F284650

General Info

Members Datasets Scaffolds Average Seq Length
185 130 184 177

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0121313|Ga0373927_0121313_292_894
Length 200
Sequence MLTRAKQKILRRSHPAPHLLHHPGAQMPDPRYPIGKFHFDGPPTPDQRTQLIANIEQAPAALRAAVAGLSPQQLDTPYREGGWTVRQVTHHVPDSHMNAYVRFKLALTEDEPTIKPYAEDRWAQLGDTQATPVEVSLAMLESLHTRWVQLLRSLKPADWKRNFNHPEAGVMSLEKSLALYSWHGKHHVAHVTELRKRMGW

Samples

Sample ID Description Type Environment
1 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
109 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
116 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
117 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
118 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
119 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 1.62
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 1.62
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10178703 3300003316 Bacteria 2254
2 rootL2_10266048 3300003322 Bacteria 1409
3 rootH1_10311472 3300003323 Unclassified 2395
4 Ga0055531_10000197 3300003794 Bacteria 66822
5 Ga0070680_100113731 3300005336 Bacteria 2255
6 Ga0070709_10000788 3300005434 Bacteria 17716
7 Ga0070714_100003711 3300005435 Bacteria 11439
8 Ga0070713_100016490 3300005436 Bacteria 5555
9 Ga0070713_100068709 3300005436 Unclassified 2986
10 Ga0070713_100722193 3300005436 Bacteria 952
11 Ga0070713_100974975 3300005436 Bacteria 817
12 Ga0070710_10375589 3300005437 Unclassified 947
13 Ga0070711_100000045 3300005439 Bacteria 79766
14 Ga0070711_100149842 3300005439 Bacteria 1758
15 Ga0070705_100000077 3300005440 Bacteria 53477
16 Ga0070705_100679768 3300005440 Unclassified 806
17 Ga0070705_100724972 3300005440 Bacteria 783
18 Ga0070708_100004737 3300005445 Bacteria 10718
19 Ga0070708_100077546 3300005445 Bacteria 3003
20 Ga0070706_100001521 3300005467 Bacteria 24331
21 Ga0070706_100348529 3300005467 Bacteria 1380
22 Ga0070707_100411491 3300005468 Bacteria 1313
23 Ga0070698_100320668 3300005471 Bacteria 1480
24 Ga0070699_100000004 3300005518 Bacteria 404262
25 Ga0070699_100005575 3300005518 Bacteria 11039
26 Ga0070684_100342209 3300005535 Unclassified 1375
27 Ga0070697_100090489 3300005536 Unclassified 2529
28 Ga0070697_100455196 3300005536 Bacteria 1115
29 Ga0068853_100463620 3300005539 Bacteria 1193
30 Ga0070695_100060727 3300005545 Unclassified 2450
31 Ga0070696_100000002 3300005546 Bacteria 168761
32 Ga0070696_100001456 3300005546 Bacteria 15487
33 Ga0070693_100000280 3300005547 Bacteria 23961
34 Ga0070704_100023416 3300005549 Bacteria 4034
35 Ga0070704_100864567 3300005549 Bacteria 811
36 Ga0068860_100007501 3300005843 Bacteria 10911
37 Ga0068862_100000889 3300005844 Bacteria 29075
38 Ga0070717_10042350 3300006028 Bacteria 3714
39 Ga0070717_10053603 3300006028 Bacteria 3325
40 Ga0070717_10318737 3300006028 Bacteria 1385
41 Ga0070712_101258862 3300006175 Unclassified 644
42 Ga0097621_100740317 3300006237 Unclassified 907
43 Ga0068871_100396501 3300006358 Unclassified 1228
44 Ga0075428_100120105 3300006844 Bacteria 2861
45 Ga0075428_100134614 3300006844 Bacteria 2687
46 Ga0075430_100739324 3300006846 Bacteria 811
47 Ga0075431_100890095 3300006847 Unclassified 860
48 Ga0075433_10109057 3300006852 Bacteria 2456
49 Ga0075434_100020198 3300006871 Bacteria 6455
50 Ga0075434_100072828 3300006871 Bacteria 3428
51 Ga0075429_101138886 3300006880 Bacteria 681
52 Ga0075436_100007659 3300006914 Bacteria 7379
53 Ga0075436_100024273 3300006914 Unclassified 4167
54 Ga0075436_100065148 3300006914 Bacteria 2519
55 Ga0075436_100164214 3300006914 Unclassified 1566
56 Ga0075436_100217728 3300006914 Bacteria 1354
57 Ga0075436_100761635 3300006914 Unclassified 719
58 Ga0075435_100126030 3300007076 Bacteria 2140
59 Ga0075435_100770204 3300007076 Bacteria 837
60 Ga0099794_10382315 3300007265 Unclassified 734
61 Ga0105240_10238327 3300009093 Unclassified 2110
62 Ga0111539_10000013 3300009094 Bacteria 309567
63 Ga0111539_10951392 3300009094 Unclassified 999
64 Ga0114129_10028908 3300009147 Bacteria 7853
65 Ga0114129_10105133 3300009147 Bacteria 3902
66 Ga0114129_10766460 3300009147 Bacteria 1234
67 Ga0105237_10359528 3300009545 Unclassified 1460
68 Ga0105238_10138665 3300009551 Bacteria 2409
69 Ga0157373_10059046 3300013100 Unclassified 2718
70 Ga0157369_10056759 3300013105 Unclassified 4225
71 Ga0157369_10183990 3300013105 Unclassified 2197
72 Ga0157378_11338821 3300013297 Unclassified 758
73 Ga0157372_10540056 3300013307 Bacteria 1359
74 Ga0213875_10012417 3300021388 Unclassified 4211
75 Ga0224572_1001084 3300024225 Bacteria 3818
76 Ga0209257_1000006 3300025304 Bacteria 1570111
77 Ga0207653_10000153 3300025885 Bacteria 48484
78 Ga0207692_10071376 3300025898 Bacteria 1831
79 Ga0207699_10000023 3300025906 Bacteria 172262
80 Ga0207699_10137349 3300025906 Bacteria 1603
81 Ga0207643_10127713 3300025908 Unclassified 1510
82 Ga0207684_10000405 3300025910 Bacteria 57735
83 Ga0207695_10481967 3300025913 Bacteria 1123
84 Ga0207663_10000003 3300025916 Bacteria 458807
85 Ga0207663_10026693 3300025916 Bacteria 3356
86 Ga0207660_10011933 3300025917 Bacteria 5672
87 Ga0207694_10703272 3300025924 Unclassified 852
88 Ga0207700_10008033 3300025928 Bacteria 6506
89 Ga0207700_10008657 3300025928 Bacteria 6318
90 Ga0207700_10441828 3300025928 Bacteria 1145
91 Ga0207700_10660722 3300025928 Bacteria 932
92 Ga0207700_10847334 3300025928 Bacteria 818
93 Ga0207664_10066305 3300025929 Bacteria 2893
94 Ga0207665_10248166 3300025939 Bacteria 1314
95 Ga0207667_10077160 3300025949 Bacteria 3456
96 Ga0207639_10882096 3300026041 Unclassified 836
97 Ga0207702_10024456 3300026078 Bacteria 5012
98 Ga0207428_10000017 3300027907 Bacteria 309575
99 Ga0268265_10000416 3300028380 Bacteria 45800
100 Ga0268264_10005156 3300028381 Bacteria 11072
101 Ga0265325_10019903 3300031241 Unclassified 3705
102 Ga0265339_10084070 3300031249 Bacteria 1678
103 Ga0265342_10403920 3300031712 Unclassified 705
104 Ga0307405_10000851 3300031731 Bacteria 12035
105 Ga0307405_10416797 3300031731 Bacteria 1055
106 Ga0307413_10001748 3300031824 Bacteria 8492
107 Ga0307413_11048392 3300031824 Unclassified 701
108 Ga0307410_10009466 3300031852 Bacteria 5462
109 Ga0307410_10010929 3300031852 Bacteria 5167
110 Ga0307406_10016906 3300031901 Bacteria 4245
111 Ga0307406_10131528 3300031901 Unclassified 1757
112 Ga0307407_10042557 3300031903 Bacteria 2547
113 Ga0307412_10109907 3300031911 Bacteria 1966
114 Ga0307412_10299941 3300031911 Unclassified 1269
115 Ga0307409_100031059 3300031995 Bacteria 3848
116 Ga0307409_100031822 3300031995 Bacteria 3814
117 Ga0307416_100052885 3300032002 Bacteria 3254
118 Ga0307416_102839487 3300032002 Bacteria 579
119 Ga0307414_10013954 3300032004 Bacteria 4799
120 Ga0307414_10066346 3300032004 Bacteria 2579
121 Ga0307411_10001466 3300032005 Bacteria 9677
122 Ga0307411_10006909 3300032005 Bacteria 5722
123 Ga0307415_100001966 3300032126 Bacteria 10108
124 Ga0307415_100105714 3300032126 Bacteria 2076
125 Ga0316583_10001712 3300032133 Bacteria 7456
126 Ga0373926_0190595 3300035083 Bacteria 788
127 Ga0373923_0044200 3300035111 Bacteria 1846
128 Ga0373943_0657074 3300035170 Bacteria 620
129 Ga0373961_0002912 3300035241 Unclassified 4339
130 Ga0373927_0024828 3300035695 Bacteria 3917
131 Ga0373927_0121313 3300035695 Bacteria 1706
132 Ga0373937_0133189 3300036401 Unclassified 2323
133 Ga0373937_1532719 3300036401 Unclassified 614
134 Ga0373925_0092592 3300037068 Bacteria 2312
135 Ga0451807_2279752 3300041486 Unclassified 2397
136 Ga0453683_0208278 3300044673 Unclassified 1242
137 Ga0453683_0500556 3300044673 Bacteria 788
138 Ga0466961_0466836 3300044693 Bacteria 763
139 Ga0466963_0054413 3300044694 Unclassified 2660
140 Ga0453684_1020215 3300044712 Unclassified 879
141 Ga0466957_0000662 3300044842 Bacteria 17489
142 Ga0466957_0116067 3300044842 Bacteria 1703
143 Ga0451576_1176673 3300045051 Bacteria 801
144 Ga0495580_0103254 3300046472 Bacteria 1981
145 Ga0495605_0332539 3300046474 Unclassified 639
146 Ga0495630_0230384 3300046517 Bacteria 1415
147 Ga0495654_0134331 3300046530 Unclassified 1108
148 Ga0495665_0047381 3300046531 Bacteria 2279
149 Ga0496102_0012708 3300048905 Bacteria 7293
150 Ga0496112_0092550 3300048915 Bacteria 2993
151 Ga0501306_042735 3300049127 Unclassified 707
152 Ga0501308_012365 3300049128 Unclassified 974
153 Ga0501296_003251 3300049519 Bacteria 1729
154 Ga0501312_016317 3300049528 Bacteria 1061
155 Ga0501046_0060905 3300049580 Bacteria 2953
156 Ga0501046_0717036 3300049580 Bacteria 704
157 Ga0501048_0308988 3300049582 Unclassified 1125
158 Ga0501069_0406094 3300049585 Bacteria 806
159 Ga0501076_0031291 3300049592 Bacteria 4149
160 Ga0501077_0117353 3300049593 Unclassified 1687
161 Ga0501207_005825 3300049654 Bacteria 1715
162 Ga0501242_017952 3300049674 Unclassified 896
163 Ga0501256_018596 3300049685 Bacteria 716
164 Ga0501257_005681 3300049686 Bacteria 2755
165 Ga0501225_0014309 3300049705 Bacteria 2217
166 Ga0501079_0140289 3300049741 Bacteria 1883
167 Ga0501080_0758567 3300049742 Unclassified 853
168 Ga0501081_0049981 3300049743 Bacteria 2880
169 Ga0501081_0457652 3300049743 Bacteria 948
170 nmdc:mga05p37_120289_c1 3300050507 Bacteria 3226
171 nmdc:mga05p37_1238249_c1 3300050507 Unclassified 767
172 nmdc:mga05p37_435_c1 3300050507 Bacteria 45317
173 nmdc:mga05p37_874991_c1 3300050507 Unclassified 972
174 nmdc:mga09592_53184_c1 3300050508 Bacteria 3418
175 nmdc:mga06r32_851725_c1 3300050510 Unclassified 870
176 nmdc:mga08y16_19_c1 3300050511 Bacteria 309575
177 nmdc:mga0n895_1153497_c1 3300050512 Unclassified 750
178 nmdc:mga0n895_18182_c1 3300050512 Bacteria 6498
179 nmdc:mga0rr50_109168_c1 3300050513 Bacteria 2187
180 nmdc:mga08x19_10_c1 3300050514 Bacteria 404490
181 nmdc:mga08x19_152496_c1 3300050514 Unclassified 1566
182 nmdc:mga08x19_37518_c1 3300050514 Unclassified 3076
183 nmdc:mga08x19_45369_c1 3300050514 Bacteria 2809
184 nmdc:mga0a205_17680_c1 3300050515 Bacteria 6692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_1153497_c1 nmdc:mga0n895_1153497_c1_132_623 162
2 3300049743 Ga0501081_0457652 Ga0501081_0457652_438_932 163
3 3300036401 Ga0373937_1532719 Ga0373937_1532719_81_599 164
4 iso_pu_bacteria 2857604169 2857604852 168
5 3300006846 Ga0075430_100739324 Ga0075430_1007393241 169
6 3300009147 Ga0114129_10105133 Ga0114129_101051332 169
7 3300009147 Ga0114129_10766460 Ga0114129_107664603 169
8 3300050507 nmdc:mga05p37_120289_c1 nmdc:mga05p37_120289_c1_1900_2412 169
9 3300031731 Ga0307405_10416797 Ga0307405_104167972 170
10 3300031824 Ga0307413_10001748 Ga0307413_100017484 170
11 3300031852 Ga0307410_10010929 Ga0307410_100109293 170
12 3300031901 Ga0307406_10016906 Ga0307406_100169063 170
13 3300031903 Ga0307407_10042557 Ga0307407_100425573 170
14 3300031911 Ga0307412_10109907 Ga0307412_101099073 170
15 3300031995 Ga0307409_100031822 Ga0307409_1000318223 170
16 3300032002 Ga0307416_100052885 Ga0307416_1000528856 170
17 3300032004 Ga0307414_10066346 Ga0307414_100663462 170
18 3300032005 Ga0307411_10001466 Ga0307411_100014668 170
19 3300032126 Ga0307415_100105714 Ga0307415_1001057142 170
20 3300049685 Ga0501256_018596 Ga0501256_018596_123_656 170
21 3300009094 Ga0111539_10951392 Ga0111539_109513922 171
22 3300005434 Ga0070709_10000788 Ga0070709_100007888 172
23 3300025906 Ga0207699_10000023 Ga0207699_1000002312 172
24 3300025928 Ga0207700_10847334 Ga0207700_108473341 172
25 3300025939 Ga0207665_10248166 Ga0207665_102481662 172
26 3300046474 Ga0495605_0332539 Ga0495605_0332539_49_570 172
27 3300046530 Ga0495654_0134331 Ga0495654_0134331_373_894 172
28 3300005336 Ga0070680_100113731 Ga0070680_1001137311 173
29 3300005435 Ga0070714_100003711 Ga0070714_1000037116 173
30 3300005436 Ga0070713_100016490 Ga0070713_1000164902 173
31 3300005436 Ga0070713_100068709 Ga0070713_1000687093 173
32 3300005436 Ga0070713_100722193 Ga0070713_1007221932 173
33 3300005436 Ga0070713_100974975 Ga0070713_1009749752 173
34 3300005437 Ga0070710_10375589 Ga0070710_103755891 173
35 3300005439 Ga0070711_100000045 Ga0070711_10000004555 173
36 3300005439 Ga0070711_100149842 Ga0070711_1001498422 173
37 3300005440 Ga0070705_100679768 Ga0070705_1006797682 173
38 3300005445 Ga0070708_100004737 Ga0070708_10000473710 173
39 3300005467 Ga0070706_100001521 Ga0070706_10000152121 173
40 3300005467 Ga0070706_100348529 Ga0070706_1003485292 173
41 3300005468 Ga0070707_100411491 Ga0070707_1004114912 173
42 3300005471 Ga0070698_100320668 Ga0070698_1003206682 173
43 3300005535 Ga0070684_100342209 Ga0070684_1003422092 173
44 3300005539 Ga0068853_100463620 Ga0068853_1004636201 173
45 3300005545 Ga0070695_100060727 Ga0070695_1000607274 173
46 3300005547 Ga0070693_100000280 Ga0070693_1000002804 173
47 3300005549 Ga0070704_100864567 Ga0070704_1008645671 173
48 3300005843 Ga0068860_100007501 Ga0068860_1000075014 173
49 3300006028 Ga0070717_10042350 Ga0070717_100423504 173
50 3300006028 Ga0070717_10053603 Ga0070717_100536034 173
51 3300006028 Ga0070717_10318737 Ga0070717_103187372 173
52 3300006175 Ga0070712_101258862 Ga0070712_1012588621 173
53 3300006237 Ga0097621_100740317 Ga0097621_1007403171 173
54 3300006358 Ga0068871_100396501 Ga0068871_1003965012 173
55 3300006844 Ga0075428_100120105 Ga0075428_1001201052 173
56 3300006871 Ga0075434_100020198 Ga0075434_1000201985 173
57 3300006914 Ga0075436_100024273 Ga0075436_1000242733 173
58 3300006914 Ga0075436_100217728 Ga0075436_1002177281 173
59 3300007076 Ga0075435_100126030 Ga0075435_1001260302 173
60 3300007265 Ga0099794_10382315 Ga0099794_103823151 173
61 3300009093 Ga0105240_10238327 Ga0105240_102383273 173
62 3300009094 Ga0111539_10000013 Ga0111539_1000001351 173
63 3300009147 Ga0114129_10028908 Ga0114129_100289087 173
64 3300009545 Ga0105237_10359528 Ga0105237_103595282 173
65 3300009551 Ga0105238_10138665 Ga0105238_101386652 173
66 3300013100 Ga0157373_10059046 Ga0157373_100590463 173
67 3300013105 Ga0157369_10056759 Ga0157369_100567593 173
68 3300013105 Ga0157369_10183990 Ga0157369_101839902 173
69 3300013297 Ga0157378_11338821 Ga0157378_113388212 173
70 3300013307 Ga0157372_10540056 Ga0157372_105400561 173
71 3300021388 Ga0213875_10012417 Ga0213875_100124174 173
72 3300024225 Ga0224572_1001084 Ga0224572_10010844 173
73 3300025885 Ga0207653_10000153 Ga0207653_1000015334 173
74 3300025898 Ga0207692_10071376 Ga0207692_100713762 173
75 3300025906 Ga0207699_10137349 Ga0207699_101373493 173
76 3300025908 Ga0207643_10127713 Ga0207643_101277132 173
77 3300025910 Ga0207684_10000405 Ga0207684_1000040541 173
78 3300025913 Ga0207695_10481967 Ga0207695_104819672 173
79 3300025916 Ga0207663_10000003 Ga0207663_10000003243 173
80 3300025916 Ga0207663_10026693 Ga0207663_100266932 173
81 3300025917 Ga0207660_10011933 Ga0207660_100119334 173
82 3300025924 Ga0207694_10703272 Ga0207694_107032721 173
83 3300025928 Ga0207700_10008033 Ga0207700_100080331 173
84 3300025928 Ga0207700_10008657 Ga0207700_100086572 173
85 3300025928 Ga0207700_10441828 Ga0207700_104418281 173
86 3300025928 Ga0207700_10660722 Ga0207700_106607221 173
87 3300025929 Ga0207664_10066305 Ga0207664_100663053 173
88 3300025949 Ga0207667_10077160 Ga0207667_100771601 173
89 3300026041 Ga0207639_10882096 Ga0207639_108820961 173
90 3300026078 Ga0207702_10024456 Ga0207702_100244562 173
91 3300027907 Ga0207428_10000017 Ga0207428_10000017220 173
92 3300028381 Ga0268264_10005156 Ga0268264_100051565 173
93 3300031241 Ga0265325_10019903 Ga0265325_100199035 173
94 3300031249 Ga0265339_10084070 Ga0265339_100840702 173
95 3300031712 Ga0265342_10403920 Ga0265342_104039201 173
96 3300032133 Ga0316583_10001712 Ga0316583_100017125 173
97 3300035083 Ga0373926_0190595 Ga0373926_0190595_17_541 173
98 3300035111 Ga0373923_0044200 Ga0373923_0044200_1189_1713 173
99 3300035170 Ga0373943_0657074 Ga0373943_0657074_86_610 173
100 3300035241 Ga0373961_0002912 Ga0373961_0002912_176_700 173
101 3300035695 Ga0373927_0024828 Ga0373927_0024828_2304_2828 173
102 3300035695 Ga0373927_0121313 Ga0373927_0121313_292_894 173
103 3300036401 Ga0373937_0133189 Ga0373937_0133189_215_739 173
104 3300037068 Ga0373925_0092592 Ga0373925_0092592_295_897 173
105 3300041486 Ga0451807_2279752 Ga0451807_2279752_1557_2084 173
106 3300044673 Ga0453683_0500556 Ga0453683_0500556_116_640 173
107 3300044693 Ga0466961_0466836 Ga0466961_0466836_149_673 173
108 3300044694 Ga0466963_0054413 Ga0466963_0054413_2041_2565 173
109 3300044842 Ga0466957_0000662 Ga0466957_0000662_353_877 173
110 3300044842 Ga0466957_0116067 Ga0466957_0116067_792_1316 173
111 3300045051 Ga0451576_1176673 Ga0451576_1176673_108_632 173
112 3300046472 Ga0495580_0103254 Ga0495580_0103254_1029_1553 173
113 3300046517 Ga0495630_0230384 Ga0495630_0230384_742_1344 173
114 3300046531 Ga0495665_0047381 Ga0495665_0047381_165_689 173
115 3300048915 Ga0496112_0092550 Ga0496112_0092550_1603_2127 173
116 3300049127 Ga0501306_042735 Ga0501306_042735_166_696 173
117 3300049128 Ga0501308_012365 Ga0501308_012365_12_542 173
118 3300049528 Ga0501312_016317 Ga0501312_016317_430_960 173
119 3300049654 Ga0501207_005825 Ga0501207_005825_1092_1622 173
120 3300049674 Ga0501242_017952 Ga0501242_017952_120_650 173
121 3300049686 Ga0501257_005681 Ga0501257_005681_1977_2507 173
122 3300049705 Ga0501225_0014309 Ga0501225_0014309_198_728 173
123 3300050507 nmdc:mga05p37_435_c1 nmdc:mga05p37_435_c1_33778_34302 173
124 3300050511 nmdc:mga08y16_19_c1 nmdc:mga08y16_19_c1_257330_257857 173
125 3300050512 nmdc:mga0n895_18182_c1 nmdc:mga0n895_18182_c1_2250_2774 173
126 3300050513 nmdc:mga0rr50_109168_c1 nmdc:mga0rr50_109168_c1_374_898 173
127 3300050514 nmdc:mga08x19_37518_c1 nmdc:mga08x19_37518_c1_451_975 173
128 3300050514 nmdc:mga08x19_45369_c1 nmdc:mga08x19_45369_c1_2272_2796 173
129 3300005440 Ga0070705_100000077 Ga0070705_1000000774 174
130 3300005445 Ga0070708_100077546 Ga0070708_1000775463 174
131 3300005518 Ga0070699_100000004 Ga0070699_100000004159 174
132 3300005536 Ga0070697_100455196 Ga0070697_1004551962 174
133 3300005546 Ga0070696_100000002 Ga0070696_10000000218 174
134 3300005844 Ga0068862_100000889 Ga0068862_10000088910 174
135 3300006844 Ga0075428_100134614 Ga0075428_1001346143 174
136 3300006847 Ga0075431_100890095 Ga0075431_1008900952 174
137 3300006880 Ga0075429_101138886 Ga0075429_1011388862 174
138 3300006914 Ga0075436_100007659 Ga0075436_1000076599 174
139 3300006914 Ga0075436_100065148 Ga0075436_1000651482 174
140 3300006914 Ga0075436_100164214 Ga0075436_1001642143 174
141 3300006914 Ga0075436_100761635 Ga0075436_1007616352 174
142 3300028380 Ga0268265_10000416 Ga0268265_1000041631 174
143 3300032002 Ga0307416_102839487 Ga0307416_1028394871 174
144 3300044673 Ga0453683_0208278 Ga0453683_0208278_171_698 174
145 3300044712 Ga0453684_1020215 Ga0453684_1020215_64_597 174
146 3300049519 Ga0501296_003251 Ga0501296_003251_526_1056 174
147 3300049580 Ga0501046_0060905 Ga0501046_0060905_1731_2291 174
148 3300049580 Ga0501046_0717036 Ga0501046_0717036_120_671 174
149 3300049582 Ga0501048_0308988 Ga0501048_0308988_69_629 174
150 3300049585 Ga0501069_0406094 Ga0501069_0406094_261_785 174
151 3300049592 Ga0501076_0031291 Ga0501076_0031291_2611_3171 174
152 3300049593 Ga0501077_0117353 Ga0501077_0117353_442_1002 174
153 3300049741 Ga0501079_0140289 Ga0501079_0140289_269_829 174
154 3300049742 Ga0501080_0758567 Ga0501080_0758567_265_825 174
155 3300049743 Ga0501081_0049981 Ga0501081_0049981_982_1542 174
156 3300050507 nmdc:mga05p37_1238249_c1 nmdc:mga05p37_1238249_c1_32_586 174
157 3300050508 nmdc:mga09592_53184_c1 nmdc:mga09592_53184_c1_2420_2950 174
158 3300050510 nmdc:mga06r32_851725_c1 nmdc:mga06r32_851725_c1_192_719 174
159 3300050514 nmdc:mga08x19_10_c1 nmdc:mga08x19_10_c1_67985_68512 174
160 3300050514 nmdc:mga08x19_152496_c1 nmdc:mga08x19_152496_c1_216_743 174
161 3300003316 rootH1_10178703 rootH1_101787032 175
162 3300003322 rootL2_10266048 rootL2_102660482 175
163 3300003323 rootH1_10311472 rootH1_103114722 175
164 3300003794 Ga0055531_10000197 Ga0055531_1000019743 175
165 3300005440 Ga0070705_100724972 Ga0070705_1007249721 175
166 3300005518 Ga0070699_100005575 Ga0070699_10000557513 175
167 3300005536 Ga0070697_100090489 Ga0070697_1000904892 175
168 3300005546 Ga0070696_100001456 Ga0070696_10000145616 175
169 3300005549 Ga0070704_100023416 Ga0070704_1000234164 175
170 3300006852 Ga0075433_10109057 Ga0075433_101090573 175
171 3300006871 Ga0075434_100072828 Ga0075434_1000728283 175
172 3300007076 Ga0075435_100770204 Ga0075435_1007702041 175
173 3300025304 Ga0209257_1000006 Ga0209257_1000006661 175
174 3300031731 Ga0307405_10000851 Ga0307405_100008513 175
175 3300031824 Ga0307413_11048392 Ga0307413_110483921 175
176 3300031852 Ga0307410_10009466 Ga0307410_100094668 175
177 3300031901 Ga0307406_10131528 Ga0307406_101315284 175
178 3300031911 Ga0307412_10299941 Ga0307412_102999413 175
179 3300031995 Ga0307409_100031059 Ga0307409_1000310597 175
180 3300032004 Ga0307414_10013954 Ga0307414_100139547 175
181 3300032005 Ga0307411_10006909 Ga0307411_100069098 175
182 3300032126 Ga0307415_100001966 Ga0307415_1000019667 175
183 3300048905 Ga0496102_0012708 Ga0496102_0012708_639_1202 175
184 3300050507 nmdc:mga05p37_874991_c1 nmdc:mga05p37_874991_c1_156_719 175
185 3300050515 nmdc:mga0a205_17680_c1 nmdc:mga0a205_17680_c1_463_1026 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

54

191

0.98

PF05163

DinB

DinB family

44

200

0.9

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

55

178

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.9748 3 175
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8035 22 171
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.7924 11 174
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7889 14 173
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7868 22 168
ID Description Score Start End Superfamily
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9678 8 175 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9621 8 175 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8118 14 174 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7718 22 169 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7628 17 173 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7Y4QD87-F1-model_v4 Putative metal-dependent hydrolase 0.991 4 175 GO:0005737
GO:0016787
GO:0046872
AF-A0A268JAC6-F1-model_v4 Metal-dependent hydrolase 0.988 22 174 GO:0016787
AF-A0A6N4EJ97-F1-model_v4 deleted 0.9874 1 174
AF-A0A7W1EA82-F1-model_v4 Putative metal-dependent hydrolase 0.9871 3 175 GO:0005737
GO:0016787
GO:0046872
AF-A0A7Y2NPN9-F1-model_v4 Putative metal-dependent hydrolase 0.9871 29 175 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.17 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map