F283004

General Info

Members Datasets Scaffolds Average Seq Length
184 124 368 160

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0106370|Ga0451577_0106370_316_870
Length 184
Sequence VAERSTTKRGRGAEASPADGTPRRLWAPWRMTFIEAPKPVGCIFCDFPAAEGEENDRRNLIVHRSERAFTVLNRYPYNSGHVMVIPRAHVSRLEDLSAEEFTALHEELRRTAATIRAVYHPEGMNVGMNLGRIAGAGIADHLHYHVVPRWGGDTNFMPVLSDTRVMIEHLDGTWQRIRKGFDAP

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
4 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
59 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
60 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
61 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
62 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
63 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
64 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
65 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
66 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
67 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
70 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
83 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
123 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
124 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 8.7
Rhizosphere 89.67
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0106370 3300042876 Bacteria 2508
2 Ga0065707_10320334 3300005295 Bacteria 968
3 Ga0070701_10303872 3300005438 Unclassified 982
4 Ga0070708_100000607 3300005445 Bacteria 26975
5 Ga0070708_100406059 3300005445 Bacteria 1285
6 Ga0070681_10104354 3300005458 Bacteria 2777
7 Ga0070685_10739371 3300005466 Bacteria 720
8 Ga0070706_100086065 3300005467 Bacteria 2912
9 Ga0070707_100696727 3300005468 Bacteria 979
10 Ga0070698_100071591 3300005471 Bacteria 3477
11 Ga0070699_100060099 3300005518 Bacteria 3292
12 Ga0070679_100678648 3300005530 Bacteria 973
13 Ga0070697_100007678 3300005536 Bacteria 8399
14 Ga0070697_100012208 3300005536 Bacteria 6726
15 Ga0070695_100640637 3300005545 Bacteria 838
16 Ga0070704_100230603 3300005549 Bacteria 1510
17 Ga0068855_100035655 3300005563 Bacteria 5925
18 Ga0070664_100436877 3300005564 Bacteria 1200
19 Ga0070717_10109243 3300006028 Bacteria 2357
20 Ga0070716_100660387 3300006173 Bacteria 794
21 Ga0068871_101475871 3300006358 Unclassified 642
22 Ga0075428_101424742 3300006844 Bacteria 727
23 Ga0075433_10422752 3300006852 Bacteria 1175
24 Ga0075434_101030974 3300006871 Bacteria 836
25 Ga0075436_100005760 3300006914 Bacteria 8517
26 Ga0075435_100012836 3300007076 Bacteria 6210
27 Ga0075435_100246197 3300007076 Bacteria 1521
28 Ga0075435_100420624 3300007076 Bacteria 1151
29 Ga0099794_10000027 3300007265 Bacteria 59551
30 Ga0099794_10405991 3300007265 Bacteria 712
31 Ga0105240_11774160 3300009093 Bacteria 643
32 Ga0111539_10121605 3300009094 Bacteria 3059
33 Ga0111539_10330762 3300009094 Bacteria 1773
34 Ga0111539_10913962 3300009094 Bacteria 1021
35 Ga0114129_10061372 3300009147 Bacteria 5253
36 Ga0114129_10726593 3300009147 Bacteria 1274
37 Ga0105243_10185369 3300009148 Bacteria 1813
38 Ga0099796_10075232 3300010159 Bacteria 1227
39 Ga0099796_10138729 3300010159 Bacteria 949
40 Ga0157370_10036870 3300013104 Bacteria 4743
41 Ga0157370_10234050 3300013104 Bacteria 1700
42 Ga0157369_11355608 3300013105 Bacteria 724
43 Ga0207653_10006301 3300025885 Bacteria 3701
44 Ga0207692_10129917 3300025898 Bacteria 1421
45 Ga0207699_10759526 3300025906 Bacteria 712
46 Ga0207707_10239810 3300025912 Bacteria 1576
47 Ga0207695_10732139 3300025913 Bacteria 869
48 Ga0207693_10000422 3300025915 Bacteria 38519
49 Ga0207700_10542646 3300025928 Unclassified 1031
50 Ga0207664_10404462 3300025929 Bacteria 1215
51 Ga0207706_10281590 3300025933 Bacteria 1450
52 Ga0207665_10013598 3300025939 Bacteria 5354
53 Ga0207679_11432856 3300025945 Bacteria 634
54 Ga0207667_11511314 3300025949 Bacteria 642
55 Ga0207702_10222153 3300026078 Bacteria 1761
56 Ga0207683_10008705 3300026121 Bacteria 8671
57 Ga0209588_1000043 3300027671 Bacteria 56113
58 Ga0207428_10021140 3300027907 Bacteria 5512
59 Ga0207428_10285212 3300027907 Bacteria 1225
60 Ga0265316_10642432 3300031344 Unclassified 751
61 Ga0316579_10032761 3300031691 Bacteria 2385
62 Ga0307405_10083852 3300031731 Bacteria 2090
63 Ga0307405_10121208 3300031731 Unclassified 1790
64 Ga0307413_10946769 3300031824 Bacteria 734
65 Ga0307410_10266379 3300031852 Bacteria 1338
66 Ga0307406_10009785 3300031901 Bacteria 5392
67 Ga0307406_10277565 3300031901 Bacteria 1276
68 Ga0307407_10026593 3300031903 Bacteria 3066
69 Ga0307412_10055592 3300031911 Bacteria 2633
70 Ga0307416_100703946 3300032002 Bacteria 1099
71 Ga0307414_10599108 3300032004 Bacteria 988
72 Ga0373948_0000414 3300034817 Bacteria 5269
73 Ga0373950_0091540 3300034818 Bacteria 646
74 Ga0373929_0004401 3300035085 Bacteria 2526
75 Ga0373940_0018054 3300035088 Bacteria 1765
76 Ga0373949_0024792 3300035090 Bacteria 1396
77 Ga0373951_0001508 3300035091 Bacteria 6084
78 Ga0373939_0011424 3300035114 Bacteria 2240
79 Ga0373941_0001343 3300035115 Bacteria 5177
80 Ga0373960_0001155 3300035121 Bacteria 5734
81 Ga0373946_0036922 3300035171 Bacteria 1984
82 Ga0373942_0072817 3300035207 Bacteria 1006
83 Ga0373961_0012763 3300035241 Bacteria 2108
84 Ga0373962_0004958 3300035242 Bacteria 3219
85 Ga0373927_0047814 3300035695 Bacteria 2767
86 Ga0373927_0206715 3300035695 Bacteria 1289
87 Ga0373947_0013698 3300035725 Bacteria 4646
88 Ga0316582_0030246 3300036647 Bacteria 3297
89 Ga0316582_0474808 3300036647 Unclassified 862
90 Ga0316582_0735717 3300036647 Archaea 677
91 Ga0316584_0652504 3300036712 Archaea 725
92 Ga0395899_0035627 3300037312 Bacteria 3735
93 Ga0395899_0102096 3300037312 Bacteria 2069
94 Ga0395900_0016412 3300037418 Bacteria 7550
95 Ga0395900_0017773 3300037418 Bacteria 7259
96 Ga0395900_0098003 3300037418 Bacteria 3012
97 Ga0395900_0237636 3300037418 Bacteria 1829
98 Ga0395898_0029228 3300037466 Bacteria 5523
99 Ga0395898_0039405 3300037466 Bacteria 4677
100 Ga0395898_0172510 3300037466 Bacteria 2067
101 Ga0395898_0467437 3300037466 Bacteria 1200
102 Ga0395905_0038589 3300037471 Bacteria 4482
103 Ga0395905_0049181 3300037471 Bacteria 3951
104 Ga0395905_0124840 3300037471 Bacteria 2420
105 Ga0395905_0352279 3300037471 Bacteria 1364
106 Ga0316581_0109009 3300037588 Unclassified 853
107 Ga0395901_0000841 3300038443 Bacteria 33814
108 Ga0395901_0017101 3300038443 Bacteria 7394
109 Ga0395901_0018249 3300038443 Bacteria 7163
110 Ga0395901_0019715 3300038443 Bacteria 6894
111 Ga0395901_0023982 3300038443 Bacteria 6258
112 Ga0395901_0156755 3300038443 Bacteria 2391
113 Ga0395901_0177146 3300038443 Bacteria 2236
114 Ga0400489_43015 3300039093 Unclassified 1797
115 Ga0436363_0173231 3300039450 Bacteria 1210
116 Ga0436362_0761167 3300039453 Bacteria 1028
117 Ga0439453_0007272 3300041408 Bacteria 1752
118 Ga0439449_0289042 3300042007 Bacteria 618
119 Ga0439451_009282 3300042009 Bacteria 1991
120 Ga0451577_0000935 3300042876 Bacteria 42928
121 Ga0451577_0095309 3300042876 Bacteria 2657
122 Ga0451577_0188400 3300042876 Bacteria 1861
123 Ga0451577_1684264 3300042876 Bacteria 558
124 Ga0453683_0081877 3300044673 Unclassified 2022
125 Ga0466966_0045300 3300044684 Unclassified 2813
126 Ga0466961_0077889 3300044693 Bacteria 2100
127 Ga0453684_0000696 3300044712 Bacteria 119520
128 Ga0453684_0100238 3300044712 Bacteria 3545
129 Ga0453684_0114509 3300044712 Bacteria 3269
130 Ga0453684_0178248 3300044712 Bacteria 2497
131 Ga0453684_0264788 3300044712 Bacteria 1967
132 Ga0466971_0258977 3300044719 Bacteria 830
133 Ga0466957_0982736 3300044842 Bacteria 606
134 Ga0466959_0000607 3300045049 Bacteria 20899
135 Ga0466959_0100790 3300045049 Bacteria 2067
136 Ga0451576_0557540 3300045051 Bacteria 1204
137 Ga0451576_0987861 3300045051 Bacteria 882
138 Ga0466958_0036642 3300045836 Bacteria 2937
139 Ga0466958_0094432 3300045836 Bacteria 1853
140 Ga0466967_0270359 3300045976 Bacteria 1629
141 Ga0466967_2067541 3300045976 Bacteria 566
142 Ga0495603_0214865 3300046455 Bacteria 1110
143 Ga0495663_0189984 3300046525 Bacteria 714
144 Ga0495640_0270055 3300046533 Bacteria 1061
145 Ga0495586_0222075 3300046535 Bacteria 1074
146 Ga0495586_0257242 3300046535 Bacteria 997
147 Ga0495586_0407077 3300046535 Bacteria 783
148 Ga0495624_0052244 3300046690 Bacteria 2583
149 Ga0495670_0303581 3300046691 Bacteria 856
150 Ga0495674_0067606 3300047319 Bacteria 3095
151 Ga0495676_0733928 3300047321 Bacteria 638
152 Ga0496100_0058979 3300048903 Bacteria 2520
153 Ga0496100_0330547 3300048903 Bacteria 1147
154 Ga0496101_0231836 3300048904 Bacteria 1435
155 Ga0496102_0221060 3300048905 Bacteria 1785
156 Ga0496103_0013755 3300048906 Bacteria 4803
157 Ga0496104_0378839 3300048907 Bacteria 1327
158 Ga0496105_0022365 3300048908 Bacteria 5121
159 Ga0496105_0140557 3300048908 Bacteria 1987
160 Ga0496106_0096943 3300048909 Bacteria 2283
161 Ga0496106_0806287 3300048909 Bacteria 744
162 Ga0496107_0364787 3300048910 Bacteria 1074
163 Ga0496110_0466852 3300048913 Bacteria 1150
164 Ga0496111_0049575 3300048914 Bacteria 3028
165 Ga0496113_0084625 3300048916 Bacteria 2435
166 Ga0496114_0014523 3300048917 Bacteria 6325
167 Ga0496114_0855745 3300048917 Bacteria 789
168 nmdc:mga05p37_55908_c1 3300050507 Bacteria 4859
169 nmdc:mga05p37_907020_c1 3300050507 Bacteria 949
170 nmdc:mga08y16_1695119_c1 3300050511 Bacteria 587
171 nmdc:mga08y16_60633_c1 3300050511 Bacteria 3951
172 nmdc:mga08y16_98658_c1 3300050511 Bacteria 3042
173 nmdc:mga0n895_18027_c1 3300050512 Bacteria 6526
174 nmdc:mga0rr50_11437_c1 3300050513 Bacteria 5684
175 nmdc:mga0rr50_1393_c1 3300050513 Bacteria 13241
176 nmdc:mga0rr50_342874_c1 3300050513 Bacteria 1256
177 nmdc:mga0rr50_467912_c1 3300050513 Bacteria 1070
178 nmdc:mga08x19_14042_c1 3300050514 Bacteria 4853
179 nmdc:mga08x19_36360_c1 3300050514 Bacteria 3119
180 nmdc:mga08x19_447469_c1 3300050514 Bacteria 909
181 nmdc:mga08x19_4789_c1 3300050514 Bacteria 8021
182 nmdc:mga0a205_708354_c1 3300050515 Bacteria 856
183 nmdc:mga0a205_73772_c1 3300050515 Bacteria 3297
184 Ga0500556_0113869 3300053104 Bacteria 1051
185 Ga0451577_0106370
186 Ga0065707_10320334
187 Ga0070701_10303872
188 Ga0070708_100000607
189 Ga0070708_100406059
190 Ga0070681_10104354
191 Ga0070685_10739371
192 Ga0070706_100086065
193 Ga0070707_100696727
194 Ga0070698_100071591
195 Ga0070699_100060099
196 Ga0070679_100678648
197 Ga0070697_100007678
198 Ga0070697_100012208
199 Ga0070695_100640637
200 Ga0070704_100230603
201 Ga0068855_100035655
202 Ga0070664_100436877
203 Ga0070717_10109243
204 Ga0070716_100660387
205 Ga0068871_101475871
206 Ga0075428_101424742
207 Ga0075433_10422752
208 Ga0075434_101030974
209 Ga0075436_100005760
210 Ga0075435_100012836
211 Ga0075435_100246197
212 Ga0075435_100420624
213 Ga0099794_10000027
214 Ga0099794_10405991
215 Ga0105240_11774160
216 Ga0111539_10121605
217 Ga0111539_10330762
218 Ga0111539_10913962
219 Ga0114129_10061372
220 Ga0114129_10726593
221 Ga0105243_10185369
222 Ga0099796_10075232
223 Ga0099796_10138729
224 Ga0157370_10036870
225 Ga0157370_10234050
226 Ga0157369_11355608
227 Ga0207653_10006301
228 Ga0207692_10129917
229 Ga0207699_10759526
230 Ga0207707_10239810
231 Ga0207695_10732139
232 Ga0207693_10000422
233 Ga0207700_10542646
234 Ga0207664_10404462
235 Ga0207706_10281590
236 Ga0207665_10013598
237 Ga0207679_11432856
238 Ga0207667_11511314
239 Ga0207702_10222153
240 Ga0207683_10008705
241 Ga0209588_1000043
242 Ga0207428_10021140
243 Ga0207428_10285212
244 Ga0265316_10642432
245 Ga0316579_10032761
246 Ga0307405_10083852
247 Ga0307405_10121208
248 Ga0307413_10946769
249 Ga0307410_10266379
250 Ga0307406_10009785
251 Ga0307406_10277565
252 Ga0307407_10026593
253 Ga0307412_10055592
254 Ga0307416_100703946
255 Ga0307414_10599108
256 Ga0373948_0000414
257 Ga0373950_0091540
258 Ga0373929_0004401
259 Ga0373940_0018054
260 Ga0373949_0024792
261 Ga0373951_0001508
262 Ga0373939_0011424
263 Ga0373941_0001343
264 Ga0373960_0001155
265 Ga0373946_0036922
266 Ga0373942_0072817
267 Ga0373961_0012763
268 Ga0373962_0004958
269 Ga0373927_0047814
270 Ga0373927_0206715
271 Ga0373947_0013698
272 Ga0316582_0030246
273 Ga0316582_0474808
274 Ga0316582_0735717
275 Ga0316584_0652504
276 Ga0395899_0035627
277 Ga0395899_0102096
278 Ga0395900_0016412
279 Ga0395900_0017773
280 Ga0395900_0098003
281 Ga0395900_0237636
282 Ga0395898_0029228
283 Ga0395898_0039405
284 Ga0395898_0172510
285 Ga0395898_0467437
286 Ga0395905_0038589
287 Ga0395905_0049181
288 Ga0395905_0124840
289 Ga0395905_0352279
290 Ga0316581_0109009
291 Ga0395901_0000841
292 Ga0395901_0017101
293 Ga0395901_0018249
294 Ga0395901_0019715
295 Ga0395901_0023982
296 Ga0395901_0156755
297 Ga0395901_0177146
298 Ga0400489_43015
299 Ga0436363_0173231
300 Ga0436362_0761167
301 Ga0439453_0007272
302 Ga0439449_0289042
303 Ga0439451_009282
304 Ga0451577_0000935
305 Ga0451577_0095309
306 Ga0451577_0188400
307 Ga0451577_1684264
308 Ga0453683_0081877
309 Ga0466966_0045300
310 Ga0466961_0077889
311 Ga0453684_0000696
312 Ga0453684_0100238
313 Ga0453684_0114509
314 Ga0453684_0178248
315 Ga0453684_0264788
316 Ga0466971_0258977
317 Ga0466957_0982736
318 Ga0466959_0000607
319 Ga0466959_0100790
320 Ga0451576_0557540
321 Ga0451576_0987861
322 Ga0466958_0036642
323 Ga0466958_0094432
324 Ga0466967_0270359
325 Ga0466967_2067541
326 Ga0495603_0214865
327 Ga0495663_0189984
328 Ga0495640_0270055
329 Ga0495586_0222075
330 Ga0495586_0257242
331 Ga0495586_0407077
332 Ga0495624_0052244
333 Ga0495670_0303581
334 Ga0495674_0067606
335 Ga0495676_0733928
336 Ga0496100_0058979
337 Ga0496100_0330547
338 Ga0496101_0231836
339 Ga0496102_0221060
340 Ga0496103_0013755
341 Ga0496104_0378839
342 Ga0496105_0022365
343 Ga0496105_0140557
344 Ga0496106_0096943
345 Ga0496106_0806287
346 Ga0496107_0364787
347 Ga0496110_0466852
348 Ga0496111_0049575
349 Ga0496113_0084625
350 Ga0496114_0014523
351 Ga0496114_0855745
352 nmdc:mga05p37_55908_c1
353 nmdc:mga05p37_907020_c1
354 nmdc:mga08y16_1695119_c1
355 nmdc:mga08y16_60633_c1
356 nmdc:mga08y16_98658_c1
357 nmdc:mga0n895_18027_c1
358 nmdc:mga0rr50_11437_c1
359 nmdc:mga0rr50_1393_c1
360 nmdc:mga0rr50_342874_c1
361 nmdc:mga0rr50_467912_c1
362 nmdc:mga08x19_14042_c1
363 nmdc:mga08x19_36360_c1
364 nmdc:mga08x19_447469_c1
365 nmdc:mga08x19_4789_c1
366 nmdc:mga0a205_708354_c1
367 nmdc:mga0a205_73772_c1
368 Ga0500556_0113869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

54

152

0.94

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

36

149

0.77

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

41

151

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.9018 36 161
6af2-assembly1.cif.gz_D-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8916 24 161
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.876 21 161
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.876 21 161
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8701 21 161
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9343 36 125 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9287 36 129 3.30.428.10
af_A0A1D8PKG2_1_175_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9198 36 131 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.914 57 130 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8671 22 133 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A2H9PQ75-F1-model_v4 HIT family hydrolase 0.941 38 133 GO:0000166
GO:0016787
AF-B2WMW8-F1-model_v4 Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.29) 0.9384 36 129 GO:0000166
GO:0047710
AF-A0A4Q2WE26-F1-model_v4 deleted 0.9361 37 130
AF-A0A1H6F610-F1-model_v4 AP-4-A phosphorylase (EC 2.7.7.53) 0.9358 36 130 GO:0003877
AF-A0A537A0R5-F1-model_v4 HIT family protein 0.9233 36 130 GO:0003824

Map