F285557

General Info

Members Datasets Scaffolds Average Seq Length
186 124 372 121

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100038307|Ga0070714_1000383072
Length 123
Sequence MMRSMPYSVDVWLRGNDFATTAPLEGVTNDPRAWTDDDVQLVLEGMLRAMDRLKRPGEADREIVLRGLSWIVNPFDGGGVVIAIEITLGAAIAGPFDIDRPALESMITRVLARPSTPPSSTVH

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.61
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 36.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100038307 3300005435 Bacteria 4030
2 Ga0058860_12108258 3300004801 Unclassified 575
3 Ga0065714_10133096 3300005288 Bacteria 1228
4 Ga0065712_10020152 3300005290 Bacteria 2307
5 Ga0065707_10397232 3300005295 Unclassified 857
6 Ga0065707_10805688 3300005295 Bacteria 597
7 Ga0070676_10090945 3300005328 Bacteria 1869
8 Ga0070670_100061152 3300005331 Unclassified 3233
9 Ga0070677_10010526 3300005333 Unclassified 3166
10 Ga0070666_10237759 3300005335 Bacteria 1287
11 Ga0070666_10807914 3300005335 Bacteria 691
12 Ga0070687_100867295 3300005343 Unclassified 645
13 Ga0070668_100662969 3300005347 Unclassified 917
14 Ga0070669_100014299 3300005353 Bacteria 5648
15 Ga0070669_101045115 3300005353 Bacteria 702
16 Ga0070675_100006685 3300005354 Bacteria 8863
17 Ga0070675_101206964 3300005354 Unclassified 696
18 Ga0070674_100300487 3300005356 Unclassified 1279
19 Ga0070674_101501797 3300005356 Unclassified 605
20 Ga0070673_100018075 3300005364 Bacteria 5030
21 Ga0070673_100505825 3300005364 Bacteria 1093
22 Ga0070688_100151231 3300005365 Unclassified 1587
23 Ga0070667_100384153 3300005367 Bacteria 1276
24 Ga0070713_100071016 3300005436 Bacteria 2941
25 Ga0070711_100306219 3300005439 Bacteria 1265
26 Ga0070700_101720089 3300005441 Unclassified 538
27 Ga0070694_100429134 3300005444 Unclassified 1040
28 Ga0070694_100454739 3300005444 Bacteria 1011
29 Ga0070678_101005545 3300005456 Bacteria 767
30 Ga0070678_101508236 3300005456 Unclassified 630
31 Ga0068867_100175124 3300005459 Bacteria 1702
32 Ga0068867_100767915 3300005459 Unclassified 857
33 Ga0068867_100813724 3300005459 Unclassified 834
34 Ga0070698_100057452 3300005471 Bacteria 3937
35 Ga0070698_100640500 3300005471 Unclassified 1004
36 Ga0070698_102104996 3300005471 Unclassified 518
37 Ga0070697_100018550 3300005536 Bacteria 5486
38 Ga0070697_100147576 3300005536 Unclassified 1981
39 Ga0070672_100048446 3300005543 Unclassified 3302
40 Ga0070672_100585559 3300005543 Bacteria 971
41 Ga0070686_100139843 3300005544 Bacteria 1684
42 Ga0070695_100119781 3300005545 Unclassified 1799
43 Ga0070695_101416569 3300005545 Unclassified 577
44 Ga0070696_100400155 3300005546 Bacteria 1074
45 Ga0070696_101567949 3300005546 Unclassified 565
46 Ga0070704_100087032 3300005549 Bacteria 2318
47 Ga0070704_100303157 3300005549 Bacteria 1332
48 Ga0070664_101543935 3300005564 Unclassified 629
49 Ga0068859_101203382 3300005617 Bacteria 834
50 Ga0068864_100179186 3300005618 Bacteria 1936
51 Ga0068864_102023279 3300005618 Bacteria 582
52 Ga0068861_100135533 3300005719 Unclassified 2003
53 Ga0068861_100456737 3300005719 Unclassified 1146
54 Ga0068858_101264839 3300005842 Unclassified 726
55 Ga0068860_100522829 3300005843 Unclassified 1187
56 Ga0070716_100216034 3300006173 Bacteria 1285
57 Ga0097621_101228284 3300006237 Bacteria 706
58 Ga0068871_100252437 3300006358 Bacteria 1536
59 Ga0075428_100103510 3300006844 Unclassified 3104
60 Ga0075428_101242131 3300006844 Archaea 785
61 Ga0075430_100143725 3300006846 Bacteria 1987
62 Ga0075430_101067034 3300006846 Archaea 665
63 Ga0075433_10082775 3300006852 Unclassified 2831
64 Ga0075434_100000237 3300006871 Bacteria 38182
65 Ga0075434_100194347 3300006871 Bacteria 2049
66 Ga0075434_100926176 3300006871 Unclassified 886
67 Ga0075434_101079500 3300006871 Bacteria 816
68 Ga0075434_101439648 3300006871 Bacteria 699
69 Ga0075429_100042926 3300006880 Bacteria 3934
70 Ga0068865_100084888 3300006881 Unclassified 2283
71 Ga0075436_100000078 3300006914 Bacteria 55590
72 Ga0075436_100029379 3300006914 Bacteria 3780
73 Ga0075436_100998449 3300006914 Bacteria 628
74 Ga0097620_101203387 3300006931 Bacteria 834
75 Ga0075435_100000018 3300007076 Bacteria 97506
76 Ga0075435_100011529 3300007076 Bacteria 6509
77 Ga0075435_100033170 3300007076 Bacteria 4081
78 Ga0075435_100112921 3300007076 Bacteria 2261
79 Ga0105240_10113785 3300009093 Bacteria 3269
80 Ga0111539_11617661 3300009094 Bacteria 751
81 Ga0105245_10765623 3300009098 Unclassified 1002
82 Ga0105245_11347769 3300009098 Bacteria 763
83 Ga0105247_10698507 3300009101 Bacteria 763
84 Ga0114129_10018376 3300009147 Bacteria 9959
85 Ga0114129_10023164 3300009147 Bacteria 8807
86 Ga0114129_10076156 3300009147 Bacteria 4671
87 Ga0114129_13139175 3300009147 Bacteria 539
88 Ga0105243_10489034 3300009148 Bacteria 1163
89 Ga0105241_12049662 3300009174 Bacteria 564
90 Ga0105248_10510227 3300009177 Unclassified 1356
91 Ga0105248_10710097 3300009177 Unclassified 1134
92 Ga0163162_10238179 3300013306 Bacteria 1950
93 Ga0157372_10302494 3300013307 Bacteria 1860
94 Ga0157375_10444524 3300013308 Bacteria 1462
95 Ga0157375_13814680 3300013308 Unclassified 500
96 Ga0163163_10132637 3300014325 Bacteria 2531
97 Ga0157380_10342007 3300014326 Bacteria 1396
98 Ga0157380_10383230 3300014326 Bacteria 1328
99 Ga0157380_10785335 3300014326 Bacteria 968
100 Ga0157380_12446572 3300014326 Unclassified 588
101 Ga0157379_10409796 3300014968 Bacteria 1247
102 Ga0157379_11889071 3300014968 Unclassified 588
103 Ga0207682_10001371 3300025893 Bacteria 11230
104 Ga0207642_10069593 3300025899 Bacteria 1669
105 Ga0207680_10037525 3300025903 Unclassified 2798
106 Ga0207645_10041030 3300025907 Unclassified 2964
107 Ga0207645_10619876 3300025907 Bacteria 735
108 Ga0207643_10013549 3300025908 Unclassified 4417
109 Ga0207684_10847076 3300025910 Bacteria 771
110 Ga0207681_10111041 3300025923 Bacteria 1994
111 Ga0207681_10756053 3300025923 Bacteria 810
112 Ga0207650_10219157 3300025925 Bacteria 1531
113 Ga0207659_10043195 3300025926 Unclassified 3165
114 Ga0207659_11059823 3300025926 Unclassified 698
115 Ga0207687_11597998 3300025927 Bacteria 559
116 Ga0207700_10761593 3300025928 Unclassified 865
117 Ga0207664_10040948 3300025929 Bacteria 3607
118 Ga0207706_10042750 3300025933 Bacteria 4016
119 Ga0207669_10498922 3300025937 Bacteria 973
120 Ga0207669_11055499 3300025937 Bacteria 684
121 Ga0207665_10257589 3300025939 Bacteria 1291
122 Ga0207665_11049772 3300025939 Bacteria 649
123 Ga0207691_10076161 3300025940 Unclassified 3024
124 Ga0207691_10575519 3300025940 Bacteria 954
125 Ga0207711_11066092 3300025941 Unclassified 749
126 Ga0207689_10920147 3300025942 Bacteria 738
127 Ga0207679_10682106 3300025945 Unclassified 931
128 Ga0207651_10019582 3300025960 Unclassified 4060
129 Ga0207668_10325483 3300025972 Unclassified 1277
130 Ga0207658_10079716 3300025986 Unclassified 2506
131 Ga0207658_11459384 3300025986 Bacteria 626
132 Ga0207703_11968035 3300026035 Bacteria 561
133 Ga0207708_10070520 3300026075 Bacteria 2676
134 Ga0207702_11396181 3300026078 Unclassified 694
135 Ga0207648_10078848 3300026089 Unclassified 2873
136 Ga0207676_10380778 3300026095 Bacteria 1313
137 Ga0207676_11977178 3300026095 Bacteria 582
138 Ga0207675_100035735 3300026118 Bacteria 4634
139 Ga0207675_100210614 3300026118 Unclassified 1869
140 Ga0207683_10042273 3300026121 Bacteria 3980
141 Ga0209998_10071436 3300027717 Unclassified 830
142 Ga0209974_10145530 3300027876 Bacteria 852
143 Ga0207428_10368316 3300027907 Bacteria 1055
144 Ga0268265_12491634 3300028380 Unclassified 523
145 Ga0268264_10430807 3300028381 Unclassified 1274
146 Ga0307408_102191208 3300031548 Bacteria 534
147 Ga0307410_10055819 3300031852 Bacteria 2683
148 Ga0373941_0060427 3300035115 Unclassified 1232
149 Ga0373931_0667493 3300035691 Bacteria 684
150 Ga0373933_0805765 3300035724 Unclassified 618
151 Ga0373925_0249215 3300037068 Bacteria 1424
152 Ga0395901_0518852 3300038443 Bacteria 1211
153 Ga0453683_0971832 3300044673 Unclassified 563
154 Ga0466963_0034374 3300044694 Bacteria 3298
155 Ga0451576_0039057 3300045051 Bacteria 5024
156 Ga0451576_0108046 3300045051 Bacteria 2895
157 Ga0451576_0226763 3300045051 Bacteria 1951
158 Ga0466967_0091691 3300045976 Unclassified 2762
159 Ga0495656_0386150 3300046615 Bacteria 730
160 Ga0495674_0720152 3300047319 Bacteria 782
161 Ga0496100_1217967 3300048903 Unclassified 594
162 Ga0496109_0047947 3300048912 Bacteria 3886
163 Ga0496112_0177112 3300048915 Unclassified 2097
164 Ga0501037_0725813 3300049573 Unclassified 660
165 Ga0501047_1348658 3300049581 Bacteria 528
166 nmdc:mga05p37_125059_c1 3300050507 Bacteria 3158
167 nmdc:mga05p37_22399_c1 3300050507 Bacteria 5768
168 nmdc:mga05p37_23720_c1 3300050507 Bacteria 7450
169 nmdc:mga05p37_666690_c1 3300050507 Unclassified 1162
170 nmdc:mga05p37_93531_c1 3300050507 Bacteria 3704
171 nmdc:mga09592_34793_c1 3300050508 Unclassified 4213
172 nmdc:mga0qj67_532576_c1 3300050509 Bacteria 943
173 nmdc:mga08y16_709171_c1 3300050511 Unclassified 669
174 nmdc:mga0n895_24_c1 3300050512 Bacteria 92082
175 nmdc:mga0n895_260263_c1 3300050512 Bacteria 1761
176 nmdc:mga0n895_467058_c1 3300050512 Bacteria 1273
177 nmdc:mga0n895_801779_c1 3300050512 Bacteria 932
178 nmdc:mga0rr50_1771_c1 3300050513 Bacteria 11927
179 nmdc:mga0rr50_207050_c1 3300050513 Bacteria 1615
180 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
181 nmdc:mga08x19_77_c1 3300050514 Bacteria 91801
182 nmdc:mga0a205_135515_c1 3300050515 Unclassified 2363
183 nmdc:mga0a205_227470_c1 3300050515 Bacteria 1749
184 nmdc:mga0a205_621765_c1 3300050515 Bacteria 932
185 Ga0590071_024497 3300059421 Unclassified 1430
186 Ga0590077_005019 3300059426 Bacteria 2706
187 Ga0070714_100038307
188 Ga0058860_12108258
189 Ga0065714_10133096
190 Ga0065712_10020152
191 Ga0065707_10397232
192 Ga0065707_10805688
193 Ga0070676_10090945
194 Ga0070670_100061152
195 Ga0070677_10010526
196 Ga0070666_10237759
197 Ga0070666_10807914
198 Ga0070687_100867295
199 Ga0070668_100662969
200 Ga0070669_100014299
201 Ga0070669_101045115
202 Ga0070675_100006685
203 Ga0070675_101206964
204 Ga0070674_100300487
205 Ga0070674_101501797
206 Ga0070673_100018075
207 Ga0070673_100505825
208 Ga0070688_100151231
209 Ga0070667_100384153
210 Ga0070713_100071016
211 Ga0070711_100306219
212 Ga0070700_101720089
213 Ga0070694_100429134
214 Ga0070694_100454739
215 Ga0070678_101005545
216 Ga0070678_101508236
217 Ga0068867_100175124
218 Ga0068867_100767915
219 Ga0068867_100813724
220 Ga0070698_100057452
221 Ga0070698_100640500
222 Ga0070698_102104996
223 Ga0070697_100018550
224 Ga0070697_100147576
225 Ga0070672_100048446
226 Ga0070672_100585559
227 Ga0070686_100139843
228 Ga0070695_100119781
229 Ga0070695_101416569
230 Ga0070696_100400155
231 Ga0070696_101567949
232 Ga0070704_100087032
233 Ga0070704_100303157
234 Ga0070664_101543935
235 Ga0068859_101203382
236 Ga0068864_100179186
237 Ga0068864_102023279
238 Ga0068861_100135533
239 Ga0068861_100456737
240 Ga0068858_101264839
241 Ga0068860_100522829
242 Ga0070716_100216034
243 Ga0097621_101228284
244 Ga0068871_100252437
245 Ga0075428_100103510
246 Ga0075428_101242131
247 Ga0075430_100143725
248 Ga0075430_101067034
249 Ga0075433_10082775
250 Ga0075434_100000237
251 Ga0075434_100194347
252 Ga0075434_100926176
253 Ga0075434_101079500
254 Ga0075434_101439648
255 Ga0075429_100042926
256 Ga0068865_100084888
257 Ga0075436_100000078
258 Ga0075436_100029379
259 Ga0075436_100998449
260 Ga0097620_101203387
261 Ga0075435_100000018
262 Ga0075435_100011529
263 Ga0075435_100033170
264 Ga0075435_100112921
265 Ga0105240_10113785
266 Ga0111539_11617661
267 Ga0105245_10765623
268 Ga0105245_11347769
269 Ga0105247_10698507
270 Ga0114129_10018376
271 Ga0114129_10023164
272 Ga0114129_10076156
273 Ga0114129_13139175
274 Ga0105243_10489034
275 Ga0105241_12049662
276 Ga0105248_10510227
277 Ga0105248_10710097
278 Ga0163162_10238179
279 Ga0157372_10302494
280 Ga0157375_10444524
281 Ga0157375_13814680
282 Ga0163163_10132637
283 Ga0157380_10342007
284 Ga0157380_10383230
285 Ga0157380_10785335
286 Ga0157380_12446572
287 Ga0157379_10409796
288 Ga0157379_11889071
289 Ga0207682_10001371
290 Ga0207642_10069593
291 Ga0207680_10037525
292 Ga0207645_10041030
293 Ga0207645_10619876
294 Ga0207643_10013549
295 Ga0207684_10847076
296 Ga0207681_10111041
297 Ga0207681_10756053
298 Ga0207650_10219157
299 Ga0207659_10043195
300 Ga0207659_11059823
301 Ga0207687_11597998
302 Ga0207700_10761593
303 Ga0207664_10040948
304 Ga0207706_10042750
305 Ga0207669_10498922
306 Ga0207669_11055499
307 Ga0207665_10257589
308 Ga0207665_11049772
309 Ga0207691_10076161
310 Ga0207691_10575519
311 Ga0207711_11066092
312 Ga0207689_10920147
313 Ga0207679_10682106
314 Ga0207651_10019582
315 Ga0207668_10325483
316 Ga0207658_10079716
317 Ga0207658_11459384
318 Ga0207703_11968035
319 Ga0207708_10070520
320 Ga0207702_11396181
321 Ga0207648_10078848
322 Ga0207676_10380778
323 Ga0207676_11977178
324 Ga0207675_100035735
325 Ga0207675_100210614
326 Ga0207683_10042273
327 Ga0209998_10071436
328 Ga0209974_10145530
329 Ga0207428_10368316
330 Ga0268265_12491634
331 Ga0268264_10430807
332 Ga0307408_102191208
333 Ga0307410_10055819
334 Ga0373941_0060427
335 Ga0373931_0667493
336 Ga0373933_0805765
337 Ga0373925_0249215
338 Ga0395901_0518852
339 Ga0453683_0971832
340 Ga0466963_0034374
341 Ga0451576_0039057
342 Ga0451576_0108046
343 Ga0451576_0226763
344 Ga0466967_0091691
345 Ga0495656_0386150
346 Ga0495674_0720152
347 Ga0496100_1217967
348 Ga0496109_0047947
349 Ga0496112_0177112
350 Ga0501037_0725813
351 Ga0501047_1348658
352 nmdc:mga05p37_125059_c1
353 nmdc:mga05p37_22399_c1
354 nmdc:mga05p37_23720_c1
355 nmdc:mga05p37_666690_c1
356 nmdc:mga05p37_93531_c1
357 nmdc:mga09592_34793_c1
358 nmdc:mga0qj67_532576_c1
359 nmdc:mga08y16_709171_c1
360 nmdc:mga0n895_24_c1
361 nmdc:mga0n895_260263_c1
362 nmdc:mga0n895_467058_c1
363 nmdc:mga0n895_801779_c1
364 nmdc:mga0rr50_1771_c1
365 nmdc:mga0rr50_207050_c1
366 nmdc:mga0rr50_5_c1
367 nmdc:mga08x19_77_c1
368 nmdc:mga0a205_135515_c1
369 nmdc:mga0a205_227470_c1
370 nmdc:mga0a205_621765_c1
371 Ga0590071_024497
372 Ga0590077_005019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cir-assembly1.cif.gz_A the ferm domain of human moesin with a bound peptide identified by phage display 0.7358 62 90
3fek-assembly2.cif.gz_B crystal structure of the r132k:y134f:r111l:l121d:t54v mutant of cellular retinoic acid-binding protein ii at 1.51 angstrom resolution 0.6894 59 90
4m7m-assembly1.cif.gz_A crystal structure of the r111k:r132q:y134f:t54v:r59w:a32w mutant of the cellular retinoic acid binding protein type ii in complex with all-trans retinal at 2.57 angstrom resolution 0.6861 59 90
7aa1-assembly1.cif.gz_AAA structural comparison of cellular retinoic acid binding proteins i and ii in the presence and absence of natural and synthetic ligands 0.6841 59 90
3fen-assembly2.cif.gz_B crystal structure of the r132k:r111l:a32e mutant of cellular retinoic acid-binding protein ii at 1.56 angstrom resolution 0.6799 59 90
ID Description Score Start End Superfamily
1zh1B01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;Hepatitis C NS5A, domain 1B 0.7391 63 92 2.20.25.210
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6943 63 94 2.30.29.30
af_Q55GN5_15_116_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6675 58 109 2.30.29.30
af_G5EGH4_653_740_2.60.40.1910 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6602 1 21 2.60.40.1910
af_Q61727_128_238_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6508 2 20 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V8I7N1-F1-model_v4 Uncharacterized protein 0.9793 1 113
AF-A0A382MWZ6-F1-model_v4 Uncharacterized protein 0.9541 1 113
AF-A0A7W1DPB9-F1-model_v4 DUF3194 domain-containing protein 0.9533 1 112
AF-A0A2E8E3B3-F1-model_v4 Uncharacterized protein 0.9315 1 116
AF-A0A1Q7NAD3-F1-model_v4 Uncharacterized protein 0.9294 1 123

Map