F284259

General Info

Members Datasets Scaffolds Average Seq Length
185 73 370 181

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10135003|Ga0105247_101350032
Length 183
Sequence MNHEIVISGFGGQGVLFAGQLLAYAGLAEGRHVTWIPSYGPEMRGGTAHCTVIISDQEIGSPLVRNPTAALVMNPPSMEKYAPLVQAHGVLILDTTLIEQRSARSDIQTIALPAKTIADELGAPQIANVVMLGALIAATGVVTVETMNDVLAQHLSARHRDKLKANRAALARGAAYVLDRVPA

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
28 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
35 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
38 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
39 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
42 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
48 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
51 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
52 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
55 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
56 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
57 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
58 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
60 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
61 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
62 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
63 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
64 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
65 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
66 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
67 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
68 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
69 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
70 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
71 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
72 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
73 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 1.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.54
Rhizosphere 99.46
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10135003 3300009101 Bacteria 1611
2 SwRhRL2b_contig_1316054 2162886007 Bacteria 2014
3 Ga0065704_10000323 3300005289 Bacteria 40015
4 Ga0065704_10270000 3300005289 Bacteria 898
5 Ga0065704_10286640 3300005289 Bacteria 912
6 Ga0065707_10005330 3300005295 Bacteria 3411
7 Ga0065707_10107734 3300005295 Bacteria 2538
8 Ga0065707_10109043 3300005295 Bacteria 2484
9 Ga0065707_10167629 3300005295 Bacteria 1509
10 Ga0065707_10687809 3300005295 Archaea 634
11 Ga0070683_100268682 3300005329 Bacteria 1622
12 Ga0070660_100265152 3300005339 Bacteria 1403
13 Ga0070703_10143225 3300005406 Bacteria 890
14 Ga0070701_10253887 3300005438 Bacteria 1063
15 Ga0070706_100378859 3300005467 Bacteria 1318
16 Ga0070698_100296842 3300005471 Bacteria 1547
17 Ga0068855_100460277 3300005563 Bacteria 1387
18 Ga0068857_100800340 3300005577 Bacteria 900
19 Ga0068859_100599648 3300005617 Bacteria 1194
20 Ga0068864_100397096 3300005618 Bacteria 1310
21 Ga0068870_10180006 3300005840 Bacteria 1268
22 Ga0075428_100043219 3300006844 Bacteria 4953
23 Ga0075430_100024085 3300006846 Bacteria 5183
24 Ga0075430_100213210 3300006846 Bacteria 1602
25 Ga0075431_100194726 3300006847 Bacteria 2075
26 Ga0075433_10501542 3300006852 Bacteria 1068
27 Ga0075434_100915322 3300006871 Bacteria 892
28 Ga0075429_100006998 3300006880 Bacteria 9801
29 Ga0075429_100020850 3300006880 Bacteria 5688
30 Ga0075429_100047197 3300006880 Bacteria 3747
31 Ga0075429_100187191 3300006880 Bacteria 1814
32 Ga0111539_10626425 3300009094 Bacteria 1253
33 Ga0114129_10002194 3300009147 Bacteria 26882
34 Ga0114129_10012733 3300009147 Bacteria 11973
35 Ga0114129_10204703 3300009147 Bacteria 2671
36 Ga0105243_10204561 3300009148 Bacteria 1734
37 Ga0105249_10189386 3300009553 Bacteria 2007
38 Ga0105246_10179068 3300011119 Bacteria 1630
39 Ga0157380_10897950 3300014326 Bacteria 912
40 Ga0207662_10174484 3300025918 Bacteria 1380
41 Ga0207689_10380552 3300025942 Bacteria 1175
42 Ga0207661_10386808 3300025944 Bacteria 1267
43 Ga0207667_10425356 3300025949 Bacteria 1351
44 Ga0207641_10533421 3300026088 Bacteria 1143
45 Ga0207675_100140482 3300026118 Bacteria 2294
46 Ga0265326_10044870 3300028558 Bacteria 1254
47 Ga0265334_10031721 3300028573 Bacteria 2111
48 Ga0265318_10007309 3300028577 Bacteria 5003
49 Ga0265328_10052405 3300031239 Bacteria 1498
50 Ga0265320_10009864 3300031240 Bacteria 5723
51 Ga0265340_10041859 3300031247 Bacteria 2250
52 Ga0265316_10092069 3300031344 Bacteria 2312
53 Ga0316575_10298705 3300031665 Unclassified 681
54 Ga0316579_10001544 3300031691 Bacteria 8400
55 Ga0316579_10012617 3300031691 Bacteria 3619
56 Ga0316579_10013868 3300031691 Bacteria 3476
57 Ga0316579_10016044 3300031691 Bacteria 3264
58 Ga0316576_10078657 3300031727 Bacteria 2444
59 Ga0316576_10091886 3300031727 Bacteria 2262
60 Ga0316576_10791509 3300031727 Unclassified 683
61 Ga0316578_10124759 3300031728 Unclassified 1548
62 Ga0316578_10145444 3300031728 Bacteria 1428
63 Ga0316578_10160892 3300031728 Bacteria 1353
64 Ga0316578_10291789 3300031728 Bacteria 976
65 Ga0316577_10003553 3300031733 Bacteria 7894
66 Ga0316577_10044800 3300031733 Bacteria 2474
67 Ga0316577_10116772 3300031733 Bacteria 1499
68 Ga0316577_10130741 3300031733 Bacteria 1413
69 Ga0307409_101137022 3300031995 Bacteria 803
70 Ga0316585_10039963 3300032137 Unclassified 1493
71 Ga0316593_10007898 3300032168 Bacteria 2942
72 Ga0316593_10008515 3300032168 Bacteria 2862
73 Ga0316593_10009128 3300032168 Bacteria 2790
74 Ga0316574_0000361 3300035398 Bacteria 17653
75 Ga0316574_0005885 3300035398 Bacteria 6580
76 Ga0316574_0016102 3300035398 Unclassified 4350
77 Ga0316574_0034057 3300035398 Bacteria 3103
78 Ga0316574_0143455 3300035398 Unclassified 1539
79 Ga0316574_0238140 3300035398 Bacteria 1164
80 Ga0316582_0001827 3300036647 Bacteria 9623
81 Ga0316582_0028075 3300036647 Bacteria 3406
82 Ga0316582_0088642 3300036647 Bacteria 2033
83 Ga0316582_0115231 3300036647 Unclassified 1793
84 Ga0316582_0122876 3300036647 Bacteria 1739
85 Ga0316582_0286468 3300036647 Bacteria 1131
86 Ga0316582_0517520 3300036647 Unclassified 822
87 Ga0316584_0000189 3300036712 Bacteria 30040
88 Ga0316584_0024222 3300036712 Bacteria 4440
89 Ga0316584_0043245 3300036712 Bacteria 3359
90 Ga0316581_0009687 3300037588 Bacteria 2655
91 Ga0316581_0033905 3300037588 Unclassified 1544
92 Ga0316581_0053713 3300037588 Bacteria 1235
93 Ga0316581_0054350 3300037588 Unclassified 1228
94 Ga0316581_0065792 3300037588 Bacteria 1113
95 Ga0451577_0029062 3300042876 Bacteria 4999
96 Ga0451577_0064242 3300042876 Bacteria 3273
97 Ga0451577_0119198 3300042876 Bacteria 2364
98 Ga0451577_0136862 3300042876 Bacteria 2199
99 Ga0451577_0175739 3300042876 Bacteria 1930
100 Ga0451577_0180069 3300042876 Bacteria 1905
101 Ga0451577_0347312 3300042876 Bacteria 1346
102 Ga0451577_0544491 3300042876 Bacteria 1054
103 Ga0451577_0558064 3300042876 Unclassified 1040
104 Ga0451577_0884763 3300042876 Bacteria 805
105 Ga0453683_0000406 3300044673 Bacteria 50333
106 Ga0453683_0189870 3300044673 Bacteria 1303
107 Ga0453683_0196293 3300044673 Unclassified 1281
108 Ga0453683_0203387 3300044673 Bacteria 1257
109 Ga0453683_0226159 3300044673 Bacteria 1190
110 Ga0453683_0246314 3300044673 Bacteria 1139
111 Ga0453683_0392686 3300044673 Unclassified 894
112 Ga0453683_0586584 3300044673 Unclassified 726
113 Ga0453684_0000003 3300044712 Bacteria 1481694
114 Ga0453684_0000047 3300044712 Bacteria 560243
115 Ga0453684_0000128 3300044712 Bacteria 335864
116 Ga0453684_0000435 3300044712 Bacteria 170233
117 Ga0453684_0001080 3300044712 Bacteria 86823
118 Ga0453684_0004143 3300044712 Bacteria 31379
119 Ga0453684_0005735 3300044712 Bacteria 24263
120 Ga0453684_0005976 3300044712 Bacteria 23595
121 Ga0453684_0013590 3300044712 Bacteria 13197
122 Ga0453684_0024038 3300044712 Bacteria 8932
123 Ga0453684_0036254 3300044712 Bacteria 6799
124 Ga0453684_0055186 3300044712 Bacteria 5167
125 Ga0453684_0056384 3300044712 Bacteria 5097
126 Ga0453684_0062926 3300044712 Bacteria 4750
127 Ga0453684_0078098 3300044712 Unclassified 4144
128 Ga0453684_0081610 3300044712 Bacteria 4032
129 Ga0453684_0100449 3300044712 Bacteria 3541
130 Ga0453684_0135994 3300044712 Bacteria 2943
131 Ga0453684_0138722 3300044712 Bacteria 2907
132 Ga0453684_0159679 3300044712 Bacteria 2668
133 Ga0453684_0233534 3300044712 Bacteria 2121
134 Ga0453684_0257827 3300044712 Bacteria 1999
135 Ga0453684_0262809 3300044712 Bacteria 1976
136 Ga0453684_0267265 3300044712 Bacteria 1956
137 Ga0453684_0361598 3300044712 Bacteria 1634
138 Ga0453684_0408650 3300044712 Bacteria 1519
139 Ga0453684_0474983 3300044712 Bacteria 1388
140 Ga0453684_0610098 3300044712 Bacteria 1195
141 Ga0453684_0691065 3300044712 Bacteria 1109
142 Ga0453684_0739700 3300044712 Bacteria 1065
143 Ga0453684_0790301 3300044712 Bacteria 1024
144 Ga0453684_0810214 3300044712 Bacteria 1009
145 Ga0453684_1014892 3300044712 Bacteria 881
146 Ga0453684_1851962 3300044712 Unclassified 612
147 Ga0451576_0000046 3300045051 Bacteria 334064
148 Ga0451576_0004217 3300045051 Bacteria 18889
149 Ga0451576_0014912 3300045051 Bacteria 8633
150 Ga0451576_0022150 3300045051 Bacteria 6894
151 Ga0451576_0126070 3300045051 Bacteria 2668
152 Ga0451576_0145971 3300045051 Bacteria 2467
153 Ga0451576_0151229 3300045051 Bacteria 2421
154 Ga0451576_0226935 3300045051 Bacteria 1950
155 Ga0451576_0303361 3300045051 Unclassified 1670
156 Ga0451576_0432926 3300045051 Bacteria 1380
157 Ga0451576_0991250 3300045051 Bacteria 881
158 Ga0496108_0961235 3300048911 Bacteria 731
159 Ga0501039_0207206 3300049575 Bacteria 1542
160 Ga0501071_0687963 3300049587 Unclassified 787
161 Ga0501072_0279209 3300049588 Unclassified 1329
162 Ga0501072_0468785 3300049588 Bacteria 997
163 Ga0501075_0483868 3300049591 Unclassified 944
164 Ga0501075_0999616 3300049591 Bacteria 636
165 Ga0501076_0118542 3300049592 Bacteria 2143
166 Ga0501076_0147854 3300049592 Bacteria 1911
167 Ga0501076_0455486 3300049592 Bacteria 1053
168 Ga0501217_068346 3300049661 Bacteria 962
169 Ga0501079_0095174 3300049741 Bacteria 2308
170 Ga0501079_0309590 3300049741 Bacteria 1236
171 Ga0501080_0863769 3300049742 Bacteria 790
172 Ga0501081_0116172 3300049743 Bacteria 1902
173 Ga0501081_0480184 3300049743 Bacteria 925
174 Ga0501045_0357663 3300049824 Bacteria 1086
175 nmdc:mga05p37_44521_c1 3300050507 Bacteria 5460
176 nmdc:mga05p37_4921_c1 3300050507 Bacteria 15649
177 nmdc:mga09592_183825_c1 3300050508 Bacteria 1808
178 nmdc:mga09592_5950_c1 3300050508 Bacteria 9944
179 nmdc:mga09592_96206_c1 3300050508 Bacteria 2533
180 nmdc:mga0qj67_42703_c1 3300050509 Bacteria 3569
181 nmdc:mga0qj67_917889_c1 3300050509 Unclassified 689
182 Ga0501084_0020199 3300054114 Bacteria 5552
183 Ga0501084_0111828 3300054114 Bacteria 2295
184 Ga0501082_0059359 3300060353 Bacteria 3297
185 Ga0530510_0236228 3300061734 Bacteria 1360
186 Ga0105247_10135003
187 SwRhRL2b_contig_1316054
188 Ga0065704_10000323
189 Ga0065704_10270000
190 Ga0065704_10286640
191 Ga0065707_10005330
192 Ga0065707_10107734
193 Ga0065707_10109043
194 Ga0065707_10167629
195 Ga0065707_10687809
196 Ga0070683_100268682
197 Ga0070660_100265152
198 Ga0070703_10143225
199 Ga0070701_10253887
200 Ga0070706_100378859
201 Ga0070698_100296842
202 Ga0068855_100460277
203 Ga0068857_100800340
204 Ga0068859_100599648
205 Ga0068864_100397096
206 Ga0068870_10180006
207 Ga0075428_100043219
208 Ga0075430_100024085
209 Ga0075430_100213210
210 Ga0075431_100194726
211 Ga0075433_10501542
212 Ga0075434_100915322
213 Ga0075429_100006998
214 Ga0075429_100020850
215 Ga0075429_100047197
216 Ga0075429_100187191
217 Ga0111539_10626425
218 Ga0114129_10002194
219 Ga0114129_10012733
220 Ga0114129_10204703
221 Ga0105243_10204561
222 Ga0105249_10189386
223 Ga0105246_10179068
224 Ga0157380_10897950
225 Ga0207662_10174484
226 Ga0207689_10380552
227 Ga0207661_10386808
228 Ga0207667_10425356
229 Ga0207641_10533421
230 Ga0207675_100140482
231 Ga0265326_10044870
232 Ga0265334_10031721
233 Ga0265318_10007309
234 Ga0265328_10052405
235 Ga0265320_10009864
236 Ga0265340_10041859
237 Ga0265316_10092069
238 Ga0316575_10298705
239 Ga0316579_10001544
240 Ga0316579_10012617
241 Ga0316579_10013868
242 Ga0316579_10016044
243 Ga0316576_10078657
244 Ga0316576_10091886
245 Ga0316576_10791509
246 Ga0316578_10124759
247 Ga0316578_10145444
248 Ga0316578_10160892
249 Ga0316578_10291789
250 Ga0316577_10003553
251 Ga0316577_10044800
252 Ga0316577_10116772
253 Ga0316577_10130741
254 Ga0307409_101137022
255 Ga0316585_10039963
256 Ga0316593_10007898
257 Ga0316593_10008515
258 Ga0316593_10009128
259 Ga0316574_0000361
260 Ga0316574_0005885
261 Ga0316574_0016102
262 Ga0316574_0034057
263 Ga0316574_0143455
264 Ga0316574_0238140
265 Ga0316582_0001827
266 Ga0316582_0028075
267 Ga0316582_0088642
268 Ga0316582_0115231
269 Ga0316582_0122876
270 Ga0316582_0286468
271 Ga0316582_0517520
272 Ga0316584_0000189
273 Ga0316584_0024222
274 Ga0316584_0043245
275 Ga0316581_0009687
276 Ga0316581_0033905
277 Ga0316581_0053713
278 Ga0316581_0054350
279 Ga0316581_0065792
280 Ga0451577_0029062
281 Ga0451577_0064242
282 Ga0451577_0119198
283 Ga0451577_0136862
284 Ga0451577_0175739
285 Ga0451577_0180069
286 Ga0451577_0347312
287 Ga0451577_0544491
288 Ga0451577_0558064
289 Ga0451577_0884763
290 Ga0453683_0000406
291 Ga0453683_0189870
292 Ga0453683_0196293
293 Ga0453683_0203387
294 Ga0453683_0226159
295 Ga0453683_0246314
296 Ga0453683_0392686
297 Ga0453683_0586584
298 Ga0453684_0000003
299 Ga0453684_0000047
300 Ga0453684_0000128
301 Ga0453684_0000435
302 Ga0453684_0001080
303 Ga0453684_0004143
304 Ga0453684_0005735
305 Ga0453684_0005976
306 Ga0453684_0013590
307 Ga0453684_0024038
308 Ga0453684_0036254
309 Ga0453684_0055186
310 Ga0453684_0056384
311 Ga0453684_0062926
312 Ga0453684_0078098
313 Ga0453684_0081610
314 Ga0453684_0100449
315 Ga0453684_0135994
316 Ga0453684_0138722
317 Ga0453684_0159679
318 Ga0453684_0233534
319 Ga0453684_0257827
320 Ga0453684_0262809
321 Ga0453684_0267265
322 Ga0453684_0361598
323 Ga0453684_0408650
324 Ga0453684_0474983
325 Ga0453684_0610098
326 Ga0453684_0691065
327 Ga0453684_0739700
328 Ga0453684_0790301
329 Ga0453684_0810214
330 Ga0453684_1014892
331 Ga0453684_1851962
332 Ga0451576_0000046
333 Ga0451576_0004217
334 Ga0451576_0014912
335 Ga0451576_0022150
336 Ga0451576_0126070
337 Ga0451576_0145971
338 Ga0451576_0151229
339 Ga0451576_0226935
340 Ga0451576_0303361
341 Ga0451576_0432926
342 Ga0451576_0991250
343 Ga0496108_0961235
344 Ga0501039_0207206
345 Ga0501071_0687963
346 Ga0501072_0279209
347 Ga0501072_0468785
348 Ga0501075_0483868
349 Ga0501075_0999616
350 Ga0501076_0118542
351 Ga0501076_0147854
352 Ga0501076_0455486
353 Ga0501217_068346
354 Ga0501079_0095174
355 Ga0501079_0309590
356 Ga0501080_0863769
357 Ga0501081_0116172
358 Ga0501081_0480184
359 Ga0501045_0357663
360 nmdc:mga05p37_44521_c1
361 nmdc:mga05p37_4921_c1
362 nmdc:mga09592_183825_c1
363 nmdc:mga09592_5950_c1
364 nmdc:mga09592_96206_c1
365 nmdc:mga0qj67_42703_c1
366 nmdc:mga0qj67_917889_c1
367 Ga0501084_0020199
368 Ga0501084_0111828
369 Ga0501082_0059359
370 Ga0530510_0236228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01558

POR

Pyruvate ferredoxin/flavodoxin oxidoreductase

11

175

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3on3-assembly2.cif.gz_A the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8881 3 163
3on3-assembly3.cif.gz_B the crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from geobacter sulfurreducens pca 0.8831 1 164
3g2e-assembly1.cif.gz_D structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8722 1 164
3g2e-assembly1.cif.gz_A structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8658 15 163
3g2e-assembly1.cif.gz_D structure of putative oorc subunit of 2-oxoglutarate:acceptor oxidoreductase from campylobacter jejuni 0.8626 1 164
ID Description Score Start End Superfamily
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8807 2 162 3.40.920.10
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8783 3 163 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8585 1 164 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.849 1 164 3.40.920.10
af_Q57717_1_177_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8305 3 163 3.40.920.10
ID Description Score Start End GO Terms
AF-A0A1H7XK93-F1-model_v4 Pyruvate ferredoxin/flavodoxin oxidoreductase 0.9644 57 164 GO:0016903
AF-A0A7V2PKR6-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit gamma 0.9638 1 164 GO:0016625
AF-A0A7C7QV89-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit gamma 0.9569 1 164 GO:0016625
AF-A0A7X9ILK9-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit gamma 0.9547 1 164 GO:0016903
AF-A0A1F8SL59-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit gamma 0.9542 54 164 GO:0016903

Map