F283017

General Info

Members Datasets Scaffolds Average Seq Length
184 123 368 285

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0004461|Ga0466972_0004461_2107_3072
Length 321
Sequence MPRASPTPSARHWTFAPRTLEIVQNALAAPVDEALDLLAGRPFVALTGAGLSTDSGIPDYRGPGSPLRRPMTYGEFVSGPAAQRRYWARSHVGWARMRRAVPNPGHLALADLERRGVLQGLITQNVDGLHGEAGNRALIDLHGRIADVVCLSCGEISSRAVLQERFEQANPGFADSVGPEIETAPDGDVLLERTEGFRLVGCATCGGALKPDVVFFGENVPKERVARAYAMVDALRPAGGALLVAGSSLTVMSGLRFVRHAAKHDVPVVIVNRGETRGDPLAALHVDAGCSEVLSALAGACGGSRVDGLDTPIPEWRDLAP

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
9 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
24 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
25 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
39 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
40 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
43 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
46 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
52 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
56 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
60 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
61 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
64 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
65 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
66 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
67 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
68 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
72 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
76 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
77 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
78 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
79 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
80 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
81 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
109 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
110 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
111 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
112 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
113 2643221617 Nocardioides sp. Root79 Isolate Unclassified
114 2643221620 Nocardioides sp. Root240 Isolate Unclassified
115 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
116 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
117 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
118 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
119 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
120 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
121 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
122 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
123 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.48
Metatranscriptomes 0
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.98
Nodule 0
Rhizoplane 16.85
Rhizosphere 66.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0004461 3300044658 Bacteria 7001
2 Ga0070668_100034200 3300005347 Bacteria 3873
3 Ga0070671_100002444 3300005355 Bacteria 14365
4 Ga0070714_100028151 3300005435 Bacteria 4660
5 Ga0070700_100236142 3300005441 Bacteria 1304
6 Ga0070665_100004522 3300005548 Bacteria 14569
7 Ga0068856_100785356 3300005614 Bacteria 972
8 Ga0068864_100088600 3300005618 Bacteria 2726
9 Ga0068864_100124403 3300005618 Bacteria 2309
10 Ga0068870_10082483 3300005840 Bacteria 1780
11 Ga0068863_100039269 3300005841 Bacteria 4505
12 Ga0068863_100129696 3300005841 Bacteria 2407
13 Ga0068860_100005204 3300005843 Bacteria 13212
14 Ga0068860_100005281 3300005843 Bacteria 13107
15 Ga0081539_10079324 3300005985 Bacteria 1730
16 Ga0075365_10061207 3300006038 Bacteria 2513
17 Ga0075365_10150757 3300006038 Bacteria 1617
18 Ga0075365_10328362 3300006038 Bacteria 1077
19 Ga0075363_100017915 3300006048 Bacteria 3521
20 Ga0105243_10199324 3300009148 Bacteria 1754
21 Ga0105241_10561878 3300009174 Bacteria 1026
22 Ga0105248_10800709 3300009177 Bacteria 1064
23 Ga0105249_10645526 3300009553 Bacteria 1116
24 Ga0157372_10256868 3300013307 Bacteria 2029
25 Ga0157372_10324424 3300013307 Bacteria 1793
26 Ga0157375_10131803 3300013308 Bacteria 2620
27 Ga0157380_10038619 3300014326 Bacteria 3708
28 Ga0182008_10091865 3300014497 Bacteria 1497
29 Ga0157377_10021801 3300014745 Bacteria 3375
30 Ga0157379_10035767 3300014968 Bacteria 4428
31 Ga0207688_10127333 3300025901 Bacteria 1490
32 Ga0207652_10242549 3300025921 Bacteria 1625
33 Ga0207664_10344326 3300025929 Bacteria 1318
34 Ga0207644_10002703 3300025931 Bacteria 11425
35 Ga0207690_10214166 3300025932 Bacteria 1470
36 Ga0207709_10154056 3300025935 Bacteria 1595
37 Ga0207668_10066338 3300025972 Bacteria 2558
38 Ga0207641_10029495 3300026088 Bacteria 4537
39 Ga0207676_10062520 3300026095 Bacteria 2953
40 Ga0268266_10104885 3300028379 Bacteria 2496
41 Ga0268264_10002542 3300028381 Bacteria 16015
42 Ga0268264_10024129 3300028381 Bacteria 4964
43 Ga0307513_10193726 3300031456 Bacteria 1881
44 Ga0307408_100047790 3300031548 Bacteria 3066
45 Ga0307408_100287261 3300031548 Bacteria 1372
46 Ga0307405_10069304 3300031731 Bacteria 2260
47 Ga0307406_10030733 3300031901 Bacteria 3264
48 Ga0307412_10012137 3300031911 Bacteria 5008
49 Ga0307412_10258832 3300031911 Bacteria 1355
50 Ga0307409_100319036 3300031995 Bacteria 1453
51 Ga0307416_100019534 3300032002 Bacteria 4807
52 Ga0307416_100215405 3300032002 Bacteria 1836
53 Ga0307416_100301830 3300032002 Bacteria 1592
54 Ga0307416_100414674 3300032002 Bacteria 1389
55 Ga0373931_0255629 3300035691 Bacteria 1067
56 Ga0436365_0283733 3300039437 Bacteria 1956
57 Ga0436365_1778725 3300039437 Bacteria 2089
58 Ga0451843_0590636 3300041509 Bacteria 980
59 Ga0439442_000003 3300042002 Bacteria 73601
60 Ga0439442_000415 3300042002 Bacteria 10015
61 Ga0466972_0006289 3300044658 Bacteria 5965
62 Ga0466965_0006711 3300044683 Bacteria 5250
63 Ga0466965_0013443 3300044683 Bacteria 3862
64 Ga0466966_0017816 3300044684 Bacteria 4689
65 Ga0466961_0058027 3300044693 Bacteria 2463
66 Ga0466961_0061852 3300044693 Bacteria 2379
67 Ga0466963_0041448 3300044694 Bacteria 3020
68 Ga0466963_0100575 3300044694 Bacteria 1979
69 Ga0466963_0394116 3300044694 Bacteria 976
70 Ga0466964_0004127 3300044706 Bacteria 5346
71 Ga0466971_0018258 3300044719 Bacteria 3106
72 Ga0466968_0067439 3300044735 Bacteria 1552
73 Ga0466970_0006610 3300044765 Bacteria 5799
74 Ga0466957_0032062 3300044842 Bacteria 3144
75 Ga0466957_0067309 3300044842 Bacteria 2209
76 Ga0466960_0030753 3300044901 Bacteria 2473
77 Ga0466960_0194024 3300044901 Bacteria 1106
78 Ga0466958_0137088 3300045836 Bacteria 1539
79 Ga0466967_0060653 3300045976 Bacteria 3353
80 Ga0466967_0094886 3300045976 Bacteria 2717
81 Ga0466967_0188394 3300045976 Bacteria 1949
82 Ga0466967_0246027 3300045976 Bacteria 1707
83 Ga0466967_0249125 3300045976 Bacteria 1696
84 Ga0466967_0301518 3300045976 Bacteria 1541
85 Ga0466967_0734584 3300045976 Bacteria 979
86 Ga0495672_0137024 3300047320 Bacteria 1282
87 Ga0495680_0125528 3300047322 Bacteria 1891
88 Ga0496100_0033178 3300048903 Bacteria 3228
89 Ga0496101_0016321 3300048904 Bacteria 5013
90 Ga0496101_0078424 3300048904 Bacteria 2436
91 Ga0496101_0085229 3300048904 Bacteria 2341
92 Ga0496101_0086266 3300048904 Bacteria 2328
93 Ga0496102_0000275 3300048905 Bacteria 65564
94 Ga0496102_0056596 3300048905 Bacteria 3577
95 Ga0496102_0120486 3300048905 Bacteria 2450
96 Ga0496102_0206453 3300048905 Bacteria 1852
97 Ga0496102_0271232 3300048905 Bacteria 1600
98 Ga0496103_0000138 3300048906 Bacteria 76227
99 Ga0496104_0368804 3300048907 Bacteria 1348
100 Ga0496104_0999203 3300048907 Bacteria 741
101 Ga0496105_0003193 3300048908 Bacteria 12069
102 Ga0496105_0045800 3300048908 Bacteria 3609
103 Ga0496105_0538986 3300048908 Bacteria 912
104 Ga0496106_0253664 3300048909 Bacteria 1407
105 Ga0496107_0014882 3300048910 Bacteria 5447
106 Ga0496107_0105163 3300048910 Bacteria 2072
107 Ga0496107_0260401 3300048910 Bacteria 1290
108 Ga0496108_0046524 3300048911 Bacteria 3625
109 Ga0496109_0116975 3300048912 Bacteria 2481
110 Ga0496111_0087616 3300048914 Bacteria 2279
111 Ga0496111_0514967 3300048914 Bacteria 880
112 Ga0496113_0424785 3300048916 Bacteria 1068
113 Ga0496114_0019382 3300048917 Bacteria 5511
114 Ga0496114_0021575 3300048917 Bacteria 5240
115 Ga0496114_0047211 3300048917 Bacteria 3581
116 Ga0496115_0008773 3300048918 Bacteria 7494
117 Ga0496115_0235341 3300048918 Bacteria 1510
118 Ga0496115_0643930 3300048918 Bacteria 838
119 Ga0496116_0001348 3300048919 Bacteria 27908
120 Ga0496117_0000488 3300048920 Bacteria 65578
121 Ga0496118_0000235 3300048921 Bacteria 97453
122 Ga0496119_0000148 3300048922 Bacteria 98160
123 Ga0496120_0005749 3300048923 Bacteria 9756
124 Ga0496121_0008506 3300048924 Bacteria 12042
125 Ga0496124_0008219 3300048927 Bacteria 10943
126 Ga0496126_0000635 3300048929 Bacteria 65555
127 Ga0501031_0001297 3300049568 Bacteria 15308
128 Ga0501031_0109716 3300049568 Bacteria 1802
129 Ga0501032_0271729 3300049569 Bacteria 1098
130 Ga0501033_0012825 3300049570 Bacteria 6390
131 Ga0501037_0000782 3300049573 Bacteria 23992
132 Ga0501037_0001591 3300049573 Bacteria 16511
133 Ga0501038_0004477 3300049574 Bacteria 12992
134 Ga0501038_0024154 3300049574 Bacteria 5425
135 Ga0501039_0000331 3300049575 Bacteria 33794
136 Ga0501039_0034595 3300049575 Bacteria 3899
137 Ga0501039_0083154 3300049575 Bacteria 2493
138 Ga0501040_0093097 3300049576 Bacteria 2096
139 Ga0501042_0015179 3300049578 Bacteria 5270
140 Ga0501042_0080215 3300049578 Bacteria 2338
141 Ga0501043_0003476 3300049579 Bacteria 12940
142 Ga0501047_0074994 3300049581 Bacteria 3255
143 Ga0501048_0006060 3300049582 Bacteria 9206
144 Ga0501048_0007134 3300049582 Bacteria 8491
145 Ga0501067_0002205 3300049583 Bacteria 10764
146 Ga0501067_0018431 3300049583 Bacteria 3867
147 Ga0501068_0024750 3300049584 Bacteria 3527
148 Ga0501069_0018233 3300049585 Bacteria 3786
149 Ga0501070_0053208 3300049586 Bacteria 3359
150 Ga0501070_0163296 3300049586 Bacteria 1836
151 Ga0501070_0180089 3300049586 Bacteria 1739
152 Ga0501070_0340724 3300049586 Bacteria 1218
153 Ga0501071_0027967 3300049587 Bacteria 3970
154 Ga0501074_0006017 3300049590 Bacteria 8756
155 Ga0501074_0444926 3300049590 Bacteria 919
156 Ga0501080_0012385 3300049742 Bacteria 7818
157 Ga0501083_0008405 3300049744 Bacteria 7298
158 Ga0501035_0006710 3300049822 Bacteria 10757
159 Ga0501035_0188414 3300049822 Bacteria 1774
160 Ga0501044_0186671 3300049823 Bacteria 2038
161 Ga0501044_0259440 3300049823 Bacteria 1676
162 Ga0501045_0077579 3300049824 Bacteria 2448
163 nmdc:mga00v17_9800_c1 3300050491 Bacteria 5204
164 nmdc:mga0yw44_16758_c1 3300050492 Bacteria 3968
165 nmdc:mga0yw44_47628_c1 3300050492 Bacteria 2581
166 nmdc:mga0yw44_72329_c1 3300050492 Bacteria 2143
167 nmdc:mga06z11_184056_c1 3300050494 Bacteria 1206
168 Ga0500556_0000686 3300053104 Bacteria 20844
169 Ga0500593_004886 3300053117 Bacteria 5231
170 Ga0501084_0002835 3300054114 Bacteria 13994
171 Ga0501084_0112134 3300054114 Bacteria 2292
172 Ga0466962_0051804 3300061719 Bacteria 1963
173 2558913050 2558860112 Bacteria 9931328
174 2644099849 2643221617 Bacteria 5139111
175 2644117455 2643221620 Bacteria 5134593
176 2816508608 2816332139 Bacteria 9138787
177 2855388302 2855386786 Bacteria 4752232
178 2857712761 2857710386 Bacteria 3186771
179 2870784240 2870782633 Bacteria 9624083
180 2883823296 2883821847 Bacteria 5121194
181 2915359004 2915358134 Bacteria 6050864
182 2945942708 2945941187 Bacteria 4682474
183 8054107940 8054107350 Bacteria 5022511
184 8054473207 8054472261 Bacteria 7464355
185 Ga0466972_0004461
186 Ga0070668_100034200
187 Ga0070671_100002444
188 Ga0070714_100028151
189 Ga0070700_100236142
190 Ga0070665_100004522
191 Ga0068856_100785356
192 Ga0068864_100088600
193 Ga0068864_100124403
194 Ga0068870_10082483
195 Ga0068863_100039269
196 Ga0068863_100129696
197 Ga0068860_100005204
198 Ga0068860_100005281
199 Ga0081539_10079324
200 Ga0075365_10061207
201 Ga0075365_10150757
202 Ga0075365_10328362
203 Ga0075363_100017915
204 Ga0105243_10199324
205 Ga0105241_10561878
206 Ga0105248_10800709
207 Ga0105249_10645526
208 Ga0157372_10256868
209 Ga0157372_10324424
210 Ga0157375_10131803
211 Ga0157380_10038619
212 Ga0182008_10091865
213 Ga0157377_10021801
214 Ga0157379_10035767
215 Ga0207688_10127333
216 Ga0207652_10242549
217 Ga0207664_10344326
218 Ga0207644_10002703
219 Ga0207690_10214166
220 Ga0207709_10154056
221 Ga0207668_10066338
222 Ga0207641_10029495
223 Ga0207676_10062520
224 Ga0268266_10104885
225 Ga0268264_10002542
226 Ga0268264_10024129
227 Ga0307513_10193726
228 Ga0307408_100047790
229 Ga0307408_100287261
230 Ga0307405_10069304
231 Ga0307406_10030733
232 Ga0307412_10012137
233 Ga0307412_10258832
234 Ga0307409_100319036
235 Ga0307416_100019534
236 Ga0307416_100215405
237 Ga0307416_100301830
238 Ga0307416_100414674
239 Ga0373931_0255629
240 Ga0436365_0283733
241 Ga0436365_1778725
242 Ga0451843_0590636
243 Ga0439442_000003
244 Ga0439442_000415
245 Ga0466972_0006289
246 Ga0466965_0006711
247 Ga0466965_0013443
248 Ga0466966_0017816
249 Ga0466961_0058027
250 Ga0466961_0061852
251 Ga0466963_0041448
252 Ga0466963_0100575
253 Ga0466963_0394116
254 Ga0466964_0004127
255 Ga0466971_0018258
256 Ga0466968_0067439
257 Ga0466970_0006610
258 Ga0466957_0032062
259 Ga0466957_0067309
260 Ga0466960_0030753
261 Ga0466960_0194024
262 Ga0466958_0137088
263 Ga0466967_0060653
264 Ga0466967_0094886
265 Ga0466967_0188394
266 Ga0466967_0246027
267 Ga0466967_0249125
268 Ga0466967_0301518
269 Ga0466967_0734584
270 Ga0495672_0137024
271 Ga0495680_0125528
272 Ga0496100_0033178
273 Ga0496101_0016321
274 Ga0496101_0078424
275 Ga0496101_0085229
276 Ga0496101_0086266
277 Ga0496102_0000275
278 Ga0496102_0056596
279 Ga0496102_0120486
280 Ga0496102_0206453
281 Ga0496102_0271232
282 Ga0496103_0000138
283 Ga0496104_0368804
284 Ga0496104_0999203
285 Ga0496105_0003193
286 Ga0496105_0045800
287 Ga0496105_0538986
288 Ga0496106_0253664
289 Ga0496107_0014882
290 Ga0496107_0105163
291 Ga0496107_0260401
292 Ga0496108_0046524
293 Ga0496109_0116975
294 Ga0496111_0087616
295 Ga0496111_0514967
296 Ga0496113_0424785
297 Ga0496114_0019382
298 Ga0496114_0021575
299 Ga0496114_0047211
300 Ga0496115_0008773
301 Ga0496115_0235341
302 Ga0496115_0643930
303 Ga0496116_0001348
304 Ga0496117_0000488
305 Ga0496118_0000235
306 Ga0496119_0000148
307 Ga0496120_0005749
308 Ga0496121_0008506
309 Ga0496124_0008219
310 Ga0496126_0000635
311 Ga0501031_0001297
312 Ga0501031_0109716
313 Ga0501032_0271729
314 Ga0501033_0012825
315 Ga0501037_0000782
316 Ga0501037_0001591
317 Ga0501038_0004477
318 Ga0501038_0024154
319 Ga0501039_0000331
320 Ga0501039_0034595
321 Ga0501039_0083154
322 Ga0501040_0093097
323 Ga0501042_0015179
324 Ga0501042_0080215
325 Ga0501043_0003476
326 Ga0501047_0074994
327 Ga0501048_0006060
328 Ga0501048_0007134
329 Ga0501067_0002205
330 Ga0501067_0018431
331 Ga0501068_0024750
332 Ga0501069_0018233
333 Ga0501070_0053208
334 Ga0501070_0163296
335 Ga0501070_0180089
336 Ga0501070_0340724
337 Ga0501071_0027967
338 Ga0501074_0006017
339 Ga0501074_0444926
340 Ga0501080_0012385
341 Ga0501083_0008405
342 Ga0501035_0006710
343 Ga0501035_0188414
344 Ga0501044_0186671
345 Ga0501044_0259440
346 Ga0501045_0077579
347 nmdc:mga00v17_9800_c1
348 nmdc:mga0yw44_16758_c1
349 nmdc:mga0yw44_47628_c1
350 nmdc:mga0yw44_72329_c1
351 nmdc:mga06z11_184056_c1
352 Ga0500556_0000686
353 Ga0500593_004886
354 Ga0501084_0002835
355 Ga0501084_0112134
356 Ga0466962_0051804
357 2558913050
358 2644099849
359 2644117455
360 2816508608
361 2855388302
362 2857712761
363 2870784240
364 2883823296
365 2915359004
366 2945942708
367 8054107940
368 8054473207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

48

253

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ojn-assembly1.cif.gz_A sirtuin 4 from xenopus tropicalis in complex with thioacetyl-adp-ribose 0.924 6 271
5oj7-assembly1.cif.gz_A sirtuin 4 orthologue from xenopus tropicalis in complex with adp-ribose 0.9186 6 271
2h2f-assembly1.cif.gz_A the structural basis for sirtuin substrate affinity 0.8692 9 276
5ojn-assembly1.cif.gz_A sirtuin 4 from xenopus tropicalis in complex with thioacetyl-adp-ribose 0.868 6 271
2h2g-assembly1.cif.gz_A the structural basis of sirtuin substrate affinity 0.8678 9 276
ID Description Score Start End Superfamily
af_F1QHM6_40_305_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9302 10 271 3.40.50.1220
1iciA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9209 10 276 3.40.50.1220
af_F1QHM6_40_305_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9133 10 271 3.40.50.1220
4buzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9105 9 271 3.40.50.1220
3jwpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.897 9 276 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A2R7Z1M5-F1-model_v4 NAD-dependent deacetylase 0.9736 10 277 GO:0017136
GO:0046872
GO:0070403
AF-A0A3L8NZI0-F1-model_v4 NAD-dependent protein deacetylase 0.9727 23 276 GO:0017136
GO:0046872
GO:0070403
AF-A0A1G9Z8Y8-F1-model_v4 NAD-dependent protein deacetylase, SIR2 family 0.9675 10 276 GO:0017136
GO:0046872
GO:0070403
AF-A0A0K8Q3P1-F1-model_v4 NAD-dependent protein deacetylase 1 0.9645 49 280 GO:0017136
GO:0046872
GO:0070403
AF-A0A1G9Z8Y8-F1-model_v4 NAD-dependent protein deacetylase, SIR2 family 0.9568 10 276 GO:0017136
GO:0046872
GO:0070403

Map