F286185

General Info

Members Datasets Scaffolds Average Seq Length
186 111 372 244

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1001962|Ga0265319_10019627
Length 289
Sequence MPVVLRDLRPEDWPQVAAVYAEGIETGNATFGVAEHSVYSCSSGRRRHLGSSPVRYQFVDCRWELGSPERGRELYLAGHVPGASFLDVDEDLSDSSVADQGRHPLPSRERFASAASSAGIGPGVHVVAYGSLAGAERLWWLLRHFGHDECAVLLDGIETWGGPLRSGEETIEPAEFLPRERAGDTIAAPELARRLADPTLVLVDARTANRWRGEENPIDRPPGRIPGALNAPWTEPLPELPPGELVAYCGSGITACVLLHRAFLAGREGKLYPGSWSDWSARRLPAERG

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
8 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
34 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
35 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
36 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
39 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
40 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
56 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
57 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
58 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
59 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
107 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
108 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.15
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 6.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1001962 3300028563 Bacteria 11635
2 Ga0070658_10009850 3300005327 Bacteria 7677
3 Ga0070668_100532146 3300005347 Bacteria 1021
4 Ga0070714_100030028 3300005435 Bacteria 4522
5 Ga0070714_100036852 3300005435 Bacteria 4105
6 Ga0070714_100073037 3300005435 Bacteria 2971
7 Ga0070714_100112095 3300005435 Bacteria 2417
8 Ga0070714_100241578 3300005435 Bacteria 1667
9 Ga0070710_10009344 3300005437 Bacteria 4795
10 Ga0070707_100257499 3300005468 Bacteria 1698
11 Ga0070707_100356411 3300005468 Bacteria 1421
12 Ga0070696_100297588 3300005546 Unclassified 1235
13 Ga0070693_100400451 3300005547 Bacteria 951
14 Ga0068855_100217238 3300005563 Bacteria 2146
15 Ga0070664_100235517 3300005564 Unclassified 1642
16 Ga0068857_100002871 3300005577 Bacteria 14171
17 Ga0068856_100229888 3300005614 Bacteria 1870
18 Ga0070717_10011887 3300006028 Bacteria 6624
19 Ga0070712_100131727 3300006175 Unclassified 1896
20 Ga0075428_100852773 3300006844 Bacteria 967
21 Ga0068865_100413882 3300006881 Bacteria 1107
22 Ga0105240_10222976 3300009093 Bacteria 2195
23 Ga0111539_10002492 3300009094 Bacteria 24416
24 Ga0114129_10345975 3300009147 Bacteria 1971
25 Ga0105242_10732676 3300009176 Bacteria 971
26 Ga0157373_10131198 3300013100 Bacteria 1762
27 Ga0157370_10078647 3300013104 Bacteria 3106
28 Ga0157369_10029889 3300013105 Bacteria 6016
29 Ga0207699_10113224 3300025906 Bacteria 1742
30 Ga0207695_10400469 3300025913 Bacteria 1257
31 Ga0207663_10403955 3300025916 Unclassified 1045
32 Ga0207646_10192528 3300025922 Bacteria 1842
33 Ga0207700_10054170 3300025928 Bacteria 3009
34 Ga0207664_10037665 3300025929 Bacteria 3745
35 Ga0207664_10047366 3300025929 Bacteria 3376
36 Ga0207664_10064755 3300025929 Bacteria 2925
37 Ga0207664_10260120 3300025929 Bacteria 1517
38 Ga0207679_10340363 3300025945 Unclassified 1304
39 Ga0207674_10002115 3300026116 Bacteria 25117
40 Ga0207675_100276060 3300026118 Bacteria 1632
41 Ga0265334_10003181 3300028573 Bacteria 7491
42 Ga0265334_10066916 3300028573 Bacteria 1343
43 Ga0265318_10000763 3300028577 Bacteria 21445
44 Ga0265322_10005010 3300028654 Bacteria 3929
45 Ga0265336_10019889 3300028666 Bacteria 2161
46 Ga0265338_10003221 3300028800 Bacteria 23276
47 Ga0265338_10004855 3300028800 Bacteria 17927
48 Ga0265338_10011874 3300028800 Bacteria 10003
49 Ga0265338_10024981 3300028800 Bacteria 6083
50 Ga0265330_10001649 3300031235 Bacteria 12689
51 Ga0265330_10020449 3300031235 Bacteria 3024
52 Ga0265328_10001855 3300031239 Bacteria 9615
53 Ga0265320_10011112 3300031240 Bacteria 5314
54 Ga0265320_10037585 3300031240 Bacteria 2437
55 Ga0265320_10223584 3300031240 Bacteria 838
56 Ga0265325_10000898 3300031241 Bacteria 21506
57 Ga0265325_10021153 3300031241 Bacteria 3579
58 Ga0265329_10000962 3300031242 Bacteria 14473
59 Ga0265329_10053917 3300031242 Unclassified 1277
60 Ga0265340_10020086 3300031247 Bacteria 3437
61 Ga0265340_10091924 3300031247 Unclassified 1417
62 Ga0265339_10001348 3300031249 Bacteria 18335
63 Ga0265339_10078823 3300031249 Bacteria 1743
64 Ga0265331_10018423 3300031250 Bacteria 3622
65 Ga0265327_10006633 3300031251 Bacteria 9196
66 Ga0265316_10003611 3300031344 Bacteria 15598
67 Ga0265316_10020920 3300031344 Bacteria 5555
68 Ga0265316_10048185 3300031344 Bacteria 3366
69 Ga0265313_10009137 3300031595 Bacteria 6475
70 Ga0265313_10026683 3300031595 Bacteria 3037
71 Ga0265313_10043178 3300031595 Bacteria 2209
72 Ga0265314_10002794 3300031711 Bacteria 17415
73 Ga0265314_10023082 3300031711 Bacteria 4753
74 Ga0265314_10023334 3300031711 Bacteria 4718
75 Ga0265314_10167764 3300031711 Bacteria 1328
76 Ga0265342_10005695 3300031712 Bacteria 9422
77 Ga0307409_100008616 3300031995 Bacteria 6202
78 Ga0373937_0000364 3300036401 Bacteria 42155
79 Ga0373937_0294623 3300036401 Bacteria 1533
80 Ga0395900_0103871 3300037418 Bacteria 2919
81 Ga0395901_0058608 3300038443 Bacteria 4005
82 Ga0395901_0195096 3300038443 Bacteria 2123
83 Ga0395901_0233970 3300038443 Bacteria 1918
84 Ga0439447_041192 3300041407 Bacteria 1125
85 Ga0439461_0011476 3300041410 Bacteria 1645
86 Ga0439466_0075517 3300041411 Bacteria 1068
87 Ga0439446_0006813 3300042156 Bacteria 2990
88 Ga0466969_0000542 3300044656 Bacteria 20684
89 Ga0466969_0004008 3300044656 Bacteria 7811
90 Ga0466965_0062365 3300044683 Bacteria 1865
91 Ga0466966_0126742 3300044684 Bacteria 1565
92 Ga0466966_0132758 3300044684 Bacteria 1524
93 Ga0466961_0036699 3300044693 Bacteria 3145
94 Ga0466961_0058673 3300044693 Bacteria 2448
95 Ga0466961_0155859 3300044693 Bacteria 1425
96 Ga0466961_0337306 3300044693 Bacteria 918
97 Ga0466963_0003945 3300044694 Bacteria 8579
98 Ga0466963_0006509 3300044694 Bacteria 6915
99 Ga0466963_0023871 3300044694 Bacteria 3888
100 Ga0466963_0034930 3300044694 Bacteria 3273
101 Ga0466963_0043080 3300044694 Bacteria 2966
102 Ga0466963_0352047 3300044694 Bacteria 1037
103 Ga0466964_0032807 3300044706 Bacteria 2065
104 Ga0466971_0000576 3300044719 Bacteria 14461
105 Ga0466971_0033233 3300044719 Bacteria 2311
106 Ga0466971_0066710 3300044719 Bacteria 1631
107 Ga0466971_0146814 3300044719 Bacteria 1100
108 Ga0466968_0031751 3300044735 Bacteria 2192
109 Ga0466968_0050936 3300044735 Bacteria 1768
110 Ga0466968_0227385 3300044735 Unclassified 880
111 Ga0466970_0000979 3300044765 Bacteria 13756
112 Ga0466957_0032689 3300044842 Bacteria 3116
113 Ga0466957_0052205 3300044842 Bacteria 2489
114 Ga0466957_0090221 3300044842 Bacteria 1919
115 Ga0466957_0122768 3300044842 Unclassified 1657
116 Ga0466957_0154859 3300044842 Bacteria 1485
117 Ga0466957_0211021 3300044842 Bacteria 1278
118 Ga0466960_0007855 3300044901 Bacteria 4352
119 Ga0466960_0131449 3300044901 Unclassified 1321
120 Ga0466959_0144427 3300045049 Bacteria 1679
121 Ga0466958_0000140 3300045836 Bacteria 24688
122 Ga0466958_0008228 3300045836 Bacteria 5775
123 Ga0466958_0012562 3300045836 Bacteria 4801
124 Ga0466958_0027414 3300045836 Bacteria 3371
125 Ga0466958_0076726 3300045836 Bacteria 2052
126 Ga0466958_0085612 3300045836 Bacteria 1944
127 Ga0466958_0333308 3300045836 Unclassified 976
128 Ga0466967_0010772 3300045976 Bacteria 6876
129 Ga0466967_0025671 3300045976 Bacteria 4861
130 Ga0466967_0070790 3300045976 Bacteria 3120
131 Ga0466967_0087096 3300045976 Bacteria 2831
132 Ga0466967_0154299 3300045976 Bacteria 2149
133 Ga0466967_0487637 3300045976 Bacteria 1208
134 Ga0466967_0548781 3300045976 Bacteria 1137
135 Ga0495592_0000050 3300046454 Bacteria 111971
136 Ga0495603_0312777 3300046455 Archaea 902
137 Ga0495651_0000028 3300046462 Bacteria 105473
138 Ga0495653_0020152 3300046463 Bacteria 5406
139 Ga0495653_0100157 3300046463 Unclassified 2101
140 Ga0495608_0004916 3300046511 Bacteria 9574
141 Ga0495608_0010833 3300046511 Bacteria 6354
142 Ga0495618_0001433 3300046514 Bacteria 16025
143 Ga0495618_0155001 3300046514 Bacteria 1462
144 Ga0495618_0225549 3300046514 Unclassified 1181
145 Ga0495628_0000060 3300046516 Bacteria 87173
146 Ga0495630_0022855 3300046517 Bacteria 4618
147 Ga0495637_0137714 3300046520 Bacteria 928
148 Ga0495663_0041345 3300046525 Bacteria 1402
149 Ga0495652_0000512 3300046529 Bacteria 45282
150 Ga0495640_0170868 3300046533 Bacteria 1389
151 Ga0495587_0000062 3300046536 Bacteria 91862
152 Ga0495645_0000028 3300046543 Bacteria 113461
153 Ga0495667_0059731 3300046559 Bacteria 2502
154 Ga0495656_0064934 3300046615 Bacteria 1604
155 Ga0495657_0053141 3300046675 Bacteria 2712
156 Ga0495657_0077998 3300046675 Bacteria 2148
157 Ga0495657_0161896 3300046675 Bacteria 1384
158 Ga0495599_0000059 3300046678 Bacteria 75747
159 Ga0495623_0000082 3300046679 Bacteria 56315
160 Ga0495600_0018644 3300046809 Bacteria 4423
161 Ga0495604_0000242 3300047317 Bacteria 48737
162 Ga0495680_0002795 3300047322 Bacteria 17584
163 Ga0495680_0028951 3300047322 Bacteria 4539
164 Ga0495675_0000020 3300047444 Bacteria 111526
165 Ga0495684_0024402 3300047471 Bacteria 4654
166 Ga0495602_0000600 3300048088 Bacteria 33812
167 Ga0496104_0122159 3300048907 Bacteria 2500
168 Ga0496105_0115163 3300048908 Bacteria 2218
169 Ga0496110_0956801 3300048913 Bacteria 763
170 Ga0496112_0115353 3300048915 Bacteria 2657
171 Ga0501067_0014124 3300049583 Bacteria 4423
172 Ga0501067_0260324 3300049583 Bacteria 966
173 Ga0501068_0006655 3300049584 Bacteria 6379
174 Ga0501069_0004920 3300049585 Bacteria 6926
175 Ga0501069_0006709 3300049585 Bacteria 6027
176 Ga0501081_0610339 3300049743 Bacteria 817
177 Ga0495601_0000241 3300053077 Bacteria 29180
178 Ga0495601_0000253 3300053077 Bacteria 28610
179 Ga0495612_0024051 3300053078 Bacteria 2446
180 Ga0495595_0032722 3300053084 Bacteria 2343
181 Ga0495595_0231321 3300053084 Bacteria 924
182 Ga0495619_0000316 3300053085 Bacteria 33863
183 Ga0590075_037553 3300059424 Bacteria 1235
184 Ga0466962_0035161 3300061719 Bacteria 2398
185 Ga0466962_0038709 3300061719 Bacteria 2283
186 Ga0466962_0118566 3300061719 Bacteria 1276
187 Ga0265319_1001962
188 Ga0070658_10009850
189 Ga0070668_100532146
190 Ga0070714_100030028
191 Ga0070714_100036852
192 Ga0070714_100073037
193 Ga0070714_100112095
194 Ga0070714_100241578
195 Ga0070710_10009344
196 Ga0070707_100257499
197 Ga0070707_100356411
198 Ga0070696_100297588
199 Ga0070693_100400451
200 Ga0068855_100217238
201 Ga0070664_100235517
202 Ga0068857_100002871
203 Ga0068856_100229888
204 Ga0070717_10011887
205 Ga0070712_100131727
206 Ga0075428_100852773
207 Ga0068865_100413882
208 Ga0105240_10222976
209 Ga0111539_10002492
210 Ga0114129_10345975
211 Ga0105242_10732676
212 Ga0157373_10131198
213 Ga0157370_10078647
214 Ga0157369_10029889
215 Ga0207699_10113224
216 Ga0207695_10400469
217 Ga0207663_10403955
218 Ga0207646_10192528
219 Ga0207700_10054170
220 Ga0207664_10037665
221 Ga0207664_10047366
222 Ga0207664_10064755
223 Ga0207664_10260120
224 Ga0207679_10340363
225 Ga0207674_10002115
226 Ga0207675_100276060
227 Ga0265334_10003181
228 Ga0265334_10066916
229 Ga0265318_10000763
230 Ga0265322_10005010
231 Ga0265336_10019889
232 Ga0265338_10003221
233 Ga0265338_10004855
234 Ga0265338_10011874
235 Ga0265338_10024981
236 Ga0265330_10001649
237 Ga0265330_10020449
238 Ga0265328_10001855
239 Ga0265320_10011112
240 Ga0265320_10037585
241 Ga0265320_10223584
242 Ga0265325_10000898
243 Ga0265325_10021153
244 Ga0265329_10000962
245 Ga0265329_10053917
246 Ga0265340_10020086
247 Ga0265340_10091924
248 Ga0265339_10001348
249 Ga0265339_10078823
250 Ga0265331_10018423
251 Ga0265327_10006633
252 Ga0265316_10003611
253 Ga0265316_10020920
254 Ga0265316_10048185
255 Ga0265313_10009137
256 Ga0265313_10026683
257 Ga0265313_10043178
258 Ga0265314_10002794
259 Ga0265314_10023082
260 Ga0265314_10023334
261 Ga0265314_10167764
262 Ga0265342_10005695
263 Ga0307409_100008616
264 Ga0373937_0000364
265 Ga0373937_0294623
266 Ga0395900_0103871
267 Ga0395901_0058608
268 Ga0395901_0195096
269 Ga0395901_0233970
270 Ga0439447_041192
271 Ga0439461_0011476
272 Ga0439466_0075517
273 Ga0439446_0006813
274 Ga0466969_0000542
275 Ga0466969_0004008
276 Ga0466965_0062365
277 Ga0466966_0126742
278 Ga0466966_0132758
279 Ga0466961_0036699
280 Ga0466961_0058673
281 Ga0466961_0155859
282 Ga0466961_0337306
283 Ga0466963_0003945
284 Ga0466963_0006509
285 Ga0466963_0023871
286 Ga0466963_0034930
287 Ga0466963_0043080
288 Ga0466963_0352047
289 Ga0466964_0032807
290 Ga0466971_0000576
291 Ga0466971_0033233
292 Ga0466971_0066710
293 Ga0466971_0146814
294 Ga0466968_0031751
295 Ga0466968_0050936
296 Ga0466968_0227385
297 Ga0466970_0000979
298 Ga0466957_0032689
299 Ga0466957_0052205
300 Ga0466957_0090221
301 Ga0466957_0122768
302 Ga0466957_0154859
303 Ga0466957_0211021
304 Ga0466960_0007855
305 Ga0466960_0131449
306 Ga0466959_0144427
307 Ga0466958_0000140
308 Ga0466958_0008228
309 Ga0466958_0012562
310 Ga0466958_0027414
311 Ga0466958_0076726
312 Ga0466958_0085612
313 Ga0466958_0333308
314 Ga0466967_0010772
315 Ga0466967_0025671
316 Ga0466967_0070790
317 Ga0466967_0087096
318 Ga0466967_0154299
319 Ga0466967_0487637
320 Ga0466967_0548781
321 Ga0495592_0000050
322 Ga0495603_0312777
323 Ga0495651_0000028
324 Ga0495653_0020152
325 Ga0495653_0100157
326 Ga0495608_0004916
327 Ga0495608_0010833
328 Ga0495618_0001433
329 Ga0495618_0155001
330 Ga0495618_0225549
331 Ga0495628_0000060
332 Ga0495630_0022855
333 Ga0495637_0137714
334 Ga0495663_0041345
335 Ga0495652_0000512
336 Ga0495640_0170868
337 Ga0495587_0000062
338 Ga0495645_0000028
339 Ga0495667_0059731
340 Ga0495656_0064934
341 Ga0495657_0053141
342 Ga0495657_0077998
343 Ga0495657_0161896
344 Ga0495599_0000059
345 Ga0495623_0000082
346 Ga0495600_0018644
347 Ga0495604_0000242
348 Ga0495680_0002795
349 Ga0495680_0028951
350 Ga0495675_0000020
351 Ga0495684_0024402
352 Ga0495602_0000600
353 Ga0496104_0122159
354 Ga0496105_0115163
355 Ga0496110_0956801
356 Ga0496112_0115353
357 Ga0501067_0014124
358 Ga0501067_0260324
359 Ga0501068_0006655
360 Ga0501069_0004920
361 Ga0501069_0006709
362 Ga0501081_0610339
363 Ga0495601_0000241
364 Ga0495601_0000253
365 Ga0495612_0024051
366 Ga0495595_0032722
367 Ga0495595_0231321
368 Ga0495619_0000316
369 Ga0590075_037553
370 Ga0466962_0035161
371 Ga0466962_0038709
372 Ga0466962_0118566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

46

162

0.85

PF00581

Rhodanese

Rhodanese-like domain

187

282

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8agf-assembly1.cif.gz_A crystal structure of human thiosulfate sulfurtransferase amino acids 2-297 0.895 7 238
8q5z-assembly1.cif.gz_A crystal structure of bovine thiosulfate sulfurtransferase 0.8854 7 242
8bgq-assembly1.cif.gz_A error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/8bgq 0.8839 7 242
1rhd-assembly1.cif.gz_A structure of bovine liver rhodanese. i. structure determination at 2.5 angstroms resolution and a comparison of the conformation and sequence of its two domains 0.8782 7 242
1boi-assembly1.cif.gz_A n-terminally truncated rhodanese 0.878 7 238
ID Description Score Start End Superfamily
af_P9WHF5_1_149_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9523 8 126 3.40.250.10
af_Q4DV84_20_177_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8899 9 132 3.40.250.10
af_P91247_159_242_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8814 199 235 3.40.250.10
af_Q9USJ1_14_155_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8713 7 132 3.40.250.10
5wqjB01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8675 9 132 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A538BWF0-F1-model_v4 Sulfurtransferase 0.9839 8 242 GO:0004792
AF-A0A538EHV8-F1-model_v4 Sulfurtransferase 0.9813 2 241 GO:0004792
AF-A0A538J958-F1-model_v4 Sulfurtransferase 0.9811 2 242 GO:0004792
AF-A0A537Z2Y0-F1-model_v4 Sulfurtransferase 0.9794 1 242 GO:0004792
AF-A0A7W1QAD2-F1-model_v4 Sulfurtransferase 0.9777 2 242 GO:0004792

Map