F285620

General Info

Members Datasets Scaffolds Average Seq Length
186 141 372 518

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100034471|Ga0070706_1000344711
Length 604
Sequence MIKKRQDKLQCPVPSSSTKSGDSATHQRLRPWSRPDSGHGSLRGADSPNSSSQFEGLFGRMFRTLPAATFNEHDLLLLARTMTAVAEVVQDSEGKDKRDKDGRLIPKATPETKLDDEENLGIPAGYTYLGQFIDHDITFDPTSSLQKQNDPEALVDFRTPRLDLDCVYGRGPADQPYMFEPDGLRFRLGTDLTRNGKPTNAKDLPRINRRAIIGDKRNDENVIVSQLQGVFMQFHNAIADELKGNPPDFENVQRLVQWHYQWVVLHDFLPKIVGYPTLHQVLPHLKKRTSIYDDKPQLHFFEWKNDPFMPIEFAAAAYRFGHSMVRPIYRLNPELGGDATQDQKDRGVAGRQFIFGALRDESLNGFRDFQPIWAIDWRLFFEFDRKLDDPKNFGPGRVQPAYKIDTSLVNPLAFLPEFSEEGKDGNYEMDADGHPKTKPHEIAVLALRNLLRGMRMGLPSGQTVARYMDIEPILDKDLRVGKANVDGLKSNKSIVDVGSSFKDNAPLWFYVLAEAQHEWAKAAEANKGNDTAKNSIPVKLGPVGGRIVTEVLVGLMLGDRFSFLSQWPGWTPFSKDIPPAFAPFAPILDGRFGIAELITVAGLA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
97 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
140 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
141 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 3.76
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 4.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100034471 3300005467 Bacteria 4676
2 Ga0070683_100000113 3300005329 Bacteria 53083
3 Ga0070670_100000041 3300005331 Bacteria 147849
4 Ga0070670_100008593 3300005331 Bacteria 8711
5 Ga0068868_100002260 3300005338 Bacteria 13319
6 Ga0068868_100059587 3300005338 Bacteria 3020
7 Ga0070689_100015761 3300005340 Bacteria 5519
8 Ga0070668_100121777 3300005347 Bacteria 2086
9 Ga0070668_100129849 3300005347 Bacteria 2022
10 Ga0070669_100000124 3300005353 Bacteria 70510
11 Ga0070675_100000368 3300005354 Bacteria 30476
12 Ga0070675_100071108 3300005354 Bacteria 2885
13 Ga0070671_100006928 3300005355 Bacteria 9078
14 Ga0070673_100010224 3300005364 Bacteria 6341
15 Ga0070673_100133466 3300005364 Bacteria 2087
16 Ga0070709_10042635 3300005434 Bacteria 2803
17 Ga0070709_10055342 3300005434 Bacteria 2505
18 Ga0070713_100011031 3300005436 Bacteria 6560
19 Ga0070713_100167534 3300005436 Bacteria 1966
20 Ga0070710_10006775 3300005437 Bacteria 5525
21 Ga0070711_100006100 3300005439 Bacteria 7244
22 Ga0070711_100012436 3300005439 Bacteria 5317
23 Ga0070708_100003807 3300005445 Bacteria 11837
24 Ga0070662_100000454 3300005457 Bacteria 24209
25 Ga0070681_10057044 3300005458 Bacteria 3886
26 Ga0070706_100048737 3300005467 Bacteria 3909
27 Ga0070707_100025565 3300005468 Bacteria 5603
28 Ga0070707_100107782 3300005468 Bacteria 2703
29 Ga0070707_100153284 3300005468 Bacteria 2244
30 Ga0070684_100001793 3300005535 Bacteria 15696
31 Ga0070672_100021251 3300005543 Bacteria 4746
32 Ga0070665_100251545 3300005548 Bacteria 1768
33 Ga0068857_100018960 3300005577 Bacteria 6036
34 Ga0068852_100070376 3300005616 Bacteria 3069
35 Ga0068859_100004809 3300005617 Bacteria 13751
36 Ga0068859_100064843 3300005617 Unclassified 3686
37 Ga0068851_10004297 3300005834 Bacteria 6417
38 Ga0068863_100002505 3300005841 Bacteria 18258
39 Ga0068863_100093317 3300005841 Bacteria 2856
40 Ga0068858_100233783 3300005842 Bacteria 1743
41 Ga0081455_10135223 3300005937 Bacteria 1922
42 Ga0081538_10011990 3300005981 Bacteria 6982
43 Ga0070717_10000961 3300006028 Bacteria 19216
44 Ga0070717_10067484 3300006028 Bacteria 2976
45 Ga0070716_100001530 3300006173 Bacteria 10353
46 Ga0070712_100002192 3300006175 Bacteria 12008
47 Ga0097621_100051119 3300006237 Unclassified 3362
48 Ga0075428_100043448 3300006844 Bacteria 4940
49 Ga0075431_100015837 3300006847 Bacteria 7645
50 Ga0075434_100008790 3300006871 Bacteria 9402
51 Ga0075434_100011503 3300006871 Bacteria 8349
52 Ga0075429_100002898 3300006880 Bacteria 14540
53 Ga0075436_100032260 3300006914 Bacteria 3610
54 Ga0097620_100004809 3300006931 Bacteria 13751
55 Ga0097620_100064842 3300006931 Unclassified 3686
56 Ga0075435_100044853 3300007076 Bacteria 3543
57 Ga0099794_10005411 3300007265 Bacteria 5115
58 Ga0105240_10001026 3300009093 Bacteria 49581
59 Ga0105240_10276594 3300009093 Bacteria 1930
60 Ga0114129_10163860 3300009147 Bacteria 3035
61 Ga0105243_10026123 3300009148 Bacteria 4468
62 Ga0105241_10002252 3300009174 Bacteria 14495
63 Ga0105241_10087370 3300009174 Bacteria 2454
64 Ga0105241_10156710 3300009174 Bacteria 1868
65 Ga0105242_10016524 3300009176 Bacteria 5738
66 Ga0105248_10058161 3300009177 Bacteria 4341
67 Ga0105237_10001217 3300009545 Bacteria 34377
68 Ga0105237_10041876 3300009545 Plasmid 4618
69 Ga0105238_10000001 3300009551 Bacteria 2036163
70 Ga0105238_10011271 3300009551 Bacteria 8997
71 Ga0105238_10019271 3300009551 Bacteria 6951
72 Ga0157374_10000021 3300013296 Bacteria 272840
73 Ga0157374_10003129 3300013296 Bacteria 13899
74 Ga0157378_10003786 3300013297 Bacteria 13408
75 Ga0157378_10010200 3300013297 Bacteria 8198
76 Ga0157378_10014722 3300013297 Bacteria 6852
77 Ga0157378_10046550 3300013297 Bacteria 3855
78 Ga0163162_10052539 3300013306 Bacteria 4093
79 Ga0157372_10123727 3300013307 Bacteria 2973
80 Ga0157375_10015716 3300013308 Bacteria 6782
81 Ga0157375_10102652 3300013308 Bacteria 2945
82 Ga0157377_10000009 3300014745 Bacteria 385287
83 Ga0157379_10006197 3300014968 Bacteria 10301
84 Ga0157379_10060493 3300014968 Bacteria 3386
85 Ga0157376_10000020 3300014969 Bacteria 246318
86 Ga0157376_10032851 3300014969 Bacteria 4171
87 Ga0213873_10002126 3300021358 Bacteria 3392
88 Ga0213876_10000012 3300021384 Bacteria 396530
89 Ga0207692_10003465 3300025898 Bacteria 6166
90 Ga0207699_10008732 3300025906 Bacteria 5013
91 Ga0207684_10051281 3300025910 Bacteria 3501
92 Ga0207684_10227337 3300025910 Bacteria 1610
93 Ga0207695_10005020 3300025913 Bacteria 17769
94 Ga0207671_10007064 3300025914 Bacteria 9824
95 Ga0207671_10024301 3300025914 Plasmid 4559
96 Ga0207693_10002813 3300025915 Bacteria 15077
97 Ga0207663_10017635 3300025916 Bacteria 3984
98 Ga0207662_10048664 3300025918 Unclassified 2512
99 Ga0207681_10000032 3300025923 Bacteria 168987
100 Ga0207694_10000001 3300025924 Bacteria 4078485
101 Ga0207650_10000088 3300025925 Bacteria 123236
102 Ga0207659_10000391 3300025926 Bacteria 26406
103 Ga0207687_10044913 3300025927 Unclassified 3052
104 Ga0207700_10001872 3300025928 Bacteria 11936
105 Ga0207644_10047455 3300025931 Bacteria 3065
106 Ga0207644_10097845 3300025931 Bacteria 2198
107 Ga0207706_10001185 3300025933 Bacteria 26338
108 Ga0207686_10072759 3300025934 Bacteria 2216
109 Ga0207709_10029311 3300025935 Bacteria 3190
110 Ga0207665_10001042 3300025939 Bacteria 18657
111 Ga0207665_10039222 3300025939 Bacteria 3157
112 Ga0207665_10084056 3300025939 Bacteria 2196
113 Ga0207691_10016048 3300025940 Bacteria 7114
114 Ga0207691_10065383 3300025940 Bacteria 3292
115 Ga0207711_10126249 3300025941 Bacteria 2289
116 Ga0207661_10000001 3300025944 Bacteria 937688
117 Ga0207679_10202786 3300025945 Bacteria 1658
118 Ga0207677_10000009 3300026023 Bacteria 252751
119 Ga0207677_10025399 3300026023 Bacteria 3696
120 Ga0207677_10054831 3300026023 Bacteria 2722
121 Ga0207708_10062140 3300026075 Bacteria 2853
122 Ga0207641_10007036 3300026088 Bacteria 9399
123 Ga0207674_10001706 3300026116 Bacteria 28118
124 Ga0207698_10081854 3300026142 Bacteria 2608
125 Ga0268266_10241030 3300028379 Bacteria 1669
126 Ga0268265_10030533 3300028380 Bacteria 3883
127 Ga0373923_0053037 3300035111 Bacteria 1705
128 Ga0373937_0096262 3300036401 Bacteria 2745
129 Ga0395900_0043522 3300037418 Bacteria 4628
130 Ga0395898_0111886 3300037466 Bacteria 2617
131 Ga0395905_0010820 3300037471 Bacteria 8838
132 Ga0395901_0005886 3300038443 Bacteria 12408
133 Ga0400484_09716 3300038725 Bacteria 20414
134 Ga0400488_52225 3300038741 Bacteria 6099
135 Ga0400483_049294 3300039062 Bacteria 8915
136 Ga0400489_32653 3300039093 Bacteria 6383
137 Ga0436365_0120716 3300039437 Bacteria 90169
138 Ga0436362_1233885 3300039453 Bacteria 23331
139 Ga0451577_0200949 3300042876 Bacteria 1799
140 Ga0453684_0026382 3300044712 Bacteria 8397
141 Ga0451576_0018127 3300045051 Bacteria 7723
142 Ga0495592_0052369 3300046454 Bacteria 3031
143 Ga0495651_0013821 3300046462 Bacteria 6244
144 Ga0495653_0011956 3300046463 Bacteria 7089
145 Ga0495664_0025602 3300046477 Bacteria 3436
146 Ga0495628_0054220 3300046516 Bacteria 3161
147 Ga0495630_0061445 3300046517 Bacteria 2821
148 Ga0495652_0030896 3300046529 Bacteria 4694
149 Ga0495587_0034031 3300046536 Bacteria 3074
150 Ga0495634_0037447 3300046642 Bacteria 3314
151 Ga0495635_0066005 3300046663 Bacteria 2482
152 Ga0495657_0026371 3300046675 Bacteria 4115
153 Ga0495623_0030780 3300046679 Bacteria 3453
154 Ga0495646_0026477 3300046680 Bacteria 3642
155 Ga0495658_0060002 3300046683 Bacteria 2180
156 Ga0495600_0006264 3300046809 Bacteria 7226
157 Ga0495604_0031595 3300047317 Bacteria 4199
158 Ga0495674_0015302 3300047319 Bacteria 7176
159 Ga0495674_0062067 3300047319 Bacteria 3255
160 Ga0495680_0018259 3300047322 Bacteria 5960
161 Ga0495675_0096924 3300047444 Bacteria 1849
162 Ga0495593_0048621 3300047673 Bacteria 2254
163 Ga0496104_0042447 3300048907 Bacteria 4268
164 Ga0496104_0101769 3300048907 Bacteria 2751
165 Ga0496108_0156209 3300048911 Bacteria 1970
166 Ga0496110_0070624 3300048913 Bacteria 3095
167 Ga0496115_0001599 3300048918 Bacteria 16277
168 Ga0496115_0014976 3300048918 Bacteria 5878
169 Ga0496115_0051589 3300048918 Bacteria 3298
170 Ga0496118_0105786 3300048921 Bacteria 1885
171 Ga0496121_0067483 3300048924 Bacteria 2899
172 nmdc:mga09592_14173_c1 3300050508 Bacteria 6504
173 nmdc:mga0n895_114688_c1 3300050512 Bacteria 2712
174 nmdc:mga0n895_226798_c1 3300050512 Bacteria 1896
175 nmdc:mga0n895_313968_c1 3300050512 Bacteria 1588
176 nmdc:mga0n895_44643_c1 3300050512 Bacteria 4322
177 nmdc:mga0n895_9973_c1 3300050512 Bacteria 8357
178 nmdc:mga08x19_115109_c1 3300050514 Unclassified 1797
179 nmdc:mga0a205_10386_c1 3300050515 Bacteria 8556
180 Ga0495619_0037805 3300053085 Bacteria 3148
181 Ga0500604_0016150 3300053151 Unclassified 2054
182 Ga0500616_0053602 3300053153 Unclassified 2116
183 Ga0500622_0002291 3300053156 Bacteria 14023
184 2643908914 2643221579 Bacteria 4443405
185 2867352287 2867346516 Bacteria 7608576
186 2886630204 2886627955 Bacteria 7618130
187 Ga0070706_100034471
188 Ga0070683_100000113
189 Ga0070670_100000041
190 Ga0070670_100008593
191 Ga0068868_100002260
192 Ga0068868_100059587
193 Ga0070689_100015761
194 Ga0070668_100121777
195 Ga0070668_100129849
196 Ga0070669_100000124
197 Ga0070675_100000368
198 Ga0070675_100071108
199 Ga0070671_100006928
200 Ga0070673_100010224
201 Ga0070673_100133466
202 Ga0070709_10042635
203 Ga0070709_10055342
204 Ga0070713_100011031
205 Ga0070713_100167534
206 Ga0070710_10006775
207 Ga0070711_100006100
208 Ga0070711_100012436
209 Ga0070708_100003807
210 Ga0070662_100000454
211 Ga0070681_10057044
212 Ga0070706_100048737
213 Ga0070707_100025565
214 Ga0070707_100107782
215 Ga0070707_100153284
216 Ga0070684_100001793
217 Ga0070672_100021251
218 Ga0070665_100251545
219 Ga0068857_100018960
220 Ga0068852_100070376
221 Ga0068859_100004809
222 Ga0068859_100064843
223 Ga0068851_10004297
224 Ga0068863_100002505
225 Ga0068863_100093317
226 Ga0068858_100233783
227 Ga0081455_10135223
228 Ga0081538_10011990
229 Ga0070717_10000961
230 Ga0070717_10067484
231 Ga0070716_100001530
232 Ga0070712_100002192
233 Ga0097621_100051119
234 Ga0075428_100043448
235 Ga0075431_100015837
236 Ga0075434_100008790
237 Ga0075434_100011503
238 Ga0075429_100002898
239 Ga0075436_100032260
240 Ga0097620_100004809
241 Ga0097620_100064842
242 Ga0075435_100044853
243 Ga0099794_10005411
244 Ga0105240_10001026
245 Ga0105240_10276594
246 Ga0114129_10163860
247 Ga0105243_10026123
248 Ga0105241_10002252
249 Ga0105241_10087370
250 Ga0105241_10156710
251 Ga0105242_10016524
252 Ga0105248_10058161
253 Ga0105237_10001217
254 Ga0105237_10041876
255 Ga0105238_10000001
256 Ga0105238_10011271
257 Ga0105238_10019271
258 Ga0157374_10000021
259 Ga0157374_10003129
260 Ga0157378_10003786
261 Ga0157378_10010200
262 Ga0157378_10014722
263 Ga0157378_10046550
264 Ga0163162_10052539
265 Ga0157372_10123727
266 Ga0157375_10015716
267 Ga0157375_10102652
268 Ga0157377_10000009
269 Ga0157379_10006197
270 Ga0157379_10060493
271 Ga0157376_10000020
272 Ga0157376_10032851
273 Ga0213873_10002126
274 Ga0213876_10000012
275 Ga0207692_10003465
276 Ga0207699_10008732
277 Ga0207684_10051281
278 Ga0207684_10227337
279 Ga0207695_10005020
280 Ga0207671_10007064
281 Ga0207671_10024301
282 Ga0207693_10002813
283 Ga0207663_10017635
284 Ga0207662_10048664
285 Ga0207681_10000032
286 Ga0207694_10000001
287 Ga0207650_10000088
288 Ga0207659_10000391
289 Ga0207687_10044913
290 Ga0207700_10001872
291 Ga0207644_10047455
292 Ga0207644_10097845
293 Ga0207706_10001185
294 Ga0207686_10072759
295 Ga0207709_10029311
296 Ga0207665_10001042
297 Ga0207665_10039222
298 Ga0207665_10084056
299 Ga0207691_10016048
300 Ga0207691_10065383
301 Ga0207711_10126249
302 Ga0207661_10000001
303 Ga0207679_10202786
304 Ga0207677_10000009
305 Ga0207677_10025399
306 Ga0207677_10054831
307 Ga0207708_10062140
308 Ga0207641_10007036
309 Ga0207674_10001706
310 Ga0207698_10081854
311 Ga0268266_10241030
312 Ga0268265_10030533
313 Ga0373923_0053037
314 Ga0373937_0096262
315 Ga0395900_0043522
316 Ga0395898_0111886
317 Ga0395905_0010820
318 Ga0395901_0005886
319 Ga0400484_09716
320 Ga0400488_52225
321 Ga0400483_049294
322 Ga0400489_32653
323 Ga0436365_0120716
324 Ga0436362_1233885
325 Ga0451577_0200949
326 Ga0453684_0026382
327 Ga0451576_0018127
328 Ga0495592_0052369
329 Ga0495651_0013821
330 Ga0495653_0011956
331 Ga0495664_0025602
332 Ga0495628_0054220
333 Ga0495630_0061445
334 Ga0495652_0030896
335 Ga0495587_0034031
336 Ga0495634_0037447
337 Ga0495635_0066005
338 Ga0495657_0026371
339 Ga0495623_0030780
340 Ga0495646_0026477
341 Ga0495658_0060002
342 Ga0495600_0006264
343 Ga0495604_0031595
344 Ga0495674_0015302
345 Ga0495674_0062067
346 Ga0495680_0018259
347 Ga0495675_0096924
348 Ga0495593_0048621
349 Ga0496104_0042447
350 Ga0496104_0101769
351 Ga0496108_0156209
352 Ga0496110_0070624
353 Ga0496115_0001599
354 Ga0496115_0014976
355 Ga0496115_0051589
356 Ga0496118_0105786
357 Ga0496121_0067483
358 nmdc:mga09592_14173_c1
359 nmdc:mga0n895_114688_c1
360 nmdc:mga0n895_226798_c1
361 nmdc:mga0n895_313968_c1
362 nmdc:mga0n895_44643_c1
363 nmdc:mga0n895_9973_c1
364 nmdc:mga08x19_115109_c1
365 nmdc:mga0a205_10386_c1
366 Ga0495619_0037805
367 Ga0500604_0016150
368 Ga0500616_0053602
369 Ga0500622_0002291
370 2643908914
371 2867352287
372 2886630204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03098

An_peroxidase

Animal haem peroxidase

143

346

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wxv-assembly1.cif.gz_A cryoem structure of mouse duox1-duoxa1 complex in the presence of nadph 0.6579 38 492
6bmt-assembly1.cif.gz_A crystal structure of a recombinant form of human myeloperoxidase bound to an inhibitor from staphylococcus delphini 0.6572 57 475
4c1m-assembly1.cif.gz_D myeloperoxidase in complex with the revesible inhibitor hx1 0.654 110 466
6wxr-assembly1.cif.gz_A cryoem structure of mouse duox1-duoxa1 complex in the absence of nadph 0.6471 38 492
7qzr-assembly2.cif.gz_D structure of native leukocyte myeloperoxidase in complex with the staphyloccal peroxidase inhibitor spin from staphylococcus aureus 0.646 110 475
ID Description Score Start End Superfamily
af_O17241_643_1230_1.10.640.10 Mainly Alpha;Orthogonal Bundle;Myeloperoxidase, subunit C;Haem peroxidase domain superfamily, animal type 0.6902 48 493 1.10.640.10
af_Q20616_121_655_1.10.640.10 Mainly Alpha;Orthogonal Bundle;Myeloperoxidase, subunit C;Haem peroxidase domain superfamily, animal type 0.663 39 472 1.10.640.10
af_Q01603_94_677_1.10.640.10 Mainly Alpha;Orthogonal Bundle;Myeloperoxidase, subunit C;Haem peroxidase domain superfamily, animal type 0.6591 48 494 1.10.640.10
af_A0A1D6QIV5_418_605_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.6587 175 214 1.10.472.10
4c1mD00 Mainly Alpha;Orthogonal Bundle;Myeloperoxidase, subunit C;Haem peroxidase domain superfamily, animal type 0.654 110 466 1.10.640.10
ID Description Score Start End GO Terms
AF-A0A537JEX8-F1-model_v4 Uncharacterized protein 0.9245 360 494 GO:0004601
GO:0006979
GO:0020037
AF-A0A534XJ86-F1-model_v4 Heme peroxidase 0.9142 44 494 GO:0004601
GO:0006979
GO:0020037
AF-A0A7S7NNL4-F1-model_v4 Peroxidase 0.9079 107 489 GO:0004601
GO:0006979
GO:0020037
AF-A0A536GVB5-F1-model_v4 Peroxidase 0.9077 178 489 GO:0004601
GO:0006979
GO:0020037
AF-A0A2V5T3T5-F1-model_v4 Uncharacterized protein 0.9032 361 491 GO:0004601
GO:0006979
GO:0020037

Map