F283041

General Info

Members Datasets Scaffolds Average Seq Length
184 152 368 125

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0007315|Ga0466970_0007315_2905_3351
Length 148
Sequence MTEGESDRGVGARAGRDSLERTVDIPQNLLYTAEHEWVDWTPGTTEPVAVGITGYAAESLGDIVFVQLPEVGQRLTAGETCGELESTKSVSDLFAPVTGEVAEVNQAALDDPAIINADPYGAGWLLKVRVETSEGLITAAKYAELTGH

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
55 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
56 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
57 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
58 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
73 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
76 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
79 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
80 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
83 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
86 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
98 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
142 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
143 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
144 2739367653 Kocuria sp. OV113 Isolate Unclassified
145 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
146 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
147 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
148 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
149 2857727296 Kocuria sp. R-72562 Isolate Unclassified
150 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
151 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
152 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.85
Metatranscriptomes 1.63
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 7.07
Rhizosphere 70.11
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0007315 3300044765 Bacteria 5532
2 Ga0007423J48922_100308 3300003285 Bacteria 2655
3 rootL2_10329721 3300003322 Bacteria 3445
4 Ga0006562J51391_1082032 3300003578 Bacteria 2545
5 Ga0065714_10385633 3300005288 Bacteria 567
6 Ga0070658_11022082 3300005327 Bacteria 719
7 Ga0070683_101026302 3300005329 Bacteria 792
8 Ga0070682_100042080 3300005337 Bacteria 2819
9 Ga0068868_101375230 3300005338 Bacteria 658
10 Ga0070687_101445636 3300005343 Bacteria 515
11 Ga0070671_100760001 3300005355 Bacteria 843
12 Ga0070674_100361367 3300005356 Bacteria 1176
13 Ga0070674_101697053 3300005356 Bacteria 571
14 Ga0070673_102410983 3300005364 Bacteria 500
15 Ga0070714_100312503 3300005435 Bacteria 1467
16 Ga0070711_100927666 3300005439 Bacteria 744
17 Ga0070700_101897723 3300005441 Bacteria 515
18 Ga0070663_100693485 3300005455 Bacteria 865
19 Ga0070678_102070028 3300005456 Bacteria 539
20 Ga0070664_101432586 3300005564 Bacteria 653
21 Ga0070702_101532776 3300005615 Unclassified 549
22 Ga0068866_10407131 3300005718 Bacteria 879
23 Ga0068858_101721824 3300005842 Bacteria 619
24 Ga0070717_10202195 3300006028 Bacteria 1740
25 Ga0070716_100734545 3300006173 Bacteria 758
26 Ga0070712_100765355 3300006175 Bacteria 827
27 Ga0068871_100523559 3300006358 Bacteria 1071
28 Ga0105243_10963523 3300009148 Bacteria 853
29 Ga0105242_11505282 3300009176 Unclassified 704
30 Ga0105238_11068498 3300009551 Bacteria 829
31 Ga0105249_10273227 3300009553 Bacteria 1684
32 Ga0105246_10607753 3300011119 Bacteria 946
33 Ga0157370_10147271 3300013104 Bacteria 2192
34 Ga0157369_10065440 3300013105 Bacteria 3912
35 Ga0157369_10345849 3300013105 Bacteria 1545
36 Ga0157378_12719090 3300013297 Bacteria 547
37 Ga0163162_11372048 3300013306 Bacteria 804
38 Ga0157372_11935126 3300013307 Bacteria 678
39 Ga0157375_10213458 3300013308 Bacteria 2087
40 Ga0157375_10314770 3300013308 Bacteria 1730
41 Ga0157375_10320861 3300013308 Bacteria 1714
42 Ga0157375_11425856 3300013308 Bacteria 816
43 Ga0157380_10850047 3300014326 Bacteria 934
44 Ga0157380_11245903 3300014326 Bacteria 789
45 Ga0157376_11691859 3300014969 Bacteria 668
46 Ga0163161_10510525 3300017792 Bacteria 980
47 Ga0213876_10037414 3300021384 Bacteria 2560
48 Ga0213875_10015811 3300021388 Bacteria 3668
49 Ga0207642_10084842 3300025899 Bacteria 1548
50 Ga0207693_10908058 3300025915 Bacteria 675
51 Ga0207670_11490113 3300025936 Bacteria 575
52 Ga0207669_11624630 3300025937 Bacteria 552
53 Ga0207712_10219181 3300025961 Bacteria 1520
54 Ga0207640_10811986 3300025981 Bacteria 811
55 Ga0207678_10214911 3300026067 Bacteria 1645
56 Ga0207708_11119772 3300026075 Bacteria 687
57 Ga0207648_10557522 3300026089 Bacteria 1053
58 Ga0307517_10397362 3300028786 Bacteria 731
59 Ga0265338_10002764 3300028800 Bacteria 25690
60 Ga0316177_1131127 3300030731 Bacteria 1173
61 Ga0316176_1002901 3300030732 Bacteria 4140
62 Ga0314311_1174516 3300030733 Bacteria 7397
63 Ga0316178_1177354 3300030735 Bacteria 620
64 Ga0316180_1025632 3300030736 Bacteria 1077
65 Ga0265327_10255750 3300031251 Bacteria 779
66 Ga0307405_10522229 3300031731 Bacteria 956
67 Ga0307410_10549451 3300031852 Bacteria 957
68 Ga0307406_11454329 3300031901 Bacteria 602
69 Ga0307407_10075816 3300031903 Bacteria 2018
70 Ga0307412_11468947 3300031911 Bacteria 619
71 Ga0307409_100641011 3300031995 Bacteria 1055
72 Ga0307409_101136752 3300031995 Bacteria 803
73 Ga0307414_12169331 3300032004 Bacteria 519
74 Ga0316593_10259853 3300032168 Bacteria 651
75 Ga0373943_0304193 3300035170 Bacteria 906
76 Ga0316574_0096037 3300035398 Bacteria 1894
77 Ga0373931_0998470 3300035691 Bacteria 566
78 Ga0436364_0689226 3300037853 Bacteria 15763
79 Ga0400485_20247 3300038735 Bacteria 3429
80 Ga0400485_21123 3300038735 Bacteria 5300
81 Ga0400483_008915 3300039062 Unclassified 1143
82 Ga0400483_093256 3300039062 Bacteria 2307
83 Ga0400483_245651 3300039062 Bacteria 1200
84 Ga0400483_279754 3300039062 Bacteria 139594
85 Ga0436365_0165530 3300039437 Bacteria 6847
86 Ga0436365_0573760 3300039437 Unclassified 588
87 Ga0436365_0894133 3300039437 Bacteria 8648
88 Ga0439439_0048522 3300041406 Bacteria 1110
89 Ga0451787_018307 3300041441 Unclassified 752
90 Ga0451791_0939356 3300041451 Bacteria 1374
91 Ga0451793_1480796 3300041452 Bacteria 1403
92 Ga0451795_0157590 3300041456 Bacteria 1052
93 Ga0451802_1982787 3300041460 Bacteria 595
94 Ga0451807_1838032 3300041486 Bacteria 2084
95 Ga0451841_1263050 3300041498 Bacteria 566
96 Ga0451845_0276040 3300041501 Bacteria 703
97 Ga0451853_2413816 3300041512 Bacteria 973
98 Ga0451853_3901068 3300041512 Bacteria 1033
99 Ga0439463_139381 3300042016 Bacteria 628
100 Ga0450900_004757 3300042136 Bacteria 1575
101 Ga0466965_0004169 3300044683 Bacteria 6422
102 Ga0466965_0605459 3300044683 Bacteria 623
103 Ga0466966_0274561 3300044684 Bacteria 1014
104 Ga0466966_0799319 3300044684 Bacteria 569
105 Ga0466960_0291258 3300044901 Bacteria 917
106 Ga0466960_0654852 3300044901 Bacteria 627
107 Ga0466960_0706159 3300044901 Bacteria 605
108 Ga0466959_1097835 3300045049 Bacteria 529
109 Ga0451576_0014330 3300045051 Bacteria 8831
110 Ga0451576_0020763 3300045051 Bacteria 7148
111 Ga0451576_0171766 3300045051 Bacteria 2262
112 Ga0466958_0190579 3300045836 Bacteria 1303
113 Ga0466958_0773442 3300045836 Bacteria 626
114 Ga0495610_0321244 3300046512 Bacteria 591
115 Ga0495618_0007219 3300046514 Bacteria 6728
116 Ga0495635_0091140 3300046663 Bacteria 2085
117 Ga0495600_0372237 3300046809 Bacteria 892
118 Ga0495636_0540933 3300047318 Bacteria 566
119 Ga0495685_057314 3300047447 Bacteria 1316
120 Ga0496103_1023485 3300048906 Bacteria 514
121 Ga0496105_0609683 3300048908 Bacteria 846
122 Ga0496111_0185957 3300048914 Bacteria 1544
123 Ga0496114_0278198 3300048917 Bacteria 1475
124 Ga0496114_0310111 3300048917 Bacteria 1394
125 Ga0496114_0720669 3300048917 Bacteria 874
126 Ga0496114_1722423 3300048917 Bacteria 515
127 Ga0496117_0232907 3300048920 Bacteria 1016
128 Ga0496118_0064827 3300048921 Bacteria 2677
129 Ga0496119_0014719 3300048922 Bacteria 6094
130 Ga0496119_0066320 3300048922 Bacteria 2134
131 Ga0496119_0310922 3300048922 Bacteria 774
132 Ga0496120_0090474 3300048923 Bacteria 1636
133 Ga0496122_0000515 3300048925 Bacteria 79995
134 Ga0496123_0315579 3300048926 Bacteria 740
135 Ga0496124_0021853 3300048927 Bacteria 5886
136 Ga0496125_0000046 3300048928 Bacteria 295288
137 Ga0496126_0085432 3300048929 Bacteria 2781
138 Ga0496126_0103670 3300048929 Bacteria 2486
139 Ga0501031_0047116 3300049568 Bacteria 2810
140 Ga0501032_0028180 3300049569 Bacteria 3859
141 Ga0501033_0107921 3300049570 Bacteria 2028
142 Ga0501034_0109343 3300049571 Bacteria 2755
143 Ga0501036_0025623 3300049572 Bacteria 4977
144 Ga0501037_0405215 3300049573 Bacteria 935
145 Ga0501038_0003869 3300049574 Bacteria 13917
146 Ga0501039_1369416 3300049575 Bacteria 545
147 Ga0501043_0140550 3300049579 Bacteria 1891
148 Ga0501046_0020954 3300049580 Bacteria 5397
149 Ga0501047_0026825 3300049581 Bacteria 5545
150 Ga0501048_1285528 3300049582 Unclassified 526
151 Ga0501067_0056147 3300049583 Bacteria 2182
152 Ga0501067_0232021 3300049583 Bacteria 1027
153 Ga0501069_0484402 3300049585 Unclassified 737
154 Ga0501070_0042928 3300049586 Bacteria 3765
155 Ga0501071_0270507 3300049587 Bacteria 1285
156 Ga0501071_0405704 3300049587 Bacteria 1041
157 Ga0501072_0637290 3300049588 Bacteria 839
158 Ga0501073_0020683 3300049589 Bacteria 4746
159 Ga0501074_0013232 3300049590 Bacteria 5999
160 Ga0501075_0786408 3300049591 Bacteria 724
161 Ga0501079_0306221 3300049741 Bacteria 1243
162 Ga0501079_0443948 3300049741 Bacteria 1019
163 Ga0501080_0098938 3300049742 Bacteria 2707
164 Ga0501083_0012753 3300049744 Bacteria 5877
165 Ga0501035_0042988 3300049822 Bacteria 4073
166 Ga0501035_0631847 3300049822 Bacteria 870
167 Ga0501044_0001211 3300049823 Bacteria 30598
168 nmdc:mga0yw44_263224_c1 3300050492 Bacteria 1149
169 nmdc:mga07m45_720187_c1 3300050496 Bacteria 573
170 nmdc:mga08y16_1112754_c1 3300050511 Unclassified 764
171 Ga0501082_0749636 3300060353 Bacteria 854
172 Ga0501082_0803797 3300060353 Bacteria 823
173 2644504434 2643221690 Bacteria 4654705
174 2644524077 2643221694 Bacteria 4392972
175 2644668177 2643221722 Bacteria 4247614
176 2739604294 2739367653 Bacteria 2780952
177 2809197402 2808606439 Bacteria 5952208
178 2812363089 2811994880 Bacteria 4147780
179 2817509421 2816332305 Bacteria 2697803
180 2839986352 2839986021 Bacteria 3685650
181 2857728751 2857727296 Bacteria 2745552
182 2932434914 2932431166 Bacteria 4215299
183 8003857396 8003856774 Bacteria 7675274
184 8057572491 8057568493 Bacteria 7221719
185 Ga0466970_0007315
186 Ga0007423J48922_100308
187 rootL2_10329721
188 Ga0006562J51391_1082032
189 Ga0065714_10385633
190 Ga0070658_11022082
191 Ga0070683_101026302
192 Ga0070682_100042080
193 Ga0068868_101375230
194 Ga0070687_101445636
195 Ga0070671_100760001
196 Ga0070674_100361367
197 Ga0070674_101697053
198 Ga0070673_102410983
199 Ga0070714_100312503
200 Ga0070711_100927666
201 Ga0070700_101897723
202 Ga0070663_100693485
203 Ga0070678_102070028
204 Ga0070664_101432586
205 Ga0070702_101532776
206 Ga0068866_10407131
207 Ga0068858_101721824
208 Ga0070717_10202195
209 Ga0070716_100734545
210 Ga0070712_100765355
211 Ga0068871_100523559
212 Ga0105243_10963523
213 Ga0105242_11505282
214 Ga0105238_11068498
215 Ga0105249_10273227
216 Ga0105246_10607753
217 Ga0157370_10147271
218 Ga0157369_10065440
219 Ga0157369_10345849
220 Ga0157378_12719090
221 Ga0163162_11372048
222 Ga0157372_11935126
223 Ga0157375_10213458
224 Ga0157375_10314770
225 Ga0157375_10320861
226 Ga0157375_11425856
227 Ga0157380_10850047
228 Ga0157380_11245903
229 Ga0157376_11691859
230 Ga0163161_10510525
231 Ga0213876_10037414
232 Ga0213875_10015811
233 Ga0207642_10084842
234 Ga0207693_10908058
235 Ga0207670_11490113
236 Ga0207669_11624630
237 Ga0207712_10219181
238 Ga0207640_10811986
239 Ga0207678_10214911
240 Ga0207708_11119772
241 Ga0207648_10557522
242 Ga0307517_10397362
243 Ga0265338_10002764
244 Ga0316177_1131127
245 Ga0316176_1002901
246 Ga0314311_1174516
247 Ga0316178_1177354
248 Ga0316180_1025632
249 Ga0265327_10255750
250 Ga0307405_10522229
251 Ga0307410_10549451
252 Ga0307406_11454329
253 Ga0307407_10075816
254 Ga0307412_11468947
255 Ga0307409_100641011
256 Ga0307409_101136752
257 Ga0307414_12169331
258 Ga0316593_10259853
259 Ga0373943_0304193
260 Ga0316574_0096037
261 Ga0373931_0998470
262 Ga0436364_0689226
263 Ga0400485_20247
264 Ga0400485_21123
265 Ga0400483_008915
266 Ga0400483_093256
267 Ga0400483_245651
268 Ga0400483_279754
269 Ga0436365_0165530
270 Ga0436365_0573760
271 Ga0436365_0894133
272 Ga0439439_0048522
273 Ga0451787_018307
274 Ga0451791_0939356
275 Ga0451793_1480796
276 Ga0451795_0157590
277 Ga0451802_1982787
278 Ga0451807_1838032
279 Ga0451841_1263050
280 Ga0451845_0276040
281 Ga0451853_2413816
282 Ga0451853_3901068
283 Ga0439463_139381
284 Ga0450900_004757
285 Ga0466965_0004169
286 Ga0466965_0605459
287 Ga0466966_0274561
288 Ga0466966_0799319
289 Ga0466960_0291258
290 Ga0466960_0654852
291 Ga0466960_0706159
292 Ga0466959_1097835
293 Ga0451576_0014330
294 Ga0451576_0020763
295 Ga0451576_0171766
296 Ga0466958_0190579
297 Ga0466958_0773442
298 Ga0495610_0321244
299 Ga0495618_0007219
300 Ga0495635_0091140
301 Ga0495600_0372237
302 Ga0495636_0540933
303 Ga0495685_057314
304 Ga0496103_1023485
305 Ga0496105_0609683
306 Ga0496111_0185957
307 Ga0496114_0278198
308 Ga0496114_0310111
309 Ga0496114_0720669
310 Ga0496114_1722423
311 Ga0496117_0232907
312 Ga0496118_0064827
313 Ga0496119_0014719
314 Ga0496119_0066320
315 Ga0496119_0310922
316 Ga0496120_0090474
317 Ga0496122_0000515
318 Ga0496123_0315579
319 Ga0496124_0021853
320 Ga0496125_0000046
321 Ga0496126_0085432
322 Ga0496126_0103670
323 Ga0501031_0047116
324 Ga0501032_0028180
325 Ga0501033_0107921
326 Ga0501034_0109343
327 Ga0501036_0025623
328 Ga0501037_0405215
329 Ga0501038_0003869
330 Ga0501039_1369416
331 Ga0501043_0140550
332 Ga0501046_0020954
333 Ga0501047_0026825
334 Ga0501048_1285528
335 Ga0501067_0056147
336 Ga0501067_0232021
337 Ga0501069_0484402
338 Ga0501070_0042928
339 Ga0501071_0270507
340 Ga0501071_0405704
341 Ga0501072_0637290
342 Ga0501073_0020683
343 Ga0501074_0013232
344 Ga0501075_0786408
345 Ga0501079_0306221
346 Ga0501079_0443948
347 Ga0501080_0098938
348 Ga0501083_0012753
349 Ga0501035_0042988
350 Ga0501035_0631847
351 Ga0501044_0001211
352 nmdc:mga0yw44_263224_c1
353 nmdc:mga07m45_720187_c1
354 nmdc:mga08y16_1112754_c1
355 Ga0501082_0749636
356 Ga0501082_0803797
357 2644504434
358 2644524077
359 2644668177
360 2739604294
361 2809197402
362 2812363089
363 2817509421
364 2839986352
365 2857728751
366 2932434914
367 8003857396
368 8057572491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

29

148

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9713 3 122
3tzu-assembly1.cif.gz_A crystal structure of a glycine cleavage system h protein (gcvh) from mycobacterium marinum 0.9708 4 123
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9597 3 119
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9556 8 123
3hgb-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from mycobacterium tuberculosis 0.949 1 120
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9704 8 120 2.40.50.100
3tzuD00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.97 4 123 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.966 24 119 2.40.50.100
3tzuD00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.939 4 123 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9366 36 119 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A542SPM9-F1-model_v4 Glycine cleavage system H protein 1.003 4 120 GO:0005829
GO:0005960
GO:0019464
AF-A0A2A9E965-F1-model_v4 Glycine cleavage system H protein 0.9976 1 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A511YZF6-F1-model_v4 Glycine cleavage system H protein 0.9971 1 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A0H5RSX9-F1-model_v4 Glycine cleavage system H protein GcvH 0.9963 26 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A561U062-F1-model_v4 Glycine cleavage system H protein 0.9947 4 123 GO:0005829
GO:0005960
GO:0019464

Map