F285778

General Info

Members Datasets Scaffolds Average Seq Length
186 98 186 242

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10000033|Ga0070715_1000003324
Length 280
Sequence MQLHWFRIQKQRFGGSASLIHNADYPDQDSARRNPPVSADAMFEKFHQRSYELENIDKGTYTPEEYEGCLVELRRVNEWLGDARALEGTLFAELERAKRLSFSVLDVGAGSGELLRVTAKWARDRNCRARLVGLELNERSAKAILDESAAFPEISSVRADGLRLPFSDLAFDYAIQSLTLHHFDDDDAVKIIREMARVAARGIFVIDLHRNPVAYYFYKTVGRLFLHNRLIREDGALSILKSFKPEEMEKIGKQAGLAGVTVEKHFPSRLVLQGMLNGNG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
88 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
89 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10156528 3300005289 Bacteria 1387
2 Ga0065704_10236427 3300005289 Bacteria 1028
3 Ga0065715_10115930 3300005293 Bacteria 2398
4 Ga0065707_10118184 3300005295 Unclassified 2192
5 Ga0065707_10128017 3300005295 Bacteria 1965
6 Ga0070690_100472879 3300005330 Unclassified 933
7 Ga0068869_100003569 3300005334 Bacteria 9544
8 Ga0068869_100016014 3300005334 Bacteria 5046
9 Ga0070680_100259018 3300005336 Bacteria 1471
10 Ga0070682_100000108 3300005337 Bacteria 73708
11 Ga0070689_100132117 3300005340 Bacteria 2002
12 Ga0070689_100415265 3300005340 Bacteria 1140
13 Ga0070669_100000664 3300005353 Bacteria 25327
14 Ga0070673_100313505 3300005364 Unclassified 1384
15 Ga0070688_100358989 3300005365 Bacteria 1069
16 Ga0070703_10000124 3300005406 Bacteria 39666
17 Ga0070701_10102226 3300005438 Unclassified 1589
18 Ga0070701_10218883 3300005438 Bacteria 1134
19 Ga0070705_100066275 3300005440 Bacteria 2165
20 Ga0070705_100192909 3300005440 Bacteria 1390
21 Ga0070700_100040934 3300005441 Unclassified 2839
22 Ga0070700_100070125 3300005441 Bacteria 2234
23 Ga0070700_100693859 3300005441 Bacteria 809
24 Ga0070694_100000638 3300005444 Bacteria 19303
25 Ga0070694_100005233 3300005444 Bacteria 7838
26 Ga0070694_100219668 3300005444 Bacteria 1425
27 Ga0070694_100303989 3300005444 Bacteria 1223
28 Ga0070708_100177071 3300005445 Bacteria 1993
29 Ga0070706_100001646 3300005467 Bacteria 23245
30 Ga0070706_100004979 3300005467 Bacteria 12719
31 Ga0070706_100050339 3300005467 Unclassified 3844
32 Ga0070706_100099002 3300005467 Bacteria 2709
33 Ga0070706_100156570 3300005467 Bacteria 2127
34 Ga0070707_100000053 3300005468 Bacteria 100755
35 Ga0070707_100026860 3300005468 Bacteria 5470
36 Ga0070707_100029299 3300005468 Bacteria 5242
37 Ga0070707_100225419 3300005468 Unclassified 1825
38 Ga0070707_100508297 3300005468 Bacteria 1167
39 Ga0070698_100003096 3300005471 Bacteria 18338
40 Ga0070698_100011756 3300005471 Bacteria 9287
41 Ga0070698_100017242 3300005471 Bacteria 7609
42 Ga0070698_100035510 3300005471 Bacteria 5155
43 Ga0070698_100075701 3300005471 Bacteria 3370
44 Ga0070698_100138940 3300005471 Bacteria 2382
45 Ga0070699_100002929 3300005518 Bacteria 15176
46 Ga0070699_100037737 3300005518 Bacteria 4183
47 Ga0070699_100377234 3300005518 Unclassified 1280
48 Ga0070699_100715406 3300005518 Unclassified 915
49 Ga0070699_100834233 3300005518 Unclassified 844
50 Ga0070697_100000236 3300005536 Bacteria 44906
51 Ga0070697_100004638 3300005536 Bacteria 10544
52 Ga0070697_100005960 3300005536 Bacteria 9417
53 Ga0070697_100012658 3300005536 Bacteria 6608
54 Ga0070697_100018274 3300005536 Bacteria 5525
55 Ga0070697_100096498 3300005536 Bacteria 2452
56 Ga0070686_100199259 3300005544 Bacteria 1434
57 Ga0070695_100213765 3300005545 Bacteria 1386
58 Ga0070696_100035257 3300005546 Bacteria 3444
59 Ga0070696_100090888 3300005546 Bacteria 2173
60 Ga0070696_100171386 3300005546 Unclassified 1605
61 Ga0070696_100518128 3300005546 Bacteria 951
62 Ga0070704_100002705 3300005549 Bacteria 10021
63 Ga0070704_100239438 3300005549 Bacteria 1484
64 Ga0070704_100281976 3300005549 Bacteria 1377
65 Ga0068854_100179816 3300005578 Unclassified 1652
66 Ga0068859_100041383 3300005617 Bacteria 4628
67 Ga0068864_100015916 3300005618 Bacteria 6260
68 Ga0068864_100404959 3300005618 Bacteria 1297
69 Ga0068864_100719981 3300005618 Bacteria 976
70 Ga0068861_100255668 3300005719 Bacteria 1497
71 Ga0068858_100192470 3300005842 Bacteria 1927
72 Ga0068858_100268850 3300005842 Bacteria 1622
73 Ga0068860_100149565 3300005843 Bacteria 2248
74 Ga0068860_100474440 3300005843 Unclassified 1246
75 Ga0068862_100041732 3300005844 Bacteria 3905
76 Ga0081540_1019426 3300005983 Bacteria 4128
77 Ga0081539_10001165 3300005985 Bacteria 47581
78 Ga0081539_10002866 3300005985 Bacteria 22912
79 Ga0070715_10000033 3300006163 Bacteria 81067
80 Ga0070716_100105434 3300006173 Bacteria 1737
81 Ga0075433_10027476 3300006852 Bacteria 4826
82 Ga0075433_10039954 3300006852 Bacteria 4059
83 Ga0075433_10287215 3300006852 Bacteria 1457
84 Ga0075433_10428738 3300006852 Bacteria 1166
85 Ga0075434_100132018 3300006871 Unclassified 2517
86 Ga0075436_100000007 3300006914 Bacteria 288785
87 Ga0097620_100041381 3300006931 Bacteria 4628
88 Ga0075435_100007629 3300007076 Bacteria 7725
89 Ga0099794_10015534 3300007265 Bacteria 3363
90 Ga0099794_10134412 3300007265 Bacteria 1250
91 Ga0114129_10021131 3300009147 Bacteria 9241
92 Ga0114129_10027672 3300009147 Bacteria 8028
93 Ga0114129_10320640 3300009147 Bacteria 2060
94 Ga0105243_10000073 3300009148 Bacteria 114756
95 Ga0105243_10032423 3300009148 Bacteria 4037
96 Ga0105243_10624043 3300009148 Bacteria 1041
97 Ga0105242_10000043 3300009176 Bacteria 85748
98 Ga0105242_10001366 3300009176 Bacteria 19252
99 Ga0105242_10812543 3300009176 Unclassified 927
100 Ga0105248_10014087 3300009177 Bacteria 8799
101 Ga0105248_10022128 3300009177 Bacteria 7046
102 Ga0105248_10243909 3300009177 Bacteria 2022
103 Ga0105246_10180151 3300011119 Bacteria 1626
104 Ga0157378_10025592 3300013297 Bacteria 5196
105 Ga0157378_10054555 3300013297 Bacteria 3559
106 Ga0157378_10114736 3300013297 Bacteria 2475
107 Ga0157378_10200661 3300013297 Bacteria 1886
108 Ga0157378_10264491 3300013297 Bacteria 1652
109 Ga0163162_10003981 3300013306 Bacteria 14166
110 Ga0163161_10156157 3300017792 Bacteria 1737
111 Ga0213876_10000343 3300021384 Bacteria 40521
112 Ga0207653_10000240 3300025885 Bacteria 36488
113 Ga0207642_10017079 3300025899 Bacteria 2751
114 Ga0207642_10116545 3300025899 Unclassified 1370
115 Ga0207685_10000006 3300025905 Bacteria 284255
116 Ga0207684_10008637 3300025910 Bacteria 9051
117 Ga0207684_10022707 3300025910 Bacteria 5356
118 Ga0207684_10066977 3300025910 Bacteria 3051
119 Ga0207646_10000578 3300025922 Bacteria 48062
120 Ga0207646_10005446 3300025922 Bacteria 13382
121 Ga0207646_10017391 3300025922 Bacteria 6730
122 Ga0207646_10171050 3300025922 Bacteria 1962
123 Ga0207646_10179739 3300025922 Bacteria 1911
124 Ga0207646_10242499 3300025922 Bacteria 1628
125 Ga0207646_10559248 3300025922 Unclassified 1028
126 Ga0207646_10586098 3300025922 Bacteria 1001
127 Ga0207681_10007455 3300025923 Bacteria 6704
128 Ga0207659_10173851 3300025926 Bacteria 1701
129 Ga0207659_10536507 3300025926 Bacteria 993
130 Ga0207686_10000003 3300025934 Bacteria 376934
131 Ga0207686_10000491 3300025934 Bacteria 25947
132 Ga0207709_10000124 3300025935 Bacteria 114743
133 Ga0207670_10140536 3300025936 Bacteria 1780
134 Ga0207665_10034456 3300025939 Bacteria 3359
135 Ga0207689_10006264 3300025942 Bacteria 10545
136 Ga0207689_10013629 3300025942 Bacteria 6932
137 Ga0207651_10354007 3300025960 Unclassified 1237
138 Ga0207640_10309299 3300025981 Unclassified 1254
139 Ga0207703_10091496 3300026035 Bacteria 2559
140 Ga0207703_10102043 3300026035 Bacteria 2433
141 Ga0207703_10116699 3300026035 Bacteria 2286
142 Ga0207708_10062676 3300026075 Unclassified 2840
143 Ga0207708_10139646 3300026075 Bacteria 1899
144 Ga0207708_10299344 3300026075 Bacteria 1308
145 Ga0207676_10045516 3300026095 Bacteria 3391
146 Ga0207676_10300690 3300026095 Bacteria 1465
147 Ga0207676_10325965 3300026095 Bacteria 1412
148 Ga0207676_10331472 3300026095 Bacteria 1401
149 Ga0207675_100227694 3300026118 Bacteria 1798
150 Ga0207675_100572856 3300026118 Unclassified 1130
151 Ga0209588_1009894 3300027671 Bacteria 2858
152 Ga0207428_10006067 3300027907 Bacteria 11172
153 Ga0268265_10059015 3300028380 Bacteria 2933
154 Ga0268264_10532884 3300028381 Bacteria 1150
155 Ga0268264_10617575 3300028381 Unclassified 1070
156 Ga0307513_10006451 3300031456 Bacteria 15326
157 Ga0307408_100167016 3300031548 Bacteria 1754
158 Ga0307411_10037445 3300032005 Bacteria 3050
159 Ga0307415_100543254 3300032126 Unclassified 1024
160 Ga0395901_0070305 3300038443 Archaea 3647
161 Ga0242420_001840 3300038996 Unclassified 2925
162 Ga0436365_1425589 3300039437 Bacteria 204653
163 Ga0436365_1608250 3300039437 Bacteria 14260
164 Ga0439439_0027507 3300041406 Bacteria 1437
165 Ga0495610_0061595 3300046512 Bacteria 1782
166 Ga0495618_0217368 3300046514 Bacteria 1207
167 Ga0495630_0076841 3300046517 Bacteria 2517
168 Ga0495632_0029731 3300046519 Bacteria 2842
169 Ga0495663_0000551 3300046525 Bacteria 13192
170 Ga0495598_0005169 3300046537 Unclassified 2876
171 Ga0495598_0152961 3300046537 Unclassified 806
172 Ga0495621_0006652 3300046539 Bacteria 3384
173 Ga0495621_0009944 3300046539 Bacteria 2902
174 Ga0495656_0238593 3300046615 Bacteria 915
175 Ga0495659_0020930 3300046664 Bacteria 2201
176 Ga0495672_0007052 3300047320 Bacteria 8530
177 nmdc:mga05p37_150644_c1 3300050507 Unclassified 2845
178 nmdc:mga05p37_528294_c1 3300050507 Bacteria 1348
179 nmdc:mga05p37_87778_c1 3300050507 Bacteria 3833
180 nmdc:mga08y16_149432_c1 3300050511 Bacteria 2429
181 nmdc:mga0rr50_312_c1 3300050513 Bacteria 26393
182 nmdc:mga08x19_70_c1 3300050514 Bacteria 98848
183 nmdc:mga0a205_298580_c1 3300050515 Unclassified 1484
184 nmdc:mga0a205_429539_c1 3300050515 Bacteria 1182
185 nmdc:mga0a205_76512_c1 3300050515 Bacteria 3234
186 Ga0530510_0055067 3300061734 Unclassified 2874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10006451 Ga0307513_1000645114 230
2 3300032005 Ga0307411_10037445 Ga0307411_100374453 230
3 3300038443 Ga0395901_0070305 Ga0395901_0070305_2184_2882 230
4 3300046537 Ga0495598_0152961 Ga0495598_0152961_62_757 230
5 3300005549 Ga0070704_100239438 Ga0070704_1002394382 232
6 3300005842 Ga0068858_100268850 Ga0068858_1002688502 232
7 3300009176 Ga0105242_10001366 Ga0105242_1000136615 232
8 3300025934 Ga0207686_10000491 Ga0207686_1000049111 232
9 3300026035 Ga0207703_10091496 Ga0207703_100914962 232
10 3300005289 Ga0065704_10156528 Ga0065704_101565282 233
11 3300005289 Ga0065704_10236427 Ga0065704_102364272 233
12 3300005293 Ga0065715_10115930 Ga0065715_101159302 233
13 3300005295 Ga0065707_10118184 Ga0065707_101181844 233
14 3300005295 Ga0065707_10128017 Ga0065707_101280172 233
15 3300005330 Ga0070690_100472879 Ga0070690_1004728791 233
16 3300005334 Ga0068869_100003569 Ga0068869_1000035696 233
17 3300005334 Ga0068869_100016014 Ga0068869_1000160142 233
18 3300005336 Ga0070680_100259018 Ga0070680_1002590182 233
19 3300005337 Ga0070682_100000108 Ga0070682_10000010842 233
20 3300005340 Ga0070689_100132117 Ga0070689_1001321171 233
21 3300005340 Ga0070689_100415265 Ga0070689_1004152652 233
22 3300005353 Ga0070669_100000664 Ga0070669_10000066418 233
23 3300005364 Ga0070673_100313505 Ga0070673_1003135052 233
24 3300005365 Ga0070688_100358989 Ga0070688_1003589891 233
25 3300005406 Ga0070703_10000124 Ga0070703_1000012434 233
26 3300005438 Ga0070701_10102226 Ga0070701_101022262 233
27 3300005438 Ga0070701_10218883 Ga0070701_102188832 233
28 3300005440 Ga0070705_100066275 Ga0070705_1000662752 233
29 3300005440 Ga0070705_100192909 Ga0070705_1001929092 233
30 3300005441 Ga0070700_100040934 Ga0070700_1000409342 233
31 3300005441 Ga0070700_100070125 Ga0070700_1000701253 233
32 3300005441 Ga0070700_100693859 Ga0070700_1006938591 233
33 3300005444 Ga0070694_100000638 Ga0070694_1000006382 233
34 3300005444 Ga0070694_100005233 Ga0070694_1000052333 233
35 3300005444 Ga0070694_100219668 Ga0070694_1002196681 233
36 3300005444 Ga0070694_100303989 Ga0070694_1003039891 233
37 3300005445 Ga0070708_100177071 Ga0070708_1001770712 233
38 3300005467 Ga0070706_100001646 Ga0070706_1000016462 233
39 3300005467 Ga0070706_100004979 Ga0070706_1000049792 233
40 3300005467 Ga0070706_100050339 Ga0070706_1000503391 233
41 3300005467 Ga0070706_100099002 Ga0070706_1000990023 233
42 3300005467 Ga0070706_100156570 Ga0070706_1001565702 233
43 3300005468 Ga0070707_100000053 Ga0070707_10000005385 233
44 3300005468 Ga0070707_100026860 Ga0070707_1000268602 233
45 3300005468 Ga0070707_100029299 Ga0070707_1000292991 233
46 3300005468 Ga0070707_100225419 Ga0070707_1002254192 233
47 3300005468 Ga0070707_100508297 Ga0070707_1005082972 233
48 3300005471 Ga0070698_100003096 Ga0070698_1000030963 233
49 3300005471 Ga0070698_100011756 Ga0070698_1000117569 233
50 3300005471 Ga0070698_100017242 Ga0070698_1000172424 233
51 3300005471 Ga0070698_100035510 Ga0070698_1000355101 233
52 3300005471 Ga0070698_100075701 Ga0070698_1000757014 233
53 3300005471 Ga0070698_100138940 Ga0070698_1001389403 233
54 3300005518 Ga0070699_100002929 Ga0070699_1000029295 233
55 3300005518 Ga0070699_100037737 Ga0070699_1000377376 233
56 3300005518 Ga0070699_100377234 Ga0070699_1003772341 233
57 3300005518 Ga0070699_100715406 Ga0070699_1007154061 233
58 3300005518 Ga0070699_100834233 Ga0070699_1008342331 233
59 3300005536 Ga0070697_100000236 Ga0070697_10000023621 233
60 3300005536 Ga0070697_100004638 Ga0070697_1000046384 233
61 3300005536 Ga0070697_100005960 Ga0070697_1000059605 233
62 3300005536 Ga0070697_100012658 Ga0070697_1000126581 233
63 3300005536 Ga0070697_100018274 Ga0070697_1000182743 233
64 3300005536 Ga0070697_100096498 Ga0070697_1000964982 233
65 3300005544 Ga0070686_100199259 Ga0070686_1001992592 233
66 3300005545 Ga0070695_100213765 Ga0070695_1002137651 233
67 3300005546 Ga0070696_100035257 Ga0070696_1000352572 233
68 3300005546 Ga0070696_100090888 Ga0070696_1000908882 233
69 3300005546 Ga0070696_100171386 Ga0070696_1001713861 233
70 3300005546 Ga0070696_100518128 Ga0070696_1005181281 233
71 3300005549 Ga0070704_100002705 Ga0070704_1000027052 233
72 3300005549 Ga0070704_100281976 Ga0070704_1002819761 233
73 3300005578 Ga0068854_100179816 Ga0068854_1001798162 233
74 3300005617 Ga0068859_100041383 Ga0068859_1000413833 233
75 3300005618 Ga0068864_100015916 Ga0068864_1000159162 233
76 3300005618 Ga0068864_100404959 Ga0068864_1004049592 233
77 3300005618 Ga0068864_100719981 Ga0068864_1007199811 233
78 3300005719 Ga0068861_100255668 Ga0068861_1002556681 233
79 3300005842 Ga0068858_100192470 Ga0068858_1001924702 233
80 3300005843 Ga0068860_100149565 Ga0068860_1001495652 233
81 3300005843 Ga0068860_100474440 Ga0068860_1004744402 233
82 3300005844 Ga0068862_100041732 Ga0068862_1000417323 233
83 3300005983 Ga0081540_1019426 Ga0081540_10194263 233
84 3300005985 Ga0081539_10001165 Ga0081539_1000116512 233
85 3300005985 Ga0081539_10002866 Ga0081539_1000286610 233
86 3300006163 Ga0070715_10000033 Ga0070715_1000003324 233
87 3300006173 Ga0070716_100105434 Ga0070716_1001054341 233
88 3300006852 Ga0075433_10027476 Ga0075433_100274763 233
89 3300006852 Ga0075433_10039954 Ga0075433_100399542 233
90 3300006852 Ga0075433_10287215 Ga0075433_102872152 233
91 3300006852 Ga0075433_10428738 Ga0075433_104287381 233
92 3300006871 Ga0075434_100132018 Ga0075434_1001320183 233
93 3300006914 Ga0075436_100000007 Ga0075436_100000007221 233
94 3300006931 Ga0097620_100041381 Ga0097620_1000413813 233
95 3300007076 Ga0075435_100007629 Ga0075435_1000076296 233
96 3300007265 Ga0099794_10015534 Ga0099794_100155342 233
97 3300007265 Ga0099794_10134412 Ga0099794_101344123 233
98 3300009147 Ga0114129_10021131 Ga0114129_100211314 233
99 3300009147 Ga0114129_10027672 Ga0114129_100276724 233
100 3300009147 Ga0114129_10320640 Ga0114129_103206402 233
101 3300009148 Ga0105243_10000073 Ga0105243_1000007382 233
102 3300009148 Ga0105243_10032423 Ga0105243_100324233 233
103 3300009148 Ga0105243_10624043 Ga0105243_106240432 233
104 3300009176 Ga0105242_10000043 Ga0105242_100000433 233
105 3300009176 Ga0105242_10812543 Ga0105242_108125432 233
106 3300009177 Ga0105248_10014087 Ga0105248_100140877 233
107 3300009177 Ga0105248_10022128 Ga0105248_100221289 233
108 3300009177 Ga0105248_10243909 Ga0105248_102439092 233
109 3300011119 Ga0105246_10180151 Ga0105246_101801512 233
110 3300013297 Ga0157378_10025592 Ga0157378_100255922 233
111 3300013297 Ga0157378_10054555 Ga0157378_100545553 233
112 3300013297 Ga0157378_10114736 Ga0157378_101147361 233
113 3300013297 Ga0157378_10200661 Ga0157378_102006612 233
114 3300013297 Ga0157378_10264491 Ga0157378_102644912 233
115 3300013306 Ga0163162_10003981 Ga0163162_100039812 233
116 3300017792 Ga0163161_10156157 Ga0163161_101561571 233
117 3300021384 Ga0213876_10000343 Ga0213876_100003439 233
118 3300025885 Ga0207653_10000240 Ga0207653_1000024017 233
119 3300025899 Ga0207642_10017079 Ga0207642_100170792 233
120 3300025899 Ga0207642_10116545 Ga0207642_101165452 233
121 3300025905 Ga0207685_10000006 Ga0207685_1000000671 233
122 3300025910 Ga0207684_10008637 Ga0207684_100086376 233
123 3300025910 Ga0207684_10022707 Ga0207684_100227073 233
124 3300025910 Ga0207684_10066977 Ga0207684_100669773 233
125 3300025922 Ga0207646_10000578 Ga0207646_100005783 233
126 3300025922 Ga0207646_10005446 Ga0207646_100054465 233
127 3300025922 Ga0207646_10017391 Ga0207646_100173916 233
128 3300025922 Ga0207646_10171050 Ga0207646_101710502 233
129 3300025922 Ga0207646_10179739 Ga0207646_101797392 233
130 3300025922 Ga0207646_10242499 Ga0207646_102424992 233
131 3300025922 Ga0207646_10559248 Ga0207646_105592482 233
132 3300025922 Ga0207646_10586098 Ga0207646_105860982 233
133 3300025923 Ga0207681_10007455 Ga0207681_100074553 233
134 3300025926 Ga0207659_10173851 Ga0207659_101738512 233
135 3300025926 Ga0207659_10536507 Ga0207659_105365071 233
136 3300025934 Ga0207686_10000003 Ga0207686_1000000322 233
137 3300025935 Ga0207709_10000124 Ga0207709_1000012422 233
138 3300025936 Ga0207670_10140536 Ga0207670_101405362 233
139 3300025939 Ga0207665_10034456 Ga0207665_100344563 233
140 3300025942 Ga0207689_10006264 Ga0207689_100062643 233
141 3300025942 Ga0207689_10013629 Ga0207689_100136292 233
142 3300025960 Ga0207651_10354007 Ga0207651_103540072 233
143 3300025981 Ga0207640_10309299 Ga0207640_103092991 233
144 3300026035 Ga0207703_10102043 Ga0207703_101020432 233
145 3300026035 Ga0207703_10116699 Ga0207703_101166992 233
146 3300026075 Ga0207708_10062676 Ga0207708_100626762 233
147 3300026075 Ga0207708_10139646 Ga0207708_101396462 233
148 3300026075 Ga0207708_10299344 Ga0207708_102993441 233
149 3300026095 Ga0207676_10045516 Ga0207676_100455166 233
150 3300026095 Ga0207676_10300690 Ga0207676_103006901 233
151 3300026095 Ga0207676_10325965 Ga0207676_103259652 233
152 3300026095 Ga0207676_10331472 Ga0207676_103314721 233
153 3300026118 Ga0207675_100227694 Ga0207675_1002276942 233
154 3300026118 Ga0207675_100572856 Ga0207675_1005728563 233
155 3300027671 Ga0209588_1009894 Ga0209588_10098944 233
156 3300027907 Ga0207428_10006067 Ga0207428_1000606713 233
157 3300028380 Ga0268265_10059015 Ga0268265_100590153 233
158 3300028381 Ga0268264_10532884 Ga0268264_105328842 233
159 3300028381 Ga0268264_10617575 Ga0268264_106175751 233
160 3300031548 Ga0307408_100167016 Ga0307408_1001670162 233
161 3300032126 Ga0307415_100543254 Ga0307415_1005432542 233
162 3300038996 Ga0242420_001840 Ga0242420_001840_247_954 233
163 3300039437 Ga0436365_1425589 Ga0436365_1425589_32563_33270 233
164 3300039437 Ga0436365_1608250 Ga0436365_1608250_1342_2049 233
165 3300041406 Ga0439439_0027507 Ga0439439_0027507_66_812 233
166 3300046512 Ga0495610_0061595 Ga0495610_0061595_578_1279 233
167 3300046514 Ga0495618_0217368 Ga0495618_0217368_141_875 233
168 3300046517 Ga0495630_0076841 Ga0495630_0076841_546_1280 233
169 3300046519 Ga0495632_0029731 Ga0495632_0029731_1804_2511 233
170 3300046525 Ga0495663_0000551 Ga0495663_0000551_6985_7686 233
171 3300046537 Ga0495598_0005169 Ga0495598_0005169_250_969 233
172 3300046539 Ga0495621_0006652 Ga0495621_0006652_753_1454 233
173 3300046539 Ga0495621_0009944 Ga0495621_0009944_663_1382 233
174 3300046615 Ga0495656_0238593 Ga0495656_0238593_63_764 233
175 3300046664 Ga0495659_0020930 Ga0495659_0020930_906_1625 233
176 3300047320 Ga0495672_0007052 Ga0495672_0007052_1696_2400 233
177 3300050507 nmdc:mga05p37_150644_c1 nmdc:mga05p37_150644_c1_1027_1749 233
178 3300050507 nmdc:mga05p37_528294_c1 nmdc:mga05p37_528294_c1_157_924 233
179 3300050507 nmdc:mga05p37_87778_c1 nmdc:mga05p37_87778_c1_2240_2998 233
180 3300050511 nmdc:mga08y16_149432_c1 nmdc:mga08y16_149432_c1_1095_1829 233
181 3300050513 nmdc:mga0rr50_312_c1 nmdc:mga0rr50_312_c1_21162_21869 233
182 3300050514 nmdc:mga08x19_70_c1 nmdc:mga08x19_70_c1_38942_39649 233
183 3300050515 nmdc:mga0a205_298580_c1 nmdc:mga0a205_298580_c1_523_1293 233
184 3300050515 nmdc:mga0a205_429539_c1 nmdc:mga0a205_429539_c1_254_1063 233
185 3300050515 nmdc:mga0a205_76512_c1 nmdc:mga0a205_76512_c1_1350_2072 233
186 3300061734 Ga0530510_0055067 Ga0530510_0055067_587_1366 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

104

202

0.91

PF08241

Methyltransf_11

Methyltransferase domain

105

206

0.88

PF13847

Methyltransf_31

Methyltransferase domain

100

254

0.84

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

88

234

0.77

PF13489

Methyltransf_23

Methyltransferase domain

77

262

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8493 61 182
6wlf-assembly2.cif.gz_B phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.8392 58 182
2vz8-assembly1.cif.gz_B crystal structure of mammalian fatty acid synthase 0.8269 58 232
6p3o-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with (s)-cis-n-methylstylopine and s-adenosylhomocysteine 0.812 53 168
6hp2-assembly1.cif.gz_A crystal structure of the o-methyltransferase from the trans-at pks multienzyme c0zgq3 of brevibacillus brevis in complex with s-adenosyl-l-homocysteine 0.8036 61 166
ID Description Score Start End Superfamily
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9308 59 159 3.40.50.150
af_A0A1D6NEM6_1_118_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8953 91 174 3.40.50.150
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8764 61 158 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8655 59 166 3.40.50.150
af_A0A1D6NER7_20_250_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8575 61 170 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W0MFS8-F1-model_v4 Methyltransferase domain-containing protein 0.9913 4 233 GO:0008168
GO:0032259
AF-A0A2V8PG64-F1-model_v4 Methyltransferase domain-containing protein 0.9803 1 178 GO:0008168
AF-A0A7V1WQZ0-F1-model_v4 Methyltransferase domain-containing protein 0.9782 64 233 GO:0008757
GO:0032259
AF-A0A2V8PG64-F1-model_v4 Methyltransferase domain-containing protein 0.9749 1 178 GO:0008168
AF-A0A7W0MFS8-F1-model_v4 Methyltransferase domain-containing protein 0.9744 4 233 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.59 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map