F285354

General Info

Members Datasets Scaffolds Average Seq Length
186 110 372 230

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10018075|Ga0065712_100180752
Length 244
Sequence VDLTHPAARRELEVRRLGTVKYADGLELQKQLVEERKAGRIPDQLLLLEHPPVITLGVRTRDDRSHVLAPPEVLERDGIELFETGRGGDVTFHGPGQLVGYPIIDLRPDRQDVHRYVRDLEEVMIRMAAGFGVQATRQPGLTGAWVDTAASGESPRWEKLAAIGVRISRWITSHGFAFNVTTNLDHFGLIVPCGITDRGVTSLERLLSRSVPMDEVEDAGVAAMADVFGRIALETTADGPTIRH

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
63 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
64 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
65 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
66 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
71 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
72 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
73 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
102 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
106 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
107 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
108 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
109 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
110 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 5.91
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10018075 3300005290 Bacteria 2413
2 JGI25406J46586_10000291 3300003203 Bacteria 22497
3 JGI25406J46586_10001443 3300003203 Bacteria 11210
4 Ga0065715_10097156 3300005293 Bacteria 3754
5 Ga0065715_10160763 3300005293 Bacteria 1628
6 Ga0065707_10111666 3300005295 Bacteria 2387
7 Ga0070683_100505940 3300005329 Bacteria 1154
8 Ga0070666_10312550 3300005335 Unclassified 1120
9 Ga0070669_100000965 3300005353 Bacteria 20996
10 Ga0070671_100658448 3300005355 Unclassified 907
11 Ga0070674_100348086 3300005356 Bacteria 1196
12 Ga0070673_100077506 3300005364 Bacteria 2686
13 Ga0070673_100571058 3300005364 Unclassified 1029
14 Ga0070663_100284731 3300005455 Bacteria 1318
15 Ga0070699_100224811 3300005518 Unclassified 1673
16 Ga0070704_100448814 3300005549 Bacteria 1110
17 Ga0068857_100130636 3300005577 Bacteria 2265
18 Ga0068866_10009753 3300005718 Bacteria 4089
19 Ga0068862_100050111 3300005844 Bacteria 3568
20 Ga0075364_10040859 3300006051 Bacteria 3009
21 Ga0075367_10077001 3300006178 Bacteria 2013
22 Ga0075367_10109424 3300006178 Bacteria 1695
23 Ga0097621_100000858 3300006237 Bacteria 21364
24 Ga0097621_100515706 3300006237 Bacteria 1084
25 Ga0068871_100314304 3300006358 Bacteria 1378
26 Ga0075428_100001682 3300006844 Bacteria 23571
27 Ga0075428_100018757 3300006844 Bacteria 7650
28 Ga0075428_100110446 3300006844 Bacteria 2995
29 Ga0075428_100697346 3300006844 Bacteria 1082
30 Ga0075428_100725907 3300006844 Unclassified 1058
31 Ga0075430_100026898 3300006846 Bacteria 4892
32 Ga0075430_100054207 3300006846 Bacteria 3375
33 Ga0075430_100699028 3300006846 Bacteria 836
34 Ga0075431_100052030 3300006847 Bacteria 4223
35 Ga0075431_100107383 3300006847 Bacteria 2880
36 Ga0075431_100175643 3300006847 Bacteria 2200
37 Ga0075431_100259680 3300006847 Bacteria 1763
38 Ga0075431_100343989 3300006847 Bacteria 1500
39 Ga0075431_100621697 3300006847 Bacteria 1062
40 Ga0075431_100640749 3300006847 Bacteria 1044
41 Ga0075433_10081802 3300006852 Bacteria 2848
42 Ga0075433_10114591 3300006852 Bacteria 2392
43 Ga0075434_100116507 3300006871 Bacteria 2685
44 Ga0075429_100010633 3300006880 Bacteria 7962
45 Ga0075429_100022910 3300006880 Bacteria 5414
46 Ga0075429_100485157 3300006880 Bacteria 1083
47 Ga0075436_100684703 3300006914 Bacteria 759
48 Ga0111539_10003266 3300009094 Bacteria 21438
49 Ga0111539_10009116 3300009094 Bacteria 12553
50 Ga0111539_10051692 3300009094 Bacteria 4893
51 Ga0111539_10125318 3300009094 Bacteria 3010
52 Ga0111539_10160275 3300009094 Bacteria 2631
53 Ga0114129_10000077 3300009147 Bacteria 90951
54 Ga0114129_10049675 3300009147 Bacteria 5893
55 Ga0114129_10182987 3300009147 Bacteria 2850
56 Ga0114129_10281130 3300009147 Bacteria 2223
57 Ga0105241_10413173 3300009174 Bacteria 1186
58 Ga0105249_10074140 3300009553 Bacteria 3149
59 Ga0105249_10131404 3300009553 Bacteria 2391
60 Ga0105249_10477567 3300009553 Bacteria 1289
61 Ga0105246_10029576 3300011119 Bacteria 3609
62 Ga0207697_10003258 3300025315 Bacteria 8070
63 Ga0207688_10008225 3300025901 Bacteria 5670
64 Ga0207680_10091449 3300025903 Bacteria 1936
65 Ga0207681_10013216 3300025923 Bacteria 5104
66 Ga0207650_10006710 3300025925 Bacteria 7849
67 Ga0207650_10811808 3300025925 Unclassified 793
68 Ga0207686_10008639 3300025934 Bacteria 5500
69 Ga0207669_10352940 3300025937 Bacteria 1137
70 Ga0207704_10475389 3300025938 Bacteria 1002
71 Ga0207711_10159801 3300025941 Bacteria 2038
72 Ga0207679_10524752 3300025945 Bacteria 1059
73 Ga0207651_10135819 3300025960 Bacteria 1891
74 Ga0207651_10518047 3300025960 Unclassified 1033
75 Ga0207712_10400756 3300025961 Bacteria 1153
76 Ga0207703_10112481 3300026035 Bacteria 2326
77 Ga0207641_10251692 3300026088 Bacteria 1650
78 Ga0207648_10029864 3300026089 Bacteria 4834
79 Ga0207648_10421673 3300026089 Bacteria 1212
80 Ga0207674_10158215 3300026116 Bacteria 2220
81 Ga0207428_10004134 3300027907 Bacteria 13914
82 Ga0207428_10032138 3300027907 Bacteria 4320
83 Ga0207428_10435520 3300027907 Bacteria 957
84 Ga0268266_10015541 3300028379 Bacteria 6527
85 Ga0268266_10197258 3300028379 Bacteria 1841
86 Ga0268265_10017832 3300028380 Bacteria 4909
87 Ga0307513_10153200 3300031456 Bacteria 2210
88 Ga0307408_100119078 3300031548 Bacteria 2042
89 Ga0307405_10117710 3300031731 Bacteria 1812
90 Ga0307405_10249423 3300031731 Bacteria 1320
91 Ga0307413_10105422 3300031824 Bacteria 1874
92 Ga0307413_10130762 3300031824 Bacteria 1718
93 Ga0307410_10121667 3300031852 Bacteria 1904
94 Ga0307410_10650732 3300031852 Bacteria 884
95 Ga0307407_10085615 3300031903 Bacteria 1918
96 Ga0307412_10269804 3300031911 Bacteria 1331
97 Ga0307409_101024023 3300031995 Bacteria 844
98 Ga0307416_100006197 3300032002 Bacteria 7461
99 Ga0307416_100078508 3300032002 Bacteria 2778
100 Ga0307416_100236883 3300032002 Bacteria 1765
101 Ga0307416_100337775 3300032002 Bacteria 1517
102 Ga0307416_100986099 3300032002 Bacteria 945
103 Ga0373935_0209635 3300035692 Bacteria 1350
104 Ga0439453_0082012 3300041408 Bacteria 697
105 Ga0439433_0022277 3300041999 Bacteria 1420
106 Ga0439450_003345 3300042008 Bacteria 2640
107 Ga0450898_019325 3300042134 Bacteria 1187
108 Ga0439464_0004390 3300042439 Bacteria 3606
109 Ga0439464_0161064 3300042439 Bacteria 705
110 Ga0451577_0324540 3300042876 Bacteria 1396
111 Ga0453683_0302663 3300044673 Bacteria 1023
112 Ga0451576_0041019 3300045051 Bacteria 4894
113 Ga0451576_0550084 3300045051 Bacteria 1213
114 Ga0495670_0174176 3300046691 Bacteria 1134
115 Ga0496102_0004432 3300048905 Bacteria 11859
116 Ga0496103_0051786 3300048906 Bacteria 2541
117 Ga0496105_0420415 3300048908 Bacteria 1058
118 Ga0496106_0074184 3300048909 Bacteria 2604
119 Ga0496106_0126660 3300048909 Bacteria 2000
120 Ga0496107_0150057 3300048910 Bacteria 1724
121 Ga0496108_0395332 3300048911 Bacteria 1207
122 Ga0496109_0020172 3300048912 Bacteria 5888
123 Ga0496110_0128863 3300048913 Bacteria 2284
124 Ga0496112_0030239 3300048915 Bacteria 5240
125 Ga0496113_0141677 3300048916 Bacteria 1892
126 Ga0501031_0045340 3300049568 Unclassified 2869
127 Ga0501033_0040935 3300049570 Bacteria 3459
128 Ga0501036_0035888 3300049572 Bacteria 4195
129 Ga0501040_0085803 3300049576 Unclassified 2185
130 Ga0501040_0093329 3300049576 Unclassified 2093
131 Ga0501042_0166260 3300049578 Bacteria 1592
132 Ga0501042_0193184 3300049578 Bacteria 1468
133 Ga0501048_0100638 3300049582 Bacteria 2039
134 Ga0501071_0020164 3300049587 Bacteria 4632
135 Ga0501072_0033460 3300049588 Bacteria 4028
136 Ga0501072_0420068 3300049588 Bacteria 1060
137 Ga0501073_0314631 3300049589 Bacteria 1080
138 Ga0501074_0051052 3300049590 Unclassified 2985
139 Ga0501074_0199106 3300049590 Unclassified 1428
140 Ga0501075_0345537 3300049591 Bacteria 1134
141 Ga0501076_0012385 3300049592 Bacteria 6374
142 Ga0501076_0224513 3300049592 Bacteria 1535
143 Ga0501079_0040428 3300049741 Bacteria 3597
144 Ga0501079_0131237 3300049741 Bacteria 1950
145 Ga0501080_0638121 3300049742 Bacteria 943
146 nmdc:mga06z11_149385_c1 3300050494 Bacteria 1327
147 nmdc:mga06z11_95530_c1 3300050494 Bacteria 1621
148 nmdc:mga05p37_166352_c1 3300050507 Bacteria 2691
149 nmdc:mga05p37_1796_c1 3300050507 Bacteria 25058
150 nmdc:mga05p37_565_c1 3300050507 Bacteria 40748
151 nmdc:mga09592_3321_c1 3300050508 Bacteria 13020
152 nmdc:mga09592_38945_c1 3300050508 Bacteria 3992
153 nmdc:mga09592_7387_c1 3300050508 Bacteria 8932
154 nmdc:mga0qj67_109465_c1 3300050509 Bacteria 2230
155 nmdc:mga0qj67_16668_c1 3300050509 Bacteria 5575
156 nmdc:mga0qj67_178718_c1 3300050509 Bacteria 1724
157 nmdc:mga06r32_117571_c1 3300050510 Bacteria 2620
158 nmdc:mga06r32_228677_c1 3300050510 Bacteria 1848
159 nmdc:mga06r32_445283_c1 3300050510 Bacteria 1275
160 nmdc:mga06r32_841154_c1 3300050510 Bacteria 877
161 nmdc:mga06r32_84436_c1 3300050510 Bacteria 3095
162 nmdc:mga06r32_86628_c1 3300050510 Bacteria 3055
163 nmdc:mga06r32_912172_c1 3300050510 Bacteria 835
164 nmdc:mga08y16_109157_c1 3300050511 Bacteria 2881
165 nmdc:mga08y16_318436_c1 3300050511 Bacteria 1602
166 nmdc:mga08y16_82134_c1 3300050511 Bacteria 3360
167 nmdc:mga08y16_83053_c1 3300050511 Bacteria 3339
168 nmdc:mga08y16_904041_c1 3300050511 Bacteria 869
169 nmdc:mga0n895_237648_c1 3300050512 Bacteria 1849
170 nmdc:mga0n895_239885_c1 3300050512 Bacteria 1839
171 nmdc:mga0n895_566114_c1 3300050512 Bacteria 1141
172 nmdc:mga0rr50_66052_c1 3300050513 Bacteria 2742
173 nmdc:mga0a205_286726_c1 3300050515 Bacteria 1521
174 nmdc:mga0a205_54703_c1 3300050515 Bacteria 3853
175 nmdc:mga0a205_68172_c1 3300050515 Bacteria 3436
176 Ga0501084_0011053 3300054114 Bacteria 7475
177 Ga0501084_0432379 3300054114 Bacteria 1113
178 Ga0590071_018540 3300059421 Bacteria 1636
179 Ga0590074_002306 3300059423 Bacteria 3130
180 Ga0590075_000070 3300059424 Bacteria 25688
181 Ga0590075_011084 3300059424 Bacteria 2176
182 Ga0590077_000229 3300059426 Bacteria 16179
183 Ga0501082_0225368 3300060353 Unclassified 1631
184 Ga0501082_0320499 3300060353 Bacteria 1350
185 Ga0530510_0014183 3300061734 Bacteria 5618
186 Ga0530510_0153331 3300061734 Unclassified 1702
187 Ga0065712_10018075
188 JGI25406J46586_10000291
189 JGI25406J46586_10001443
190 Ga0065715_10097156
191 Ga0065715_10160763
192 Ga0065707_10111666
193 Ga0070683_100505940
194 Ga0070666_10312550
195 Ga0070669_100000965
196 Ga0070671_100658448
197 Ga0070674_100348086
198 Ga0070673_100077506
199 Ga0070673_100571058
200 Ga0070663_100284731
201 Ga0070699_100224811
202 Ga0070704_100448814
203 Ga0068857_100130636
204 Ga0068866_10009753
205 Ga0068862_100050111
206 Ga0075364_10040859
207 Ga0075367_10077001
208 Ga0075367_10109424
209 Ga0097621_100000858
210 Ga0097621_100515706
211 Ga0068871_100314304
212 Ga0075428_100001682
213 Ga0075428_100018757
214 Ga0075428_100110446
215 Ga0075428_100697346
216 Ga0075428_100725907
217 Ga0075430_100026898
218 Ga0075430_100054207
219 Ga0075430_100699028
220 Ga0075431_100052030
221 Ga0075431_100107383
222 Ga0075431_100175643
223 Ga0075431_100259680
224 Ga0075431_100343989
225 Ga0075431_100621697
226 Ga0075431_100640749
227 Ga0075433_10081802
228 Ga0075433_10114591
229 Ga0075434_100116507
230 Ga0075429_100010633
231 Ga0075429_100022910
232 Ga0075429_100485157
233 Ga0075436_100684703
234 Ga0111539_10003266
235 Ga0111539_10009116
236 Ga0111539_10051692
237 Ga0111539_10125318
238 Ga0111539_10160275
239 Ga0114129_10000077
240 Ga0114129_10049675
241 Ga0114129_10182987
242 Ga0114129_10281130
243 Ga0105241_10413173
244 Ga0105249_10074140
245 Ga0105249_10131404
246 Ga0105249_10477567
247 Ga0105246_10029576
248 Ga0207697_10003258
249 Ga0207688_10008225
250 Ga0207680_10091449
251 Ga0207681_10013216
252 Ga0207650_10006710
253 Ga0207650_10811808
254 Ga0207686_10008639
255 Ga0207669_10352940
256 Ga0207704_10475389
257 Ga0207711_10159801
258 Ga0207679_10524752
259 Ga0207651_10135819
260 Ga0207651_10518047
261 Ga0207712_10400756
262 Ga0207703_10112481
263 Ga0207641_10251692
264 Ga0207648_10029864
265 Ga0207648_10421673
266 Ga0207674_10158215
267 Ga0207428_10004134
268 Ga0207428_10032138
269 Ga0207428_10435520
270 Ga0268266_10015541
271 Ga0268266_10197258
272 Ga0268265_10017832
273 Ga0307513_10153200
274 Ga0307408_100119078
275 Ga0307405_10117710
276 Ga0307405_10249423
277 Ga0307413_10105422
278 Ga0307413_10130762
279 Ga0307410_10121667
280 Ga0307410_10650732
281 Ga0307407_10085615
282 Ga0307412_10269804
283 Ga0307409_101024023
284 Ga0307416_100006197
285 Ga0307416_100078508
286 Ga0307416_100236883
287 Ga0307416_100337775
288 Ga0307416_100986099
289 Ga0373935_0209635
290 Ga0439453_0082012
291 Ga0439433_0022277
292 Ga0439450_003345
293 Ga0450898_019325
294 Ga0439464_0004390
295 Ga0439464_0161064
296 Ga0451577_0324540
297 Ga0453683_0302663
298 Ga0451576_0041019
299 Ga0451576_0550084
300 Ga0495670_0174176
301 Ga0496102_0004432
302 Ga0496103_0051786
303 Ga0496105_0420415
304 Ga0496106_0074184
305 Ga0496106_0126660
306 Ga0496107_0150057
307 Ga0496108_0395332
308 Ga0496109_0020172
309 Ga0496110_0128863
310 Ga0496112_0030239
311 Ga0496113_0141677
312 Ga0501031_0045340
313 Ga0501033_0040935
314 Ga0501036_0035888
315 Ga0501040_0085803
316 Ga0501040_0093329
317 Ga0501042_0166260
318 Ga0501042_0193184
319 Ga0501048_0100638
320 Ga0501071_0020164
321 Ga0501072_0033460
322 Ga0501072_0420068
323 Ga0501073_0314631
324 Ga0501074_0051052
325 Ga0501074_0199106
326 Ga0501075_0345537
327 Ga0501076_0012385
328 Ga0501076_0224513
329 Ga0501079_0040428
330 Ga0501079_0131237
331 Ga0501080_0638121
332 nmdc:mga06z11_149385_c1
333 nmdc:mga06z11_95530_c1
334 nmdc:mga05p37_166352_c1
335 nmdc:mga05p37_1796_c1
336 nmdc:mga05p37_565_c1
337 nmdc:mga09592_3321_c1
338 nmdc:mga09592_38945_c1
339 nmdc:mga09592_7387_c1
340 nmdc:mga0qj67_109465_c1
341 nmdc:mga0qj67_16668_c1
342 nmdc:mga0qj67_178718_c1
343 nmdc:mga06r32_117571_c1
344 nmdc:mga06r32_228677_c1
345 nmdc:mga06r32_445283_c1
346 nmdc:mga06r32_841154_c1
347 nmdc:mga06r32_84436_c1
348 nmdc:mga06r32_86628_c1
349 nmdc:mga06r32_912172_c1
350 nmdc:mga08y16_109157_c1
351 nmdc:mga08y16_318436_c1
352 nmdc:mga08y16_82134_c1
353 nmdc:mga08y16_83053_c1
354 nmdc:mga08y16_904041_c1
355 nmdc:mga0n895_237648_c1
356 nmdc:mga0n895_239885_c1
357 nmdc:mga0n895_566114_c1
358 nmdc:mga0rr50_66052_c1
359 nmdc:mga0a205_286726_c1
360 nmdc:mga0a205_54703_c1
361 nmdc:mga0a205_68172_c1
362 Ga0501084_0011053
363 Ga0501084_0432379
364 Ga0590071_018540
365 Ga0590074_002306
366 Ga0590075_000070
367 Ga0590075_011084
368 Ga0590077_000229
369 Ga0501082_0225368
370 Ga0501082_0320499
371 Ga0530510_0014183
372 Ga0530510_0153331

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

21

225

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9281 4 215
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9268 3 221
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9184 3 221
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8467 4 215
2dz9-assembly1.cif.gz_B crystal structure of biotin protein ligase from pyrococcus horikoshii complexed with biotinyl-5'-amp, mutation d104a 0.7875 5 216
ID Description Score Start End Superfamily
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9283 4 216 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9266 4 215 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9263 4 216 3.30.930.10
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.926 4 216 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9136 4 216 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A2V8CLH9-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9652 34 219 GO:0005737
GO:0033819
AF-A0A2V7YPL2-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9647 1 222 GO:0005737
GO:0016787
GO:0033819
AF-A0A7Y4MSP3-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9644 1 222 GO:0005737
GO:0016787
GO:0033819
AF-A0A2L2X8I3-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9634 2 221 GO:0005737
GO:0033819
AF-A0A7W1KWQ9-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9622 2 222 GO:0005737
GO:0033819

Map