101501239
265 Ga0075429_100732940
266 Ga0068865_100716078
267 Ga0097620_101083678
268 Ga0114129_10001308
269 Ga0105243_10113193
270 Ga0105243_10507509
271 Ga0105242_10187302
272 Ga0105248_10666390
273 Ga0105249_11617555
274 Ga0105239_10288416
275 Ga0105239_10737804
276 Ga0105246_10125923
277 Ga0105246_10804779
278 Ga0157373_10276629
279 Ga0157378_10036093
280 Ga0157378_10068189
281 Ga0157378_11150402
282 Ga0157378_11596269
283 Ga0163162_11090213
284 Ga0157375_11217567
285 Ga0163163_10112911
286 Ga0157379_10674177
287 Ga0163161_10641396
288 Ga0207684_10003893
289 Ga0207684_10050150
290 Ga0207684_10080584
291 Ga0207684_10209547
292 Ga0207684_10252241
293 Ga0207707_10132154
294 Ga0207707_11209440
295 Ga0207660_10000001
296 Ga0207660_11410569
297 Ga0207662_10112008
298 Ga0207652_10342885
299 Ga0207646_10004268
300 Ga0207646_10009070
301 Ga0207646_10050127
302 Ga0207646_10088571
303 Ga0207687_10051308
304 Ga0207706_10175360
305 Ga0207709_10311923
306 Ga0207709_10611383
307 Ga0207704_10197310
308 Ga0207665_10180456
309 Ga0207640_10239302
310 Ga0207640_10300697
311 Ga0207640_11503060
312 Ga0207677_10997481
313 Ga0207708_10824239
314 Ga0207676_10338107
315 Ga0207675_100408430
316 Ga0268264_10408191
317 Ga0265326_10040730
318 Ga0265319_1000973
319 Ga0265334_10007842
320 Ga0265318_10006382
321 Ga0265318_10035177
322 Ga0265318_10101957
323 Ga0265318_10245347
324 Ga0265322_10003884
325 Ga0265322_10053651
326 Ga0265336_10009899
327 Ga0265324_10005316
328 Ga0265332_10003566
329 Ga0265328_10038909
330 Ga0265320_10000314
331 Ga0265320_10396446
332 Ga0265325_10014332
333 Ga0265325_10066852
334 Ga0265329_10008632
335 Ga0265329_10124126
336 Ga0265340_10003008
337 Ga0265339_10166076
338 Ga0265316_10051771
339 Ga0265316_10411210
340 Ga0265313_10049443
341 Ga0265314_10003392
342 Ga0265342_10015164
343 Ga0265342_10420745
344 Ga0307409_100176521
345 Ga0439441_024617
346 Ga0439458_0075340
347 Ga0439459_0057881
348 Ga0451577_0673997
349 Ga0453683_0099981
350 Ga0451576_1461174
351 Ga0451576_1854215
352 Ga0495590_0072013
353 Ga0495599_0487856
354 Ga0495647_0429123
355 Ga0496102_1034300
356 Ga0496103_0401900
357 Ga0496106_0094373
358 Ga0496112_0000001
359 Ga0496112_0115480
360 Ga0501068_0145760
361 Ga0501071_0375768
362 nmdc:mga05p37_156_c1
363 nmdc:mga09592_147588_c1
364 nmdc:mga09592_214163_c1
365 nmdc:mga06r32_647238_c1
366 nmdc:mga0n895_288674_c1
367 nmdc:mga0a205_8173_c1
368 Ga0495619_0745133
369 Ga0587088_174776
370 Ga0587089_095239
371 Ga0587128_046955
372 Ga0587107_057692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

49

126

0.89

Map