F285680

General Info

Members Datasets Scaffolds Average Seq Length
186 153 372 221

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100065500|Ga0068855_1000655006
Length 223
Sequence MADGKFIKLDAKLYDYVVAHGHNGDALLGELAAETARQLGGISMMQIAPEQGTLMNLLARAIGARCAVEVGTFTGYSAICVARALPPGGRLLCCDVSEEWTAIARRYWERAGVADRITLKIAPAIETLQALPAYAADNPIDFAFIDADKTNYRAYYEEVLKRMRAGGLILIDNVLWSGAVIDPKIQSEDTRAIRALNDFLATDERVDMVMLPISDGLTICRKR

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
68 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
93 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
94 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
105 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
109 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
110 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
148 2808606448 Streptomyces sp. 193411 Isolate Unclassified
149 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
150 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
151 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
152 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
153 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 0
Isolates 3.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0
Rhizoplane 3.76
Rhizosphere 88.17
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100065500 3300005563 Bacteria 4236
2 Ga0070674_100531442 3300005356 Bacteria 984
3 Ga0070667_100475576 3300005367 Bacteria 1144
4 Ga0070709_10509726 3300005434 Bacteria 915
5 Ga0070710_10058807 3300005437 Bacteria 2181
6 Ga0070705_100239160 3300005440 Bacteria 1268
7 Ga0070663_100376022 3300005455 Bacteria 1156
8 Ga0070678_100346610 3300005456 Bacteria 1276
9 Ga0070681_10574635 3300005458 Bacteria 1041
10 Ga0070706_100040812 3300005467 Bacteria 4284
11 Ga0070706_100478503 3300005467 Bacteria 1158
12 Ga0070698_100011886 3300005471 Bacteria 9235
13 Ga0070698_100081707 3300005471 Bacteria 3225
14 Ga0070699_100064485 3300005518 Bacteria 3177
15 Ga0070684_100185917 3300005535 Bacteria 1890
16 Ga0070696_100005992 3300005546 Bacteria 8116
17 Ga0070665_101105514 3300005548 Bacteria 804
18 Ga0070664_100011624 3300005564 Bacteria 7144
19 Ga0068860_100848485 3300005843 Bacteria 928
20 Ga0081455_10066256 3300005937 Bacteria 3017
21 Ga0081455_10529111 3300005937 Bacteria 785
22 Ga0070717_10039951 3300006028 Bacteria 3819
23 Ga0075363_100003576 3300006048 Bacteria 6647
24 Ga0075363_100011694 3300006048 Bacteria 4210
25 Ga0075367_10001691 3300006178 Bacteria 9650
26 Ga0075370_10129496 3300006353 Bacteria 1472
27 Ga0075428_100048915 3300006844 Bacteria 4640
28 Ga0075428_100070338 3300006844 Bacteria 3825
29 Ga0075428_100502635 3300006844 Bacteria 1297
30 Ga0075430_100095793 3300006846 Bacteria 2480
31 Ga0075431_100240602 3300006847 Bacteria 1841
32 Ga0075431_100591979 3300006847 Unclassified 1094
33 Ga0075431_100730811 3300006847 Bacteria 966
34 Ga0075433_10002180 3300006852 Bacteria 14841
35 Ga0075434_100011884 3300006871 Bacteria 8232
36 Ga0075434_101002828 3300006871 Bacteria 849
37 Ga0075429_100071990 3300006880 Bacteria 3010
38 Ga0075429_100101959 3300006880 Bacteria 2506
39 Ga0075435_100009894 3300007076 Bacteria 6942
40 Ga0105240_10185290 3300009093 Unclassified 2452
41 Ga0105245_11123720 3300009098 Bacteria 832
42 Ga0114129_10240887 3300009147 Bacteria 2431
43 Ga0114129_10311915 3300009147 Unclassified 2093
44 Ga0114129_10411615 3300009147 Bacteria 1780
45 Ga0105243_10376065 3300009148 Bacteria 1312
46 Ga0105242_10155808 3300009176 Bacteria 1995
47 Ga0182008_10002510 3300014497 Bacteria 11450
48 Ga0182007_10003349 3300015262 Bacteria 7577
49 Ga0207699_10381441 3300025906 Bacteria 1000
50 Ga0207645_10147766 3300025907 Bacteria 1533
51 Ga0207695_10010477 3300025913 Bacteria 11339
52 Ga0207694_10102337 3300025924 Bacteria 2271
53 Ga0207687_10594433 3300025927 Bacteria 932
54 Ga0207709_10244815 3300025935 Bacteria 1306
55 Ga0207679_10204461 3300025945 Bacteria 1652
56 Ga0207658_10623742 3300025986 Bacteria 970
57 Ga0207683_10385624 3300026121 Bacteria 1288
58 Ga0268264_10548251 3300028381 Bacteria 1134
59 Ga0265336_10013268 3300028666 Bacteria 2749
60 Ga0265338_10004121 3300028800 Bacteria 19908
61 Ga0265338_10069602 3300028800 Bacteria 3022
62 Ga0265330_10005362 3300031235 Bacteria 6391
63 Ga0265332_10042087 3300031238 Bacteria 1975
64 Ga0265328_10001493 3300031239 Bacteria 10797
65 Ga0265320_10005082 3300031240 Bacteria 8504
66 Ga0265325_10020789 3300031241 Bacteria 3614
67 Ga0265329_10014766 3300031242 Bacteria 2750
68 Ga0265339_10005683 3300031249 Bacteria 8277
69 Ga0265339_10015161 3300031249 Bacteria 4627
70 Ga0307408_100086473 3300031548 Bacteria 2357
71 Ga0307514_10009520 3300031649 Bacteria 8163
72 Ga0265314_10008179 3300031711 Bacteria 8996
73 Ga0265314_10014585 3300031711 Bacteria 6273
74 Ga0265342_10002581 3300031712 Bacteria 15516
75 Ga0265342_10011843 3300031712 Bacteria 5939
76 Ga0316576_10358380 3300031727 Bacteria 1085
77 Ga0307516_10001191 3300031730 Bacteria 36363
78 Ga0307405_10894710 3300031731 Bacteria 750
79 Ga0307413_10017886 3300031824 Bacteria 3704
80 Ga0307518_10265024 3300031838 Bacteria 1078
81 Ga0307410_10059912 3300031852 Bacteria 2600
82 Ga0307406_10038108 3300031901 Bacteria 2974
83 Ga0307414_10100712 3300032004 Bacteria 2173
84 Ga0373954_0028791 3300035118 Bacteria 2555
85 Ga0316574_0048887 3300035398 Bacteria 2628
86 Ga0316574_0188404 3300035398 Bacteria 1327
87 Ga0373933_0066099 3300035724 Bacteria 2190
88 Ga0373947_0013882 3300035725 Bacteria 4619
89 Ga0373937_0003126 3300036401 Bacteria 13856
90 Ga0316582_0127074 3300036647 Bacteria 1710
91 Ga0373925_0057282 3300037068 Bacteria 2920
92 Ga0395898_0001803 3300037466 Bacteria 27710
93 Ga0395901_0247298 3300038443 Bacteria 1859
94 Ga0395901_0842376 3300038443 Bacteria 903
95 Ga0436365_0508385 3300039437 Bacteria 1002
96 Ga0436362_0093583 3300039453 Unclassified 978
97 Ga0466963_0192439 3300044694 Bacteria 1425
98 Ga0466963_0343128 3300044694 Bacteria 1052
99 Ga0466967_0037540 3300045976 Bacteria 4147
100 Ga0466967_0337082 3300045976 Bacteria 1457
101 Ga0495603_0009261 3300046455 Bacteria 5953
102 Ga0495629_0229497 3300046459 Bacteria 1280
103 Ga0495605_0012545 3300046474 Bacteria 4696
104 Ga0495584_0330587 3300046491 Bacteria 774
105 Ga0495594_0059332 3300046499 Bacteria 2115
106 Ga0495596_0042215 3300046500 Bacteria 1797
107 Ga0495607_0014867 3300046501 Bacteria 5058
108 Ga0495606_0007344 3300046507 Bacteria 9895
109 Ga0495618_0002392 3300046514 Bacteria 12075
110 Ga0495620_0026880 3300046515 Bacteria 2700
111 Ga0495630_0003627 3300046517 Bacteria 10760
112 Ga0495630_1057016 3300046517 Bacteria 616
113 Ga0495631_0006985 3300046518 Bacteria 5777
114 Ga0495637_0175405 3300046520 Bacteria 797
115 Ga0495654_0036534 3300046530 Bacteria 2468
116 Ga0495609_0009004 3300046538 Bacteria 4853
117 Ga0495645_0224166 3300046543 Bacteria 1263
118 Ga0495633_0100268 3300046558 Bacteria 1344
119 Ga0495611_0065910 3300046648 Bacteria 1650
120 Ga0495657_0000111 3300046675 Bacteria 73065
121 Ga0495657_0240744 3300046675 Bacteria 1092
122 Ga0495658_0168720 3300046683 Bacteria 1353
123 Ga0495613_0157361 3300046689 Bacteria 1618
124 Ga0495649_0039522 3300046694 Bacteria 2586
125 Ga0495589_0023107 3300046794 Bacteria 3169
126 Ga0495636_0023813 3300047318 Bacteria 2481
127 Ga0495672_0073067 3300047320 Bacteria 1935
128 Ga0495676_0009020 3300047321 Bacteria 9101
129 Ga0495680_0163349 3300047322 Unclassified 1616
130 Ga0495683_0104496 3300047323 Bacteria 1358
131 Ga0495687_016947 3300047443 Bacteria 3649
132 Ga0495687_119686 3300047443 Bacteria 952
133 Ga0495677_0006643 3300047445 Bacteria 4360
134 Ga0495685_015263 3300047447 Bacteria 2618
135 Ga0495685_017411 3300047447 Bacteria 2461
136 Ga0495684_0007569 3300047471 Bacteria 8404
137 Ga0495626_0055566 3300048091 Bacteria 1814
138 Ga0496103_0129288 3300048906 Bacteria 1612
139 Ga0496108_0088729 3300048911 Bacteria 2628
140 Ga0496109_0159109 3300048912 Bacteria 2116
141 Ga0496112_0805494 3300048915 Bacteria 864
142 Ga0496114_0230921 3300048917 Bacteria 1625
143 Ga0496115_0000034 3300048918 Bacteria 135380
144 Ga0496115_0000199 3300048918 Bacteria 56119
145 Ga0495682_0031449 3300049460 Bacteria 1961
146 Ga0501034_0076386 3300049571 Bacteria 3356
147 Ga0501038_0004172 3300049574 Bacteria 13436
148 Ga0501039_0159158 3300049575 Bacteria 1775
149 Ga0501043_0052924 3300049579 Bacteria 3188
150 Ga0501047_0016773 3300049581 Bacteria 6999
151 Ga0501047_0025663 3300049581 Bacteria 5666
152 Ga0501048_0291737 3300049582 Bacteria 1160
153 Ga0501067_0074492 3300049583 Bacteria 1881
154 Ga0501073_0070074 3300049589 Bacteria 2443
155 Ga0501079_0408912 3300049741 Bacteria 1065
156 Ga0501080_0239242 3300049742 Bacteria 1657
157 Ga0501035_0158784 3300049822 Bacteria 1958
158 Ga0501044_0002716 3300049823 Bacteria 20127
159 Ga0501044_0025077 3300049823 Bacteria 6324
160 Ga0501044_0044792 3300049823 Bacteria 4588
161 nmdc:mga03n38_22154_c1 3300050490 Bacteria 2568
162 nmdc:mga03n38_28847_c1 3300050490 Bacteria 2317
163 nmdc:mga06z11_16185_c1 3300050494 Bacteria 3352
164 nmdc:mga07m45_55451_c1 3300050496 Bacteria 2240
165 nmdc:mga05p37_188230_c1 3300050507 Bacteria 2508
166 nmdc:mga05p37_336991_c1 3300050507 Bacteria 1780
167 nmdc:mga05p37_408476_c1 3300050507 Bacteria 1583
168 nmdc:mga09592_130670_c1 3300050508 Bacteria 2160
169 nmdc:mga09592_656055_c1 3300050508 Unclassified 896
170 nmdc:mga0qj67_474593_c1 3300050509 Bacteria 1007
171 nmdc:mga06r32_107206_c1 3300050510 Bacteria 2745
172 nmdc:mga06r32_288479_c1 3300050510 Bacteria 1628
173 nmdc:mga08y16_188583_c1 3300050511 Bacteria 2139
174 nmdc:mga0n895_14426_c1 3300050512 Bacteria 7176
175 nmdc:mga0rr50_15092_c1 3300050513 Bacteria 5091
176 nmdc:mga08x19_48569_c1 3300050514 Bacteria 2719
177 nmdc:mga0a205_8285_c1 3300050515 Bacteria 9452
178 Ga0495595_0280282 3300053084 Bacteria 837
179 Ga0501084_0058169 3300054114 Bacteria 3235
180 2784587611 2784132148 Bacteria 8627943
181 2809231176 2808606448 Bacteria 8656184
182 2862288434 2862281513 Bacteria 9621493
183 2954004039 2954002825 Bacteria 9173742
184 3006399172 3006393351 Bacteria 6615579
185 8008579856 8008574985 Bacteria 7815457
186 8056836671 8056829672 Bacteria 9045328
187 Ga0068855_100065500
188 Ga0070674_100531442
189 Ga0070667_100475576
190 Ga0070709_10509726
191 Ga0070710_10058807
192 Ga0070705_100239160
193 Ga0070663_100376022
194 Ga0070678_100346610
195 Ga0070681_10574635
196 Ga0070706_100040812
197 Ga0070706_100478503
198 Ga0070698_100011886
199 Ga0070698_100081707
200 Ga0070699_100064485
201 Ga0070684_100185917
202 Ga0070696_100005992
203 Ga0070665_101105514
204 Ga0070664_100011624
205 Ga0068860_100848485
206 Ga0081455_10066256
207 Ga0081455_10529111
208 Ga0070717_10039951
209 Ga0075363_100003576
210 Ga0075363_100011694
211 Ga0075367_10001691
212 Ga0075370_10129496
213 Ga0075428_100048915
214 Ga0075428_100070338
215 Ga0075428_100502635
216 Ga0075430_100095793
217 Ga0075431_100240602
218 Ga0075431_100591979
219 Ga0075431_100730811
220 Ga0075433_10002180
221 Ga0075434_100011884
222 Ga0075434_101002828
223 Ga0075429_100071990
224 Ga0075429_100101959
225 Ga0075435_100009894
226 Ga0105240_10185290
227 Ga0105245_11123720
228 Ga0114129_10240887
229 Ga0114129_10311915
230 Ga0114129_10411615
231 Ga0105243_10376065
232 Ga0105242_10155808
233 Ga0182008_10002510
234 Ga0182007_10003349
235 Ga0207699_10381441
236 Ga0207645_10147766
237 Ga0207695_10010477
238 Ga0207694_10102337
239 Ga0207687_10594433
240 Ga0207709_10244815
241 Ga0207679_10204461
242 Ga0207658_10623742
243 Ga0207683_10385624
244 Ga0268264_10548251
245 Ga0265336_10013268
246 Ga0265338_10004121
247 Ga0265338_10069602
248 Ga0265330_10005362
249 Ga0265332_10042087
250 Ga0265328_10001493
251 Ga0265320_10005082
252 Ga0265325_10020789
253 Ga0265329_10014766
254 Ga0265339_10005683
255 Ga0265339_10015161
256 Ga0307408_100086473
257 Ga0307514_10009520
258 Ga0265314_10008179
259 Ga0265314_10014585
260 Ga0265342_10002581
261 Ga0265342_10011843
262 Ga0316576_10358380
263 Ga0307516_10001191
264 Ga0307405_10894710
265 Ga0307413_10017886
266 Ga0307518_10265024
267 Ga0307410_10059912
268 Ga0307406_10038108
269 Ga0307414_10100712
270 Ga0373954_0028791
271 Ga0316574_0048887
272 Ga0316574_0188404
273 Ga0373933_0066099
274 Ga0373947_0013882
275 Ga0373937_0003126
276 Ga0316582_0127074
277 Ga0373925_0057282
278 Ga0395898_0001803
279 Ga0395901_0247298
280 Ga0395901_0842376
281 Ga0436365_0508385
282 Ga0436362_0093583
283 Ga0466963_0192439
284 Ga0466963_0343128
285 Ga0466967_0037540
286 Ga0466967_0337082
287 Ga0495603_0009261
288 Ga0495629_0229497
289 Ga0495605_0012545
290 Ga0495584_0330587
291 Ga0495594_0059332
292 Ga0495596_0042215
293 Ga0495607_0014867
294 Ga0495606_0007344
295 Ga0495618_0002392
296 Ga0495620_0026880
297 Ga0495630_0003627
298 Ga0495630_1057016
299 Ga0495631_0006985
300 Ga0495637_0175405
301 Ga0495654_0036534
302 Ga0495609_0009004
303 Ga0495645_0224166
304 Ga0495633_0100268
305 Ga0495611_0065910
306 Ga0495657_0000111
307 Ga0495657_0240744
308 Ga0495658_0168720
309 Ga0495613_0157361
310 Ga0495649_0039522
311 Ga0495589_0023107
312 Ga0495636_0023813
313 Ga0495672_0073067
314 Ga0495676_0009020
315 Ga0495680_0163349
316 Ga0495683_0104496
317 Ga0495687_016947
318 Ga0495687_119686
319 Ga0495677_0006643
320 Ga0495685_015263
321 Ga0495685_017411
322 Ga0495684_0007569
323 Ga0495626_0055566
324 Ga0496103_0129288
325 Ga0496108_0088729
326 Ga0496109_0159109
327 Ga0496112_0805494
328 Ga0496114_0230921
329 Ga0496115_0000034
330 Ga0496115_0000199
331 Ga0495682_0031449
332 Ga0501034_0076386
333 Ga0501038_0004172
334 Ga0501039_0159158
335 Ga0501043_0052924
336 Ga0501047_0016773
337 Ga0501047_0025663
338 Ga0501048_0291737
339 Ga0501067_0074492
340 Ga0501073_0070074
341 Ga0501079_0408912
342 Ga0501080_0239242
343 Ga0501035_0158784
344 Ga0501044_0002716
345 Ga0501044_0025077
346 Ga0501044_0044792
347 nmdc:mga03n38_22154_c1
348 nmdc:mga03n38_28847_c1
349 nmdc:mga06z11_16185_c1
350 nmdc:mga07m45_55451_c1
351 nmdc:mga05p37_188230_c1
352 nmdc:mga05p37_336991_c1
353 nmdc:mga05p37_408476_c1
354 nmdc:mga09592_130670_c1
355 nmdc:mga09592_656055_c1
356 nmdc:mga0qj67_474593_c1
357 nmdc:mga06r32_107206_c1
358 nmdc:mga06r32_288479_c1
359 nmdc:mga08y16_188583_c1
360 nmdc:mga0n895_14426_c1
361 nmdc:mga0rr50_15092_c1
362 nmdc:mga08x19_48569_c1
363 nmdc:mga0a205_8285_c1
364 Ga0495595_0280282
365 Ga0501084_0058169
366 2784587611
367 2809231176
368 2862288434
369 2954004039
370 3006399172
371 8008579856
372 8056836671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01596

Methyltransf_3

O-methyltransferase

18

223

0.97

PF13578

Methyltransf_24

Methyltransferase domain

68

174

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tr6-assembly1.cif.gz_A-2 structure of a o-methyltransferase from coxiella burnetii 0.9773 4 220
5log-assembly1.cif.gz_A crystal structure of safc from myxococcus xanthus bound to sam 0.9683 4 220
2hnk-assembly1.cif.gz_C crystal structure of sam-dependent o-methyltransferase from pathogenic bacterium leptospira interrogans 0.9614 6 220
3cbg-assembly1.cif.gz_A-2 functional and structural characterization of a cationdependent o-methyltransferase from the cyanobacterium synechocystis sp. strain pcc 6803 0.9611 9 220
3tr6-assembly1.cif.gz_A-2 structure of a o-methyltransferase from coxiella burnetii 0.9599 4 220
ID Description Score Start End Superfamily
3tr6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9619 4 220 3.40.50.150
3cbgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9611 9 220 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.961 7 220 3.40.50.150
af_F4IAT4_68_291_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9605 43 219 3.40.50.150
af_Q86IC9_10_229_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9575 4 220 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A524NPL2-F1-model_v4 SAM-dependent methyltransferase 0.9947 53 220 GO:0008171
GO:0008757
GO:0032259
AF-A0A6G2K268-F1-model_v4 SAM-dependent methyltransferase 0.9938 19 220 GO:0008171
GO:0008757
GO:0032259
AF-A0A7Y6HNW3-F1-model_v4 O-methyltransferase 0.989 4 156 GO:0008171
GO:0008757
GO:0032259
AF-A0A524NPL2-F1-model_v4 SAM-dependent methyltransferase 0.9888 53 220 GO:0008171
GO:0008757
GO:0032259
AF-M3IJG8-F1-model_v4 O-methyltransferase domain protein 0.9887 143 220 GO:0008171
GO:0008757
GO:0032259

Map