F284800

General Info

Members Datasets Scaffolds Average Seq Length
185 103 370 173

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0263597|Ga0466961_0263597_178_774
Length 198
Sequence MTPLGPLEARSVLCPRVLEFELTSCNADYMITNELQERVTGWFAGRLPAEWQPADITIDREEITVVLTTADAELEGSEAALAEARAGRAAAFREETREQRMEIAQEAQHRFERKVSWGLAVGERRELWTHVSAPVMTRLRQPQRLVLDTLVEAGVARSRADALAWCVRLVGQHEEDWLGELREAMNAVADVRAKGPAA

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
4 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
5 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
21 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
22 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
32 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
39 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
40 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
50 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
51 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
52 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
57 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
58 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
59 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
60 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
75 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
76 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
77 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
78 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
79 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
80 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
87 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
88 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
89 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
90 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
91 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
92 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
93 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
94 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
96 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
97 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
98 2643221561 Nocardioides sp. Root151 Isolate Unclassified
99 2643221615 Nocardioides sp. Root224 Isolate Unclassified
100 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
101 2643221696 Nocardioides sp. Root140 Isolate Unclassified
102 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
103 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.73
Nodule 0
Rhizoplane 2.7
Rhizosphere 63.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0263597 3300044693 Bacteria 1056
2 Ga0070668_100110222 3300005347 Bacteria 2190
3 Ga0070668_101347000 3300005347 Bacteria 650
4 Ga0070708_100599862 3300005445 Bacteria 1038
5 Ga0070685_10151218 3300005466 Bacteria 1471
6 Ga0070707_100083694 3300005468 Bacteria 3083
7 Ga0070698_100015042 3300005471 Bacteria 8180
8 Ga0068856_101569201 3300005614 Bacteria 672
9 Ga0068860_100000253 3300005843 Bacteria 79802
10 Ga0075365_10001465 3300006038 Bacteria 10718
11 Ga0075365_10016863 3300006038 Bacteria 4456
12 Ga0075365_10055946 3300006038 Bacteria 2621
13 Ga0075365_10060791 3300006038 Bacteria 2521
14 Ga0075365_10082540 3300006038 Bacteria 2179
15 Ga0075365_10124574 3300006038 Bacteria 1780
16 Ga0075365_10143553 3300006038 Bacteria 1658
17 Ga0075365_10196387 3300006038 Bacteria 1413
18 Ga0075365_10318963 3300006038 Bacteria 1094
19 Ga0075365_10319382 3300006038 Bacteria 1094
20 Ga0075368_10000492 3300006042 Bacteria 11702
21 Ga0075368_10001186 3300006042 Bacteria 8222
22 Ga0075363_100002411 3300006048 Bacteria 7627
23 Ga0075363_100029898 3300006048 Bacteria 2816
24 Ga0075363_100033721 3300006048 Bacteria 2668
25 Ga0075363_100075243 3300006048 Bacteria 1839
26 Ga0075363_100316836 3300006048 Bacteria 907
27 Ga0075364_10042379 3300006051 Bacteria 2957
28 Ga0075364_10057012 3300006051 Bacteria 2558
29 Ga0075364_10173274 3300006051 Bacteria 1459
30 Ga0075362_10000593 3300006177 Bacteria 10622
31 Ga0075362_10269005 3300006177 Bacteria 841
32 Ga0075367_10009858 3300006178 Bacteria 5004
33 Ga0075367_10046310 3300006178 Bacteria 2555
34 Ga0075370_10007616 3300006353 Bacteria 5523
35 Ga0075370_10102685 3300006353 Bacteria 1656
36 Ga0075370_10162259 3300006353 Bacteria 1312
37 Ga0105243_11114286 3300009148 Bacteria 798
38 Ga0105243_11877550 3300009148 Bacteria 631
39 Ga0105238_10947036 3300009551 Bacteria 881
40 Ga0157369_11340679 3300013105 Bacteria 729
41 Ga0157375_10642319 3300013308 Bacteria 1218
42 Ga0157380_10589391 3300014326 Bacteria 1098
43 Ga0157377_10961027 3300014745 Bacteria 644
44 Ga0207707_10736522 3300025912 Bacteria 825
45 Ga0207709_10527582 3300025935 Bacteria 925
46 Ga0207691_10385588 3300025940 Bacteria 1196
47 Ga0207668_10071546 3300025972 Bacteria 2478
48 Ga0207658_10710566 3300025986 Bacteria 909
49 Ga0207677_10761215 3300026023 Bacteria 864
50 Ga0209813_10000424 3300027866 Bacteria 10316
51 Ga0268265_11320233 3300028380 Bacteria 722
52 Ga0268264_10000220 3300028381 Bacteria 111692
53 Ga0307405_10154270 3300031731 Bacteria 1619
54 Ga0307410_10118219 3300031852 Bacteria 1929
55 Ga0307410_10335937 3300031852 Bacteria 1203
56 Ga0307410_10446607 3300031852 Bacteria 1054
57 Ga0307406_10793844 3300031901 Bacteria 798
58 Ga0307407_10564482 3300031903 Bacteria 843
59 Ga0307412_10043115 3300031911 Bacteria 2936
60 Ga0307412_10068901 3300031911 Bacteria 2407
61 Ga0307409_100004371 3300031995 Bacteria 7930
62 Ga0307409_100102584 3300031995 Bacteria 2377
63 Ga0307409_100176814 3300031995 Bacteria 1885
64 Ga0307409_100525250 3300031995 Bacteria 1157
65 Ga0307409_100774762 3300031995 Bacteria 965
66 Ga0307409_100875353 3300031995 Bacteria 910
67 Ga0307416_100010760 3300032002 Bacteria 6061
68 Ga0307416_100251287 3300032002 Bacteria 1721
69 Ga0307414_11133438 3300032004 Bacteria 723
70 Ga0316584_0016491 3300036712 Bacteria 5295
71 Ga0395900_0075210 3300037418 Bacteria 3472
72 Ga0395898_0167774 3300037466 Bacteria 2099
73 Ga0395898_0174667 3300037466 Bacteria 2053
74 Ga0395905_0439610 3300037471 Bacteria 1202
75 Ga0395901_0126697 3300038443 Bacteria 2683
76 Ga0451804_0454005 3300041463 Bacteria 593
77 Ga0451853_1002813 3300041512 Bacteria 3062
78 Ga0466965_0019797 3300044683 Bacteria 3232
79 Ga0466966_0009032 3300044684 Bacteria 6604
80 Ga0466966_0210276 3300044684 Bacteria 1176
81 Ga0466961_0012623 3300044693 Bacteria 5411
82 Ga0466961_0432396 3300044693 Bacteria 797
83 Ga0466961_0698004 3300044693 Bacteria 608
84 Ga0466971_0023412 3300044719 Bacteria 2753
85 Ga0466971_0421431 3300044719 Bacteria 652
86 Ga0466968_0278227 3300044735 Bacteria 800
87 Ga0466970_0447266 3300044765 Bacteria 740
88 Ga0466970_0496067 3300044765 Bacteria 703
89 Ga0466970_0575136 3300044765 Bacteria 652
90 Ga0466957_0018936 3300044842 Bacteria 4046
91 Ga0466957_0084123 3300044842 Bacteria 1985
92 Ga0466960_0010329 3300044901 Bacteria 3874
93 Ga0466960_0013414 3300044901 Bacteria 3482
94 Ga0466960_0018125 3300044901 Bacteria 3080
95 Ga0466960_0479432 3300044901 Bacteria 726
96 Ga0466959_0044641 3300045049 Bacteria 3265
97 Ga0466959_0109922 3300045049 Bacteria 1968
98 Ga0466959_0744869 3300045049 Bacteria 656
99 Ga0466958_0177866 3300045836 Bacteria 1349
100 Ga0466958_0268262 3300045836 Bacteria 1093
101 Ga0466967_0120924 3300045976 Bacteria 2419
102 Ga0466967_0908714 3300045976 Bacteria 876
103 Ga0496102_0707869 3300048905 Bacteria 930
104 Ga0496107_0103011 3300048910 Bacteria 2094
105 Ga0496109_1323493 3300048912 Bacteria 656
106 Ga0496114_0505541 3300048917 Bacteria 1069
107 Ga0501031_0135643 3300049568 Bacteria 1608
108 Ga0501033_0153866 3300049570 Bacteria 1658
109 Ga0501034_1310607 3300049571 Bacteria 601
110 Ga0501036_0081031 3300049572 Bacteria 2743
111 Ga0501036_0595005 3300049572 Bacteria 918
112 Ga0501036_0682532 3300049572 Bacteria 849
113 Ga0501037_0160078 3300049573 Bacteria 1605
114 Ga0501038_0023025 3300049574 Bacteria 5576
115 Ga0501039_0012285 3300049575 Bacteria 6530
116 Ga0501039_0161001 3300049575 Bacteria 1764
117 Ga0501040_0226482 3300049576 Bacteria 1331
118 Ga0501040_1010128 3300049576 Bacteria 603
119 Ga0501041_0014984 3300049577 Bacteria 4604
120 Ga0501041_0268429 3300049577 Bacteria 1073
121 Ga0501041_0510119 3300049577 Bacteria 765
122 Ga0501042_0228102 3300049578 Bacteria 1343
123 Ga0501042_0571427 3300049578 Bacteria 822
124 Ga0501043_0883186 3300049579 Bacteria 642
125 Ga0501046_0794457 3300049580 Bacteria 663
126 Ga0501048_0014878 3300049582 Bacteria 5753
127 Ga0501068_0237909 3300049584 Bacteria 1159
128 Ga0501069_0078287 3300049585 Bacteria 1859
129 Ga0501069_0401911 3300049585 Bacteria 811
130 Ga0501070_0045086 3300049586 Bacteria 3668
131 Ga0501070_0173192 3300049586 Bacteria 1777
132 Ga0501070_0277123 3300049586 Bacteria 1369
133 Ga0501072_0009562 3300049588 Bacteria 7373
134 Ga0501072_0160116 3300049588 Bacteria 1796
135 Ga0501073_0081008 3300049589 Bacteria 2258
136 Ga0501073_0654262 3300049589 Bacteria 725
137 Ga0501074_0205941 3300049590 Bacteria 1402
138 Ga0501074_0291169 3300049590 Bacteria 1160
139 Ga0501076_0056348 3300049592 Bacteria 3119
140 Ga0501076_0095166 3300049592 Bacteria 2399
141 Ga0501076_0181889 3300049592 Bacteria 1714
142 Ga0501079_0302994 3300049741 Bacteria 1250
143 Ga0501080_0086841 3300049742 Bacteria 2907
144 Ga0501080_0168526 3300049742 Bacteria 2021
145 Ga0501083_0148422 3300049744 Bacteria 1535
146 Ga0501045_0025474 3300049824 Bacteria 4253
147 nmdc:mga03683_304310_c1 3300050489 Bacteria 748
148 nmdc:mga03683_490185_c1 3300050489 Bacteria 594
149 nmdc:mga03683_8731_c1 3300050489 Bacteria 3574
150 nmdc:mga03n38_121021_c1 3300050490 Bacteria 1286
151 nmdc:mga03n38_174771_c1 3300050490 Bacteria 1097
152 nmdc:mga03n38_190751_c1 3300050490 Bacteria 1056
153 nmdc:mga03n38_22654_c1 3300050490 Bacteria 2545
154 nmdc:mga03n38_321271_c1 3300050490 Bacteria 836
155 nmdc:mga00v17_14860_c1 3300050491 Bacteria 4355
156 nmdc:mga00v17_54089_c1 3300050491 Bacteria 1474
157 nmdc:mga00v17_59156_c1 3300050491 Bacteria 2350
158 nmdc:mga0yw44_1020_c1 3300050492 Bacteria 10725
159 nmdc:mga0yw44_18047_c1 3300050492 Bacteria 3857
160 nmdc:mga0yw44_21056_c1 3300050492 Bacteria 3631
161 nmdc:mga0yw44_219301_c1 3300050492 Bacteria 1260
162 nmdc:mga0yw44_43257_c1 3300050492 Bacteria 2688
163 nmdc:mga0yw44_43623_c1 3300050492 Bacteria 2678
164 nmdc:mga0yw44_58067_c1 3300050492 Bacteria 2363
165 nmdc:mga06z11_32181_c1 3300050494 Bacteria 2555
166 nmdc:mga07m45_21145_c1 3300050496 Bacteria 3540
167 nmdc:mga07m45_349512_c1 3300050496 Bacteria 859
168 nmdc:mga07m45_85809_c1 3300050496 Bacteria 1800
169 nmdc:mga07m45_9059_c1 3300050496 Bacteria 5143
170 Ga0495655_0253717 3300053083 Bacteria 592
171 Ga0500641_0005229 3300053096 Bacteria 4598
172 Ga0500556_0000624 3300053104 Bacteria 22434
173 Ga0500593_000158 3300053117 Bacteria 27194
174 Ga0500573_0283814 3300053140 Bacteria 836
175 Ga0501084_0039450 3300054114 Bacteria 3950
176 Ga0501084_0214466 3300054114 Bacteria 1624
177 Ga0501082_0266489 3300060353 Bacteria 1491
178 Ga0501082_1281196 3300060353 Bacteria 640
179 Ga0466962_0060483 3300061719 Bacteria 1808
180 2643825546 2643221561 Bacteria 4984412
181 2644090322 2643221615 Bacteria 5487866
182 2644320168 2643221657 Bacteria 5490246
183 2644531542 2643221696 Bacteria 5431823
184 2645721162 2643221961 Bacteria 3919167
185 2857484416 2857481737 Bacteria 4761446
186 Ga0466961_0263597
187 Ga0070668_100110222
188 Ga0070668_101347000
189 Ga0070708_100599862
190 Ga0070685_10151218
191 Ga0070707_100083694
192 Ga0070698_100015042
193 Ga0068856_101569201
194 Ga0068860_100000253
195 Ga0075365_10001465
196 Ga0075365_10016863
197 Ga0075365_10055946
198 Ga0075365_10060791
199 Ga0075365_10082540
200 Ga0075365_10124574
201 Ga0075365_10143553
202 Ga0075365_10196387
203 Ga0075365_10318963
204 Ga0075365_10319382
205 Ga0075368_10000492
206 Ga0075368_10001186
207 Ga0075363_100002411
208 Ga0075363_100029898
209 Ga0075363_100033721
210 Ga0075363_100075243
211 Ga0075363_100316836
212 Ga0075364_10042379
213 Ga0075364_10057012
214 Ga0075364_10173274
215 Ga0075362_10000593
216 Ga0075362_10269005
217 Ga0075367_10009858
218 Ga0075367_10046310
219 Ga0075370_10007616
220 Ga0075370_10102685
221 Ga0075370_10162259
222 Ga0105243_11114286
223 Ga0105243_11877550
224 Ga0105238_10947036
225 Ga0157369_11340679
226 Ga0157375_10642319
227 Ga0157380_10589391
228 Ga0157377_10961027
229 Ga0207707_10736522
230 Ga0207709_10527582
231 Ga0207691_10385588
232 Ga0207668_10071546
233 Ga0207658_10710566
234 Ga0207677_10761215
235 Ga0209813_10000424
236 Ga0268265_11320233
237 Ga0268264_10000220
238 Ga0307405_10154270
239 Ga0307410_10118219
240 Ga0307410_10335937
241 Ga0307410_10446607
242 Ga0307406_10793844
243 Ga0307407_10564482
244 Ga0307412_10043115
245 Ga0307412_10068901
246 Ga0307409_100004371
247 Ga0307409_100102584
248 Ga0307409_100176814
249 Ga0307409_100525250
250 Ga0307409_100774762
251 Ga0307409_100875353
252 Ga0307416_100010760
253 Ga0307416_100251287
254 Ga0307414_11133438
255 Ga0316584_0016491
256 Ga0395900_0075210
257 Ga0395898_0167774
258 Ga0395898_0174667
259 Ga0395905_0439610
260 Ga0395901_0126697
261 Ga0451804_0454005
262 Ga0451853_1002813
263 Ga0466965_0019797
264 Ga0466966_0009032
265 Ga0466966_0210276
266 Ga0466961_0012623
267 Ga0466961_0432396
268 Ga0466961_0698004
269 Ga0466971_0023412
270 Ga0466971_0421431
271 Ga0466968_0278227
272 Ga0466970_0447266
273 Ga0466970_0496067
274 Ga0466970_0575136
275 Ga0466957_0018936
276 Ga0466957_0084123
277 Ga0466960_0010329
278 Ga0466960_0013414
279 Ga0466960_0018125
280 Ga0466960_0479432
281 Ga0466959_0044641
282 Ga0466959_0109922
283 Ga0466959_0744869
284 Ga0466958_0177866
285 Ga0466958_0268262
286 Ga0466967_0120924
287 Ga0466967_0908714
288 Ga0496102_0707869
289 Ga0496107_0103011
290 Ga0496109_1323493
291 Ga0496114_0505541
292 Ga0501031_0135643
293 Ga0501033_0153866
294 Ga0501034_1310607
295 Ga0501036_0081031
296 Ga0501036_0595005
297 Ga0501036_0682532
298 Ga0501037_0160078
299 Ga0501038_0023025
300 Ga0501039_0012285
301 Ga0501039_0161001
302 Ga0501040_0226482
303 Ga0501040_1010128
304 Ga0501041_0014984
305 Ga0501041_0268429
306 Ga0501041_0510119
307 Ga0501042_0228102
308 Ga0501042_0571427
309 Ga0501043_0883186
310 Ga0501046_0794457
311 Ga0501048_0014878
312 Ga0501068_0237909
313 Ga0501069_0078287
314 Ga0501069_0401911
315 Ga0501070_0045086
316 Ga0501070_0173192
317 Ga0501070_0277123
318 Ga0501072_0009562
319 Ga0501072_0160116
320 Ga0501073_0081008
321 Ga0501073_0654262
322 Ga0501074_0205941
323 Ga0501074_0291169
324 Ga0501076_0056348
325 Ga0501076_0095166
326 Ga0501076_0181889
327 Ga0501079_0302994
328 Ga0501080_0086841
329 Ga0501080_0168526
330 Ga0501083_0148422
331 Ga0501045_0025474
332 nmdc:mga03683_304310_c1
333 nmdc:mga03683_490185_c1
334 nmdc:mga03683_8731_c1
335 nmdc:mga03n38_121021_c1
336 nmdc:mga03n38_174771_c1
337 nmdc:mga03n38_190751_c1
338 nmdc:mga03n38_22654_c1
339 nmdc:mga03n38_321271_c1
340 nmdc:mga00v17_14860_c1
341 nmdc:mga00v17_54089_c1
342 nmdc:mga00v17_59156_c1
343 nmdc:mga0yw44_1020_c1
344 nmdc:mga0yw44_18047_c1
345 nmdc:mga0yw44_21056_c1
346 nmdc:mga0yw44_219301_c1
347 nmdc:mga0yw44_43257_c1
348 nmdc:mga0yw44_43623_c1
349 nmdc:mga0yw44_58067_c1
350 nmdc:mga06z11_32181_c1
351 nmdc:mga07m45_21145_c1
352 nmdc:mga07m45_349512_c1
353 nmdc:mga07m45_85809_c1
354 nmdc:mga07m45_9059_c1
355 Ga0495655_0253717
356 Ga0500641_0005229
357 Ga0500556_0000624
358 Ga0500593_000158
359 Ga0500573_0283814
360 Ga0501084_0039450
361 Ga0501084_0214466
362 Ga0501082_0266489
363 Ga0501082_1281196
364 Ga0466962_0060483
365 2643825546
366 2644090322
367 2644320168
368 2644531542
369 2645721162
370 2857484416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pnw-assembly1.cif.gz_C mouse mitochondrial ribosome small subunit lacking m5u modification 0.5889 2 120
7nql-assembly1.cif.gz_AC 55s mammalian mitochondrial ribosome with ict1 and p site trnamet 0.5809 1 120
7jil-assembly1.cif.gz_h 70s ribosome flavobacterium johnsoniae 0.5802 1 114
5xyi-assembly1.cif.gz_D small subunit of trichomonas vaginalis ribosome 0.5749 3 114
6okk-assembly1.cif.gz_J cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit 0.5641 34 111
ID Description Score Start End Superfamily
af_Q58597_180_485_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7641 83 115 3.30.930.10
af_Q557I0_73_177_3.30.750.80 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;RNA methyltransferase domain (HRMD) like 0.6678 32 118 3.30.750.80
3prbA03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6477 14 115 3.30.70.2210
af_P23003_45_186_2.40.50.1070 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6273 34 118 2.40.50.1070
3ieyA02 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.6255 91 119 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A535R4G1-F1-model_v4 Uncharacterized protein 0.8981 10 121
AF-A0A536KFK1-F1-model_v4 Uncharacterized protein 0.8796 12 121
AF-A0A535EME4-F1-model_v4 Uncharacterized protein 0.8594 58 121
AF-A0A535M9E4-F1-model_v4 Uncharacterized protein 0.8585 12 120
AF-A0A535K446-F1-model_v4 Uncharacterized protein 0.8545 11 124

Map